spacer

EBI Dbfetch

ID   CH466545; SV 1; linear; genomic DNA; CON; MUS; 28967849 BP.
XX
AC   CH466545;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009805932 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-28967849
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-28967849
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 898f392bddf6ce1cbb757e2c9f240d0b.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000223.
DR   Ensembl-Gn; ENSMUSG00000000934; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004187; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018008; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018893; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022353; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022360; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022366; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022367; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022371; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022376; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022425; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022558; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022598; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033287; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033669; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033837; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037119; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041453; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044276; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044309; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050014; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063522; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068391; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000958; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016696; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025356; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036176; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037260; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051698; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080371; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089681; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000156032; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167541; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168185; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184885; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..28967849
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             2096..8547
FT                   /estimated_length=6452
FT   gap             10265..10284
FT                   /estimated_length=20
FT   gap             12346..12365
FT                   /estimated_length=20
FT   gap             14436..20777
FT                   /estimated_length=6342
FT   gap             22681..25438
FT                   /estimated_length=2758
FT   gap             29005..29066
FT                   /estimated_length=62
FT   gap             31830..34305
FT                   /estimated_length=2476
FT   gap             42015..42981
FT                   /estimated_length=967
FT   gap             83197..83216
FT                   /estimated_length=20
FT   gap             124356..124754
FT                   /estimated_length=399
FT   gap             130532..130611
FT                   /estimated_length=80
FT   gap             132752..132771
FT                   /estimated_length=20
FT   gap             135775..136084
FT                   /estimated_length=310
FT   gap             155488..155507
FT                   /estimated_length=20
FT   gene            156462..156905
FT                   /pseudo
FT                   /locus_tag="mCG_146390"
FT                   /note="gene_id=mCG146390.0"
FT   mRNA            156462..156905
FT                   /pseudo
FT                   /locus_tag="mCG_146390"
FT                   /note="gene_id=mCG146390.0 transcript_id=mCT186599.0
FT                   created on 14-JUL-2003"
FT   gap             156906..156925
FT                   /estimated_length=20
FT   gap             158405..158424
FT                   /estimated_length=20
FT   gap             160881..161284
FT                   /estimated_length=404
FT   gap             195276..195295
FT                   /estimated_length=20
FT   gap             204074..204205
FT                   /estimated_length=132
FT   gap             205465..205716
FT                   /estimated_length=252
FT   gene            207009..207642
FT                   /pseudo
FT                   /locus_tag="mCG_146391"
FT                   /note="gene_id=mCG146391.0"
FT   mRNA            207009..207642
FT                   /pseudo
FT                   /locus_tag="mCG_146391"
FT                   /note="gene_id=mCG146391.0 transcript_id=mCT186600.0
FT                   created on 14-JUL-2003"
FT   gap             222318..226282
FT                   /estimated_length=3965
FT   gap             237679..237719
FT                   /estimated_length=41
FT   gap             242497..242763
FT                   /estimated_length=267
FT   gap             245621..245677
FT                   /estimated_length=57
FT   gap             312955..313846
FT                   /estimated_length=892
FT   gap             323286..323305
FT                   /estimated_length=20
FT   gap             334475..334494
FT                   /estimated_length=20
FT   gap             341353..341372
FT                   /estimated_length=20
FT   gap             349775..353659
FT                   /estimated_length=3885
FT   gap             359987..360006
FT                   /estimated_length=20
FT   gap             367622..367641
FT                   /estimated_length=20
FT   gap             380507..380546
FT                   /estimated_length=40
FT   gap             388517..388536
FT                   /estimated_length=20
FT   gap             389726..389745
FT                   /estimated_length=20
FT   gap             390998..391017
FT                   /estimated_length=20
FT   gap             398246..398265
FT                   /estimated_length=20
FT   gap             424017..424036
FT                   /estimated_length=20
FT   gap             476022..476041
FT                   /estimated_length=20
FT   gap             486534..486553
FT                   /estimated_length=20
FT   gap             496826..496927
FT                   /estimated_length=102
FT   gap             534944..534963
FT                   /estimated_length=20
FT   gap             552926..553046
FT                   /estimated_length=121
FT   gap             596622..596800
FT                   /estimated_length=179
FT   gap             605316..606485
FT                   /estimated_length=1170
FT   gap             608458..608477
FT                   /estimated_length=20
FT   gap             609777..609812
FT                   /estimated_length=36
FT   gap             614373..614623
FT                   /estimated_length=251
FT   gap             623146..623165
FT                   /estimated_length=20
FT   gap             631511..634250
FT                   /estimated_length=2740
FT   gap             635948..635967
FT                   /estimated_length=20
FT   gap             638564..638583
FT                   /estimated_length=20
FT   gap             640044..640063
FT                   /estimated_length=20
FT   gap             641167..641186
FT                   /estimated_length=20
FT   gap             642355..642374
FT                   /estimated_length=20
FT   gap             643533..643552
FT                   /estimated_length=20
FT   gap             645075..645094
FT                   /estimated_length=20
FT   gap             646753..647598
FT                   /estimated_length=846
FT   gap             651756..651960
FT                   /estimated_length=205
FT   gap             662011..662030
FT                   /estimated_length=20
FT   gap             668318..670074
FT                   /estimated_length=1757
FT   gap             720122..721403
FT                   /estimated_length=1282
FT   gap             722439..722458
FT                   /estimated_length=20
FT   gap             731252..731271
FT                   /estimated_length=20
FT   gap             733311..735379
FT                   /estimated_length=2069
FT   gap             752422..752710
FT                   /estimated_length=289
FT   gap             758330..758349
FT                   /estimated_length=20
FT   gap             759377..759396
FT                   /estimated_length=20
FT   gap             771005..771024
FT                   /estimated_length=20
FT   gap             779025..783427
FT                   /estimated_length=4403
FT   gap             792405..792483
FT                   /estimated_length=79
FT   gap             830735..830917
FT                   /estimated_length=183
FT   gap             844347..852101
FT                   /estimated_length=7755
FT   gap             853824..858214
FT                   /estimated_length=4391
FT   gap             902814..903004
FT                   /estimated_length=191
FT   gap             914084..914103
FT                   /estimated_length=20
FT   gap             920113..924534
FT                   /estimated_length=4422
FT   gap             928944..930174
FT                   /estimated_length=1231
FT   gene            complement(942512..1171751)
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /note="gene_id=mCG20645.2"
FT   mRNA            complement(join(942512..943797,946740..946862,
FT                   1047877..1047909,1104803..1105406,1113517..1113694,
FT                   1114295..1114646,1128751..1129679,1171647..1171751))
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human),
FT                   transcript variant mCT22061"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT22061.2 created
FT                   on 11-JUL-2003"
FT   mRNA            complement(join(942512..943797,946740..946862,
FT                   1104803..1105406,1113517..1113694,1114295..1114646,
FT                   1128751..1129328,1129467..1129679,1146611..1146655,
FT                   1165415..1165511))
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human),
FT                   transcript variant mCT186601"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT186601.0 created
FT                   on 11-JUL-2003"
FT   mRNA            complement(join(942512..943797,946740..946862,
FT                   1104803..1105406,1113517..1114646,1128751..1129683))
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human),
FT                   transcript variant mCT186602"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT186602.0 created
FT                   on 11-JUL-2003"
FT   CDS             complement(join(942736..943797,946740..946862,
FT                   1104803..1105406,1113517..1113694,1114295..1114646,
FT                   1128751..1129328,1129467..1129677))
FT                   /codon_start=1
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT186601.0
FT                   protein_id=mCP107837.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80V18"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR028440"
FT                   /db_xref="MGI:MGI:1927616"
FT                   /db_xref="UniProtKB/TrEMBL:Q80V18"
FT                   /protein_id="EDL29241.1"
FT                   /translation="MVRKKNPPLRNVASEGEGQTLEPTATESKVSGKNKELSADQMSEN
FT                   TDQSDVAELNSKEEHSTHGQEPSSSAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLET
FT                   KEEHKMSPKATEETGPVQSGQANCQGLSPVSVASKNPQVPSDGGVRLSKPKGDLLVNDN
FT                   PDPAPLSPELQDFKCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALH
FT                   NMVQFSHSKDFQKVNRSVLSGVLQDISSSRPALLNGTYDVQVTSGGTFIGIGRKTPDCQ
FT                   GNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPNKIKVSLPSSEGVKPSEKNSNKSIPAL
FT                   RASDSGDVGKWQDKMTVKAGDDTPVGYSVPIKPLDSSRQNDVLLFHYETVHESQASDVK
FT                   QEANHLLGSDGQQAVRDSKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADT
FT                   QSLLEHFNTVHCQEQEITTANGEEGGHAIPTIKEEPKIDLKVYSLLNPDSKMGETVPES
FT                   IVKREKLDDKEGLKDKIWTESSTDDLRGVAWRGADILRGSPSYTQASLGVLTPVSSSQE
FT                   QTKTLRDSPNVEAAHLARPMYGLAVDTKGFLQGAPAGSEKSASLTQQYPASGESKTKDE
FT                   SQSLLRRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNN
FT                   GEQIIRRRTRKRLNPEALQAEQLNKQQRGSGEEQVNGSPLERRSEDHLSESHPREIPLP
FT                   SLSKYEAQGSLTKSHSAQQPVLVSQALDIHKRMQPLHIQIKSPQESTGDPGNSSSVSDG
FT                   KGSSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGVPFVHNDFQSEADWLRFWSKY
FT                   KLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPT
FT                   ANGASKEKTKAPPTVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMS
FT                   CHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE"
FT   CDS             complement(join(942736..943797,946740..946862,
FT                   1047877..1047909,1104803..1105406,1113517..1113694,
FT                   1114295..1114646,1128751..1129677))
FT                   /codon_start=1
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT22061.2
FT                   protein_id=mCP1427.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8K1J0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR028440"
FT                   /db_xref="MGI:MGI:1927616"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1J0"
FT                   /protein_id="EDL29243.1"
FT                   /translation="MVRKKNPPLRNVASEGEGQTLEPTATESKVSGKNKELSADQMSEN
FT                   TDQSDVAELNSKEEHSTHGQEPSSSGKKDLQISGLSEKAGFNYESPSKGGSLVSFPHDE
FT                   VTDRNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEEHKMSPKATEE
FT                   TGPVQSGQANCQGLSPVSVASKNPQVPSDGGVRLSKPKGDLLVNDNPDPAPLSPELQDF
FT                   KCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQK
FT                   VNRSVLSGVLQDISSSRPALLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNF
FT                   TYMGNSSTELEQHFLQTHPNKIKVSLPSSEGVKPSEKNSNKSIPALRASDSGDVGKWQD
FT                   KMTVKAGDDTPVGYSVPIKPLDSSRQNDVLLFHYETVHESQASDVKQEANHLLGSDGQQ
FT                   AVRDSKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSLLEHFNTVHCQ
FT                   EQEITTANGEEGGHAIPTIKEEPKIDLKVYSLLNPDSKMGETVPESIVKREKLDDKEGL
FT                   KDKIWTESSTDDLRGVAWRGADILRGSPSYTQASLGVLTPVSSSQEQTKTLRDSPNVEA
FT                   AHLARPMYGLAVDTKGFLQGAPAGSEKSASLTQQYPASGESKTKDESQSLLRAVTISGT
FT                   PNRRRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGE
FT                   QIIRRRTRKRLNPEALQAEQLNKQQRGSGEEQVNGSPLERRSEDHLSESHPREIPLPSL
FT                   SKYEAQGSLTKSHSAQQPVLVSQALDIHKRMQPLHIQIKSPQESTGDPGNSSSVSDGKG
FT                   SSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGVPFVHNDFQSEADWLRFWSKYKL
FT                   SVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTAN
FT                   GASKEKTKAPPTVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCH
FT                   GDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE"
FT   CDS             complement(join(942736..943797,946740..946862,
FT                   1104803..1105406,1113517..1114646,1128751..1129677))
FT                   /codon_start=1
FT                   /gene="Trps1"
FT                   /locus_tag="mCG_20645"
FT                   /product="trichorhinophalangeal syndrome I (human), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20645.2 transcript_id=mCT186602.0
FT                   protein_id=mCP107836.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UW90"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR028440"
FT                   /db_xref="MGI:MGI:1927616"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW90"
FT                   /protein_id="EDL29242.1"
FT                   /translation="MVRKKNPPLRNVASEGEGQTLEPTATESKVSGKNKELSADQMSEN
FT                   TDQSDVAELNSKEEHSTHGQEPSSSGKKDLQISGLSEKAGFNYESPSKGGSLVSFPHDE
FT                   VTDRNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEEHKMSPKATEE
FT                   TGPVQSGQANCQGLSPVSVASKNPQVPSDGGVRLSKPKGDLLVNDNPDPAPLSPELQDF
FT                   KCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQK
FT                   VNRSVLSGVLQDISSSRPALLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNF
FT                   TYMGNSSTELEQHFLQTHPNKIKVSLPSSEGVKPSEKNSNKSIPALRASDSGDVGKWQD
FT                   KMTVKAGDDTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQ
FT                   HGAVQSGGLNPELNDKLPRGSVINQNDLAKSVEGEPLTKPEKGLSGAKKKDFPSKGAED
FT                   NMVTSYNCQFCDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEK
FT                   HLGEITYPFACRKSNCSHCALLLLHLSPGVAGSSRVKHQCHQCSFSTPDVDVLLFHYET
FT                   VHESQASDVKQEANHLLGSDGQQAVRDSKEHSCTKCDFITQVEEEISRHYRRAHSCYKC
FT                   RQCSFTAADTQSLLEHFNTVHCQEQEITTANGEEGGHAIPTIKEEPKIDLKVYSLLNPD
FT                   SKMGETVPESIVKREKLDDKEGLKDKIWTESSTDDLRGVAWRGADILRGSPSYTQASLG
FT                   VLTPVSSSQEQTKTLRDSPNVEAAHLARPMYGLAVDTKGFLQGAPAGSEKSASLTQQYP
FT                   ASGESKTKDESQSLLRRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTP
FT                   RPLNIIKQNNGEQIIRRRTRKRLNPEALQAEQLNKQQRGSGEEQVNGSPLERRSEDHLS
FT                   ESHPREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQALDIHKRMQPLHIQIKSPQESTGD
FT                   PGNSSSVSDGKGSSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGVPFVHNDFQSE
FT                   ADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDL
FT                   AIKHSRPGPTANGASKEKTKAPPTVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFL
FT                   DEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE"
FT   gap             956508..956527
FT                   /estimated_length=20
FT   gap             959923..959942
FT                   /estimated_length=20
FT   gap             972417..972436
FT                   /estimated_length=20
FT   gap             985329..985348
FT                   /estimated_length=20
FT   gap             1011519..1011538
FT                   /estimated_length=20
FT   gap             1015069..1015088
FT                   /estimated_length=20
FT   gap             1068690..1068709
FT                   /estimated_length=20
FT   gap             1120302..1121268
FT                   /estimated_length=967
FT   gap             1122307..1122467
FT                   /estimated_length=161
FT   gap             1123849..1123887
FT                   /estimated_length=39
FT   gap             1172257..1172922
FT                   /estimated_length=666
FT   gap             1179189..1179314
FT                   /estimated_length=126
FT   gap             1197103..1197122
FT                   /estimated_length=20
FT   gap             1198256..1198275
FT                   /estimated_length=20
FT   gap             1215336..1216802
FT                   /estimated_length=1467
FT   gap             1312314..1312333
FT                   /estimated_length=20
FT   gap             1316684..1316736
FT                   /estimated_length=53
FT   gap             1327284..1327303
FT                   /estimated_length=20
FT   gap             1328398..1332167
FT                   /estimated_length=3770
FT   gap             1335681..1335788
FT                   /estimated_length=108
FT   gap             1346614..1346726
FT                   /estimated_length=113
FT   gap             1357749..1357768
FT                   /estimated_length=20
FT   gap             1386086..1386131
FT                   /estimated_length=46
FT   gap             1390517..1392386
FT                   /estimated_length=1870
FT   gap             1424978..1425213
FT                   /estimated_length=236
FT   gap             1450814..1450833
FT                   /estimated_length=20
FT   gap             1478741..1478760
FT                   /estimated_length=20
FT   gap             1486216..1487234
FT                   /estimated_length=1019
FT   gap             1500442..1500461
FT                   /estimated_length=20
FT   gap             1504004..1504131
FT                   /estimated_length=128
FT   gene            complement(1505478..>1674743)
FT                   /locus_tag="mCG_145471"
FT                   /note="gene_id=mCG145471.0"
FT   mRNA            complement(join(1505478..1506367,1507850..1508147,
FT                   1538768..1539080,1539271..1539364,1622995..1623057,
FT                   1674516..1674661,1674675..>1674743))
FT                   /locus_tag="mCG_145471"
FT                   /product="mCG145471"
FT                   /note="gene_id=mCG145471.0 transcript_id=mCT184895.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(1538937..1539080,1539271..1539364,
FT                   1622995..1623057,1674516..>1674532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145471"
FT                   /product="mCG145471"
FT                   /note="gene_id=mCG145471.0 transcript_id=mCT184895.0
FT                   protein_id=mCP105339.0"
FT                   /protein_id="EDL29244.1"
FT                   /translation="ERTCVSVSAGKKADQWPLTSSPPQAFLWTFLVSSRRKVCDFSKYK
FT                   GKDCHHQMKLSVGVEHVTRTATVIKPSLSKDVYRNLQCFREDGGMHKILFCAAASRRIL
FT                   A"
FT   gap             1546463..1546482
FT                   /estimated_length=20
FT   gap             1551341..1551360
FT                   /estimated_length=20
FT   gap             1554563..1554582
FT                   /estimated_length=20
FT   gap             1564328..1564347
FT                   /estimated_length=20
FT   gap             1591137..1591156
FT                   /estimated_length=20
FT   gap             1656624..1656643
FT                   /estimated_length=20
FT   gap             1658087..1658106
FT                   /estimated_length=20
FT   gap             1660461..1660480
FT                   /estimated_length=20
FT   gap             1683204..1683223
FT                   /estimated_length=20
FT   gap             1733133..1733152
FT                   /estimated_length=20
FT   gap             1770506..1770525
FT                   /estimated_length=20
FT   gap             1774804..1774872
FT                   /estimated_length=69
FT   gap             1794996..1795256
FT                   /estimated_length=261
FT   gap             1811086..1811105
FT                   /estimated_length=20
FT   gap             1816536..1816555
FT                   /estimated_length=20
FT   gap             1823360..1823379
FT                   /estimated_length=20
FT   gap             1824590..1824609
FT                   /estimated_length=20
FT   gene            complement(1830830..1831444)
FT                   /pseudo
FT                   /locus_tag="mCG_146389"
FT                   /note="gene_id=mCG146389.0"
FT   mRNA            complement(1830830..1831444)
FT                   /pseudo
FT                   /locus_tag="mCG_146389"
FT                   /note="gene_id=mCG146389.0 transcript_id=mCT186598.0
FT                   created on 14-JUL-2003"
FT   gap             1865776..1865833
FT                   /estimated_length=58
FT   gap             1870480..1870998
FT                   /estimated_length=519
FT   gap             1886515..1886685
FT                   /estimated_length=171
FT   gap             1891412..1891542
FT                   /estimated_length=131
FT   gap             1895864..1895959
FT                   /estimated_length=96
FT   gap             1897970..1900543
FT                   /estimated_length=2574
FT   gap             1901664..1901948
FT                   /estimated_length=285
FT   gap             1926434..1926453
FT                   /estimated_length=20
FT   gap             1927678..1927697
FT                   /estimated_length=20
FT   gap             1944863..1944882
FT                   /estimated_length=20
FT   gap             1974549..1975523
FT                   /estimated_length=975
FT   gap             1976000..1980726
FT                   /estimated_length=4727
FT   gap             1986302..1986321
FT                   /estimated_length=20
FT   gap             1996895..1996914
FT                   /estimated_length=20
FT   gap             2008520..2008539
FT                   /estimated_length=20
FT   gap             2027176..2027478
FT                   /estimated_length=303
FT   gap             2032364..2032557
FT                   /estimated_length=194
FT   gap             2038104..2038241
FT                   /estimated_length=138
FT   gap             2043204..2043331
FT                   /estimated_length=128
FT   gap             2049147..2049166
FT                   /estimated_length=20
FT   gap             2051659..2052729
FT                   /estimated_length=1071
FT   gap             2054266..2054285
FT                   /estimated_length=20
FT   gene            complement(2074780..2153659)
FT                   /locus_tag="mCG_19540"
FT                   /note="gene_id=mCG19540.2"
FT   mRNA            complement(join(2074780..2075045,2076126..2076258,
FT                   2078179..2078238,2130787..2130798,2153462..2153659))
FT                   /locus_tag="mCG_19540"
FT                   /product="mCG19540, transcript variant mCT171799"
FT                   /note="gene_id=mCG19540.2 transcript_id=mCT171799.1 created
FT                   on 18-JUL-2003"
FT   mRNA            complement(join(2074780..2075045,2076126..2076258,
FT                   2078179..2078299,2084574..2084723,2085799..2085898,
FT                   2087378..2087545,2130642..2130798,2153462..2153659))
FT                   /locus_tag="mCG_19540"
FT                   /product="mCG19540, transcript variant mCT19679"
FT                   /note="gene_id=mCG19540.2 transcript_id=mCT19679.2 created
FT                   on 18-JUL-2003"
FT   CDS             complement(join(2074948..2075045,2076126..2076258,
FT                   2078179..2078238,2130787..2130798,2153462..2153593))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19540"
FT                   /product="mCG19540, isoform CRA_a"
FT                   /note="gene_id=mCG19540.2 transcript_id=mCT171799.1
FT                   protein_id=mCP94716.0 isoform=CRA_a"
FT                   /protein_id="EDL29245.1"
FT                   /translation="MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQIDGLV
FT                   VLKIIKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQAPA
FT                   RMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN"
FT   CDS             complement(join(2074948..2075045,2076126..2076258,
FT                   2078179..2078299,2084574..2084723,2085799..2085898,
FT                   2087378..2087545,2130642..2130798,2153462..2153593))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19540"
FT                   /product="mCG19540, isoform CRA_b"
FT                   /note="gene_id=mCG19540.2 transcript_id=mCT19679.2
FT                   protein_id=mCP1416.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5M9L0"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR027524"
FT                   /db_xref="MGI:MGI:1915385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9L0"
FT                   /protein_id="EDL29246.1"
FT                   /translation="MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQIDGLV
FT                   VLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMM
FT                   RSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLS
FT                   LKAYRLTPKLMEVCKEKDFSPEALKKASITFEHMFEEVPIVIKNSHLINVLMWELEKKS
FT                   AVADKHELLSLASSNHLGKSLQLLMDRVDEMSQDIIKYNTYMRNTSKQQQQKHQYQQRR
FT                   QQENMQRQSRGEPPLPEEDLSKLFKPHQAPARMDSLLIAGQINTYCQNIKEFTAQNLGK
FT                   LFMAQALQEYNN"
FT   gap             2135333..2135352
FT                   /estimated_length=20
FT   gap             2136568..2136587
FT                   /estimated_length=20
FT   gap             2138952..2138982
FT                   /estimated_length=31
FT   gene            2165580..2172171
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /note="gene_id=mCG19539.2"
FT   mRNA            join(2165580..2165850,2169215..2169389,2170350..2172171)
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, transcript variant
FT                   mCT19678"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT19678.2 created
FT                   on 10-JUL-2003"
FT   mRNA            join(2165580..2165850,2170350..2172171)
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, transcript variant
FT                   mCT174551"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT174551.1 created
FT                   on 10-JUL-2003"
FT   CDS             join(2165663..2165850,2169215..2169389,2170350..2170736)
FT                   /codon_start=1
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, isoform CRA_a"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT19678.2
FT                   protein_id=mCP1415.1 isoform=CRA_a"
FT                   /protein_id="EDL29247.1"
FT                   /translation="MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQL
FT                   RDQLPRYLMGETQLCTTRCVLKELETLGKELYGAKLIAQKCQVRNCPHFKSPVSGSECL
FT                   LSMVDEGNPHHYFVATQDQNLSVKVKRTPGIPLMFIIQNTIVLDKPSPRTVAFVKAVEA
FT                   GQLVSVHEKQSIKQLKEEQGLVRNPDLRRRRRKKKKVGGPNPLSCLKKKKKAQDTKSPA
FT                   SEKKRKRKRIRNRSTLKVSSEQQGAEG"
FT   CDS             join(2165663..2165850,2170350..2170368)
FT                   /codon_start=1
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, isoform CRA_b"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT174551.1
FT                   protein_id=mCP97470.1 isoform=CRA_b"
FT                   /db_xref="GOA:G3X989"
FT                   /db_xref="MGI:MGI:1925831"
FT                   /db_xref="UniProtKB/TrEMBL:G3X989"
FT                   /protein_id="EDL29248.1"
FT                   /translation="MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQL
FT                   RDQLPRYLMGETQLCTTRIRTYL"
FT   mRNA            join(2165882..2165952,2169215..2169389,2170350..2172171)
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, transcript variant
FT                   mCT180746"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT180746.1 created
FT                   on 10-JUL-2003"
FT   gap             2168931..2169032
FT                   /estimated_length=102
FT   CDS             join(2169345..2169389,2170350..2170736)
FT                   /codon_start=1
FT                   /gene="D530033C11Rik"
FT                   /locus_tag="mCG_19539"
FT                   /product="RIKEN cDNA D530033C11, isoform CRA_c"
FT                   /note="gene_id=mCG19539.2 transcript_id=mCT180746.1
FT                   protein_id=mCP103668.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3XA22"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="MGI:MGI:1925831"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA22"
FT                   /protein_id="EDL29249.1"
FT                   /translation="MVDEGNPHHYFVATQDQNLSVKVKRTPGIPLMFIIQNTIVLDKPS
FT                   PRTVAFVKAVEAGQLVSVHEKQSIKQLKEEQGLVRNPDLRRRRRKKKKVGGPNPLSCLK
FT                   KKKKAQDTKSPASEKKRKRKRIRNRSTLKVSSEQQGAEG"
FT   gap             2206324..2206343
FT                   /estimated_length=20
FT   gene            complement(2251094..2280123)
FT                   /gene="Rad21"
FT                   /locus_tag="mCG_19537"
FT                   /note="gene_id=mCG19537.2"
FT   mRNA            complement(join(2251094..2252739,2253447..2253530,
FT                   2255074..2255223,2256280..2256428,2256843..2257014,
FT                   2258413..2258636,2260238..2260360,2260694..2260819,
FT                   2261578..2261784,2262329..2262435,2264591..2264690,
FT                   2266537..2266666,2271139..2271313,2279845..2280123))
FT                   /gene="Rad21"
FT                   /locus_tag="mCG_19537"
FT                   /product="RAD21 homolog (S. pombe)"
FT                   /note="gene_id=mCG19537.2 transcript_id=mCT19677.1 created
FT                   on 11-JUL-2003"
FT   CDS             complement(join(2252548..2252739,2253447..2253530,
FT                   2255074..2255223,2256280..2256428,2256843..2257014,
FT                   2258413..2258636,2260238..2260360,2260694..2260819,
FT                   2261578..2261784,2262329..2262435,2264591..2264690,
FT                   2266537..2266666,2271139..2271282))
FT                   /codon_start=1
FT                   /gene="Rad21"
FT                   /locus_tag="mCG_19537"
FT                   /product="RAD21 homolog (S. pombe)"
FT                   /note="gene_id=mCG19537.2 transcript_id=mCT19677.1
FT                   protein_id=mCP1428.1"
FT                   /db_xref="GOA:A1L367"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="MGI:MGI:108016"
FT                   /db_xref="UniProtKB/TrEMBL:A1L367"
FT                   /protein_id="EDL29250.1"
FT                   /translation="MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESII
FT                   SPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAA
FT                   YNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDF
FT                   GMDDREIMREGSAFEDDDMLVSTSASNLLLEPEQSTSNLNEKMNHLEYEDQYKDDNFGE
FT                   GNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNGSLGGPDSPDSV
FT                   DPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQ
FT                   LSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPE
FT                   DLRKRRKGGEADNLDEFLKEFENPEVPREEQQPQQQQPQPQRDVIDEPIIEEPSRLQDS
FT                   VMEASRTTIEESAMPPPPPQGVKRKAGQIDPEPSIPPQQVEQMEIPPVELPPEEPPNIC
FT                   QLIPELELLPEKEKEKEKEKEEEEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALA
FT                   KTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
FT                   "
FT   gap             2268122..2268282
FT                   /estimated_length=161
FT   gap             2280167..2285074
FT                   /estimated_length=4908
FT   gap             2286146..2286274
FT                   /estimated_length=129
FT   gap             2303450..2304485
FT                   /estimated_length=1036
FT   gap             2314307..2317405
FT                   /estimated_length=3099
FT   gene            2328811..2334367
FT                   /gene="Aard"
FT                   /locus_tag="mCG_67145"
FT                   /note="gene_id=mCG67145.2"
FT   mRNA            join(2328811..2329236,2333446..2334367)
FT                   /gene="Aard"
FT                   /locus_tag="mCG_67145"
FT                   /product="alanine and arginine rich domain containing
FT                   protein"
FT                   /note="gene_id=mCG67145.2 transcript_id=mCT67328.3 created
FT                   on 11-JUL-2003"
FT   CDS             join(2328889..2329236,2333446..2333601)
FT                   /codon_start=1
FT                   /gene="Aard"
FT                   /locus_tag="mCG_67145"
FT                   /product="alanine and arginine rich domain containing
FT                   protein"
FT                   /note="gene_id=mCG67145.2 transcript_id=mCT67328.3
FT                   protein_id=mCP24402.3"
FT                   /protein_id="EDL29251.1"
FT                   /translation="MGLGDYSHCRQRMSRGLYGVSGRAALWSPVFHPVHRMPCGTWRIG
FT                   IEVPEHVRASSPVLEHLRRQLERAFQRAAARGRARRAREAVAAVAAAAAAAREERSRTR
FT                   MECALARLRAELLELRFQNHQLARTLLDLNMKMQQLKKRQDQELASKPQSPQDKEMNSE
FT                   CGSA"
FT   gap             2331874..2331999
FT                   /estimated_length=126
FT   gap             2350737..2351028
FT                   /estimated_length=292
FT   gene            2377881..2378626
FT                   /pseudo
FT                   /locus_tag="mCG_114412"
FT                   /note="gene_id=mCG114412.0"
FT   mRNA            2377881..2378626
FT                   /pseudo
FT                   /locus_tag="mCG_114412"
FT                   /note="gene_id=mCG114412.0 transcript_id=mCT115504.0
FT                   created on 11-JUL-2003"
FT   gap             2407388..2407554
FT                   /estimated_length=167
FT   gap             2413009..2413028
FT                   /estimated_length=20
FT   gap             2414995..2415014
FT                   /estimated_length=20
FT   gap             2456001..2456476
FT                   /estimated_length=476
FT   gap             2499949..2500330
FT                   /estimated_length=382
FT   gene            2542769..2543718
FT                   /pseudo
FT                   /locus_tag="mCG_19538"
FT                   /note="gene_id=mCG19538.0"
FT   mRNA            2542769..2543718
FT                   /pseudo
FT                   /locus_tag="mCG_19538"
FT                   /note="gene_id=mCG19538.0 transcript_id=mCT19676.0 created
FT                   on 11-JUL-2003"
FT   gap             2552077..2552383
FT                   /estimated_length=307
FT   gap             2556995..2557160
FT                   /estimated_length=166
FT   gap             2561645..2561664
FT                   /estimated_length=20
FT   gene            2579119..2619863
FT                   /gene="Slc30a8"
FT                   /locus_tag="mCG_114419"
FT                   /note="gene_id=mCG114419.2"
FT   mRNA            join(2579119..2579526,2590020..2590216,2600845..2600991,
FT                   2605269..2605422,2609130..2609280,2615634..2615739,
FT                   2617588..2617722,2619187..2619863)
FT                   /gene="Slc30a8"
FT                   /locus_tag="mCG_114419"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 8"
FT                   /note="gene_id=mCG114419.2 transcript_id=mCT115511.2
FT                   created on 11-JUL-2003"
FT   CDS             join(2579456..2579526,2590020..2590216,2600845..2600991,
FT                   2605269..2605422,2609130..2609280,2615634..2615739,
FT                   2617588..2617722,2619187..2619329)
FT                   /codon_start=1
FT                   /gene="Slc30a8"
FT                   /locus_tag="mCG_114419"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 8"
FT                   /note="gene_id=mCG114419.2 transcript_id=mCT115511.2
FT                   protein_id=mCP60671.2"
FT                   /protein_id="EDL29252.1"
FT                   /translation="MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPE
FT                   AGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAA
FT                   HLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACE
FT                   RLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALG
FT                   DVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGL
FT                   SYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSF
FT                   DLHSLTIQIESAADQDPSCLLCEDPQD"
FT   gap             2613070..2613704
FT                   /estimated_length=635
FT   gap             2615292..2615311
FT                   /estimated_length=20
FT   gap             2633972..2633991
FT                   /estimated_length=20
FT   gap             2636371..2636390
FT                   /estimated_length=20
FT   gap             2637719..2637738
FT                   /estimated_length=20
FT   gap             2639758..2644287
FT                   /estimated_length=4530
FT   gap             2661894..2662084
FT                   /estimated_length=191
FT   gap             2673046..2673088
FT                   /estimated_length=43
FT   gap             2684307..2689210
FT                   /estimated_length=4904
FT   gap             2697998..2699229
FT                   /estimated_length=1232
FT   gap             2708177..2708196
FT                   /estimated_length=20
FT   gap             2710867..2710886
FT                   /estimated_length=20
FT   gap             2744976..2745022
FT                   /estimated_length=47
FT   gene            complement(2765367..2766039)
FT                   /pseudo
FT                   /locus_tag="mCG_12052"
FT                   /note="gene_id=mCG12052.1"
FT   mRNA            complement(2765367..2766039)
FT                   /pseudo
FT                   /locus_tag="mCG_12052"
FT                   /note="gene_id=mCG12052.1 transcript_id=mCT14805.1 created
FT                   on 11-JUL-2003"
FT   gap             2780618..2780637
FT                   /estimated_length=20
FT   gap             2809591..2810845
FT                   /estimated_length=1255
FT   gap             2812765..2813163
FT                   /estimated_length=399
FT   gap             2858002..2858021
FT                   /estimated_length=20
FT   gap             2859550..2859569
FT                   /estimated_length=20
FT   gap             2861689..2861708
FT                   /estimated_length=20
FT   gap             2893730..2893749
FT                   /estimated_length=20
FT   gap             2909195..2909214
FT                   /estimated_length=20
FT   gap             2918402..2918488
FT                   /estimated_length=87
FT   gap             2932413..2932432
FT                   /estimated_length=20
FT   gap             2935119..2935138
FT                   /estimated_length=20
FT   gap             2936757..2936776
FT                   /estimated_length=20
FT   gap             2941273..2945370
FT                   /estimated_length=4098
FT   gap             2955422..2955712
FT                   /estimated_length=291
FT   gap             2964514..2966184
FT                   /estimated_length=1671
FT   gap             2969487..2969506
FT                   /estimated_length=20
FT   gap             2986841..2986860
FT                   /estimated_length=20
FT   gene            2992889..3011517
FT                   /gene="Thrap6"
FT                   /locus_tag="mCG_140878"
FT                   /note="gene_id=mCG140878.1"
FT   mRNA            join(2992889..2993167,2999840..2999998,3001518..3001622,
FT                   3011020..3011517)
FT                   /gene="Thrap6"
FT                   /locus_tag="mCG_140878"
FT                   /product="thyroid hormone receptor associated protein 6"
FT                   /note="gene_id=mCG140878.1 transcript_id=mCT171943.1
FT                   created on 18-JUL-2003"
FT   CDS             join(2992991..2993167,2999840..2999998,3001518..3001622,
FT                   3011020..3011115)
FT                   /codon_start=1
FT                   /gene="Thrap6"
FT                   /locus_tag="mCG_140878"
FT                   /product="thyroid hormone receptor associated protein 6"
FT                   /note="gene_id=mCG140878.1 transcript_id=mCT171943.1
FT                   protein_id=mCP94862.0"
FT                   /protein_id="EDL29253.1"
FT                   /translation="MSTPPLAPTGMASGPFGGPQAQQAAREVNTATLCRIGQETVQDIV
FT                   YRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCG
FT                   GMDPIPVEQLIPYVDEDGSKNDDRAGPPRFASEERREIVEVNKKLKQKNQQLKQIMDQL
FT                   RNLIWDINAMLAMRN"
FT   gap             3004110..3004160
FT                   /estimated_length=51
FT   gap             3009847..3009866
FT                   /estimated_length=20
FT   gap             3011739..3011758
FT                   /estimated_length=20
FT   gap             3022917..3022936
FT                   /estimated_length=20
FT   gap             3029994..3030116
FT                   /estimated_length=123
FT   gap             3032350..3032369
FT                   /estimated_length=20
FT   gap             3056205..3056408
FT                   /estimated_length=204
FT   gap             3080516..3081107
FT                   /estimated_length=592
FT   gap             3094652..3095260
FT                   /estimated_length=609
FT   gap             3098524..3098543
FT                   /estimated_length=20
FT   gap             3105891..3105910
FT                   /estimated_length=20
FT   gap             3108637..3108656
FT                   /estimated_length=20
FT   gap             3114112..3114229
FT                   /estimated_length=118
FT   gap             3125589..3125608
FT                   /estimated_length=20
FT   gap             3129760..3129779
FT                   /estimated_length=20
FT   gap             3134202..3134221
FT                   /estimated_length=20
FT   gap             3146915..3147980
FT                   /estimated_length=1066
FT   gap             3149646..3150242
FT                   /estimated_length=597
FT   gap             3151510..3151529
FT                   /estimated_length=20
FT   gap             3197545..3197648
FT                   /estimated_length=104
FT   gap             3214352..3214588
FT                   /estimated_length=237
FT   gap             3226181..3226200
FT                   /estimated_length=20
FT   gap             3244789..3244816
FT                   /estimated_length=28
FT   gap             3254631..3254650
FT                   /estimated_length=20
FT   gap             3295171..3295190
FT                   /estimated_length=20
FT   gap             3297873..3297892
FT                   /estimated_length=20
FT   gap             3309085..3309104
FT                   /estimated_length=20
FT   gap             3310209..3310228
FT                   /estimated_length=20
FT   gap             3311869..3311888
FT                   /estimated_length=20
FT   gap             3312932..3312951
FT                   /estimated_length=20
FT   gap             3320667..3320784
FT                   /estimated_length=118
FT   gene            complement(3337134..>3618242)
FT                   /gene="Ext1"
FT                   /locus_tag="mCG_114525"
FT                   /note="gene_id=mCG114525.2"
FT   mRNA            complement(join(3337134..3337549,3341993..3342164,
FT                   3344377..3344537,3351696..3351785,3356667..3356762,
FT                   3358528..3358646,3360878..3361010,3370279..3370398,
FT                   3374637..3374744,3376087..3376180,3616693..3618242))
FT                   /gene="Ext1"
FT                   /locus_tag="mCG_114525"
FT                   /product="exostoses (multiple) 1, transcript variant
FT                   mCT115617"
FT                   /note="gene_id=mCG114525.2 transcript_id=mCT115617.2
FT                   created on 14-JUL-2003"
FT   mRNA            complement(join(3337239..3337549,3341993..3342164,
FT                   3344377..3344537,3351696..3351774,3356658..3356762,
FT                   3358528..3358646,3360878..3361010,3370279..3370398,
FT                   3374637..3374744,3376087..3376180,3616693..>3618242))
FT                   /gene="Ext1"
FT                   /locus_tag="mCG_114525"
FT                   /product="exostoses (multiple) 1, transcript variant
FT                   mCT192637"
FT                   /note="gene_id=mCG114525.2 transcript_id=mCT192637.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(3337364..3337549,3341993..3342164,
FT                   3344377..3344537,3351696..3351785,3356667..3356762,
FT                   3358528..3358646,3360878..3361010,3370279..3370398,
FT                   3374637..3374744,3376087..3376180,3616693..3617654))
FT                   /codon_start=1
FT                   /gene="Ext1"
FT                   /locus_tag="mCG_114525"
FT                   /product="exostoses (multiple) 1, isoform CRA_a"
FT                   /note="gene_id=mCG114525.2 transcript_id=mCT115617.2
FT                   protein_id=mCP60289.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V1P4"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR015338"
FT                   /db_xref="MGI:MGI:894663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1P4"
FT                   /protein_id="EDL29254.1"
FT                   /translation="MQAKKRYFILLSAGSCLALLFYFGGVQFRASRSHSRREEHSGRNG
FT                   LHQPSPDHFWPRFPDALRPFFPWDQLENEDSSVHISPRQKRDANSSIYKGKKCRMESCF
FT                   DFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDR
FT                   DQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASIS
FT                   TENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRN
FT                   ALYHVHNGEDVLLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGR
FT                   RLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQD
FT                   KILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQY
FT                   SSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLW
FT                   NCDKPLPAKHRWPATAVPVIVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVD
FT                   FAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYS
FT                   HYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTSRASRWAD
FT                   PDHFAQRQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL"
FT   CDS             complement(join(3351757..3351774,3356658..3356762,
FT                   3358528..3358646,3360878..3361010,3370279..3370398,
FT                   3374637..3374744,3376087..3376180,3616693..>3617696))
FT                   /codon_start=1
FT                   /gene="Ext1"
FT                   /locus_tag="mCG_114525"
FT                   /product="exostoses (multiple) 1, isoform CRA_b"
FT                   /note="gene_id=mCG114525.2 transcript_id=mCT192637.0
FT                   protein_id=mCP113551.0 isoform=CRA_b"
FT                   /protein_id="EDL29255.1"
FT                   /translation="FLCLFTILLTQAGHMQAKKRYFILLSAGSCLALLFYFGGVQFRAS
FT                   RSHSRREEHSGRNGLHQPSPDHFWPRFPDALRPFFPWDQLENEDSSVHISPRQKRDANS
FT                   SIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPS
FT                   QACLFVLSLDTLDRDQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVG
FT                   FDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFK
FT                   GKRYLTGIGSDTRNALYHVHNGEDVLLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYRE
FT                   MLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERL
FT                   LLQIPSTIRSIHQDKILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLI
FT                   WNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVA
FT                   AAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVIVIEGESKVGGPVSAL"
FT   gap             3363107..3363126
FT                   /estimated_length=20
FT   gap             3374068..3374105
FT                   /estimated_length=38
FT   gap             3394572..3394700
FT                   /estimated_length=129
FT   gap             3438457..3438621
FT                   /estimated_length=165
FT   gap             3449014..3449033
FT                   /estimated_length=20
FT   gap             3456662..3456681
FT                   /estimated_length=20
FT   gap             3501917..3501936
FT                   /estimated_length=20
FT   gap             3555246..3555265
FT                   /estimated_length=20
FT   gene            3575185..3595769
FT                   /locus_tag="mCG_145472"
FT                   /note="gene_id=mCG145472.0"
FT   mRNA            join(3575185..3575207,3592374..3592482,3592509..3593935,
FT                   3594016..3595769)
FT                   /locus_tag="mCG_145472"
FT                   /product="mCG145472"
FT                   /note="gene_id=mCG145472.0 transcript_id=mCT184896.0
FT                   created on 05-JUN-2003"
FT   CDS             3593478..3593783
FT                   /codon_start=1
FT                   /locus_tag="mCG_145472"
FT                   /product="mCG145472"
FT                   /note="gene_id=mCG145472.0 transcript_id=mCT184896.0
FT                   protein_id=mCP105340.0"
FT                   /protein_id="EDL29256.1"
FT                   /translation="MPSSLRCQGRSTLPSLFLRNGNQQGIPEQGHSLTCMGKTRTNTHG
FT                   NIKSRGEKKIQSQCVILNHSPSDTKLHRSFMSHLGKVVERKTLDGIMCAHYQHLEW"
FT   gap             3606843..3606862
FT                   /estimated_length=20
FT   gap             3608817..3608836
FT                   /estimated_length=20
FT   gap             3610495..3610514
FT                   /estimated_length=20
FT   gap             3614924..3615004
FT                   /estimated_length=81
FT   gap             3618479..3618542
FT                   /estimated_length=64
FT   gap             3648392..3649985
FT                   /estimated_length=1594
FT   gap             3650695..3651661
FT                   /estimated_length=967
FT   gap             3652730..3653727
FT                   /estimated_length=998
FT   gap             3670270..3670490
FT                   /estimated_length=221
FT   gap             3672917..3672936
FT                   /estimated_length=20
FT   gap             3679162..3679181
FT                   /estimated_length=20
FT   gap             3713129..3713148
FT                   /estimated_length=20
FT   gap             3714641..3714660
FT                   /estimated_length=20
FT   gap             3716146..3716165
FT                   /estimated_length=20
FT   gap             3727094..3727165
FT                   /estimated_length=72
FT   gene            complement(3736346..3997769)
FT                   /gene="Samd12"
FT                   /locus_tag="mCG_50866"
FT                   /note="gene_id=mCG50866.2"
FT   mRNA            complement(join(3736346..3736761,3927576..3927716,
FT                   3990878..3990945,3997613..3997769))
FT                   /gene="Samd12"
FT                   /locus_tag="mCG_50866"
FT                   /product="sterile alpha motif domain containing 12"
FT                   /note="gene_id=mCG50866.2 transcript_id=mCT51049.2 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(3736739..3736761,3927576..3927716,
FT                   3990878..3990945,3997613..3997653))
FT                   /codon_start=1
FT                   /gene="Samd12"
FT                   /locus_tag="mCG_50866"
FT                   /product="sterile alpha motif domain containing 12"
FT                   /note="gene_id=mCG50866.2 transcript_id=mCT51049.2
FT                   protein_id=mCP28255.2"
FT                   /protein_id="EDL29257.1"
FT                   /translation="MDLWAHCPTIRVVWLKKHCPNQYQLYSESFKQHDITGRALLRLTD
FT                   KKLERMGIAQENQRQHILQQVLQLKVREEVRNLQLLTQASVECSP"
FT   gap             3842044..3842068
FT                   /estimated_length=25
FT   gap             3848625..3848825
FT                   /estimated_length=201
FT   gap             3858270..3858289
FT                   /estimated_length=20
FT   gap             3859658..3859677
FT                   /estimated_length=20
FT   gene            3890889..3892505
FT                   /locus_tag="mCG_147989"
FT                   /note="gene_id=mCG147989.0"
FT   mRNA            join(3890889..3891372,3892429..3892505)
FT                   /locus_tag="mCG_147989"
FT                   /product="mCG147989"
FT                   /note="gene_id=mCG147989.0 transcript_id=mCT188252.0
FT                   created on 13-JAN-2004"
FT   CDS             3891112..3891309
FT                   /codon_start=1
FT                   /locus_tag="mCG_147989"
FT                   /product="mCG147989"
FT                   /note="gene_id=mCG147989.0 transcript_id=mCT188252.0
FT                   protein_id=mCP108952.0"
FT                   /protein_id="EDL29258.1"
FT                   /translation="MLEERHLTRKSPMNQVAHRFTWWKKRTRKDAKLKNDKLPPGKSQF
FT                   LICIGTLALYLLKLKNMLEN"
FT   gap             3931545..3931564
FT                   /estimated_length=20
FT   gap             3941026..3941045
FT                   /estimated_length=20
FT   gap             3944257..3944276
FT                   /estimated_length=20
FT   gap             3972232..3972251
FT                   /estimated_length=20
FT   gap             3990946..3990965
FT                   /estimated_length=20
FT   gap             3992651..3992863
FT                   /estimated_length=213
FT   gap             4002764..4002783
FT                   /estimated_length=20
FT   gap             4073004..4073464
FT                   /estimated_length=461
FT   gap             4085536..4085816
FT                   /estimated_length=281
FT   gap             4101944..4101963
FT                   /estimated_length=20
FT   gap             4112930..4112996
FT                   /estimated_length=67
FT   gap             4130637..4130918
FT                   /estimated_length=282
FT   gap             4156921..4156940
FT                   /estimated_length=20
FT   gap             4158177..4158196
FT                   /estimated_length=20
FT   gap             4161912..4161931
FT                   /estimated_length=20
FT   gap             4164678..4165153
FT                   /estimated_length=476
FT   gap             4169726..4169745
FT                   /estimated_length=20
FT   gap             4191042..4191061
FT                   /estimated_length=20
FT   gap             4192711..4192870
FT                   /estimated_length=160
FT   gap             4197085..4198519
FT                   /estimated_length=1435
FT   gap             4220370..4220574
FT                   /estimated_length=205
FT   gap             4231492..4236712
FT                   /estimated_length=5221
FT   gap             4246311..4246330
FT                   /estimated_length=20
FT   gap             4270977..4271091
FT                   /estimated_length=115
FT   gap             4278421..4278440
FT                   /estimated_length=20
FT   gap             4298028..4298124
FT                   /estimated_length=97
FT   gene            complement(4317145..4317606)
FT                   /pseudo
FT                   /locus_tag="mCG_3133"
FT                   /note="gene_id=mCG3133.0"
FT   mRNA            complement(join(4317145..4317277,4317395..4317606))
FT                   /pseudo
FT                   /locus_tag="mCG_3133"
FT                   /note="gene_id=mCG3133.0 transcript_id=mCT2436.1 created on
FT                   31-OCT-2002"
FT   gap             4324390..4333182
FT                   /estimated_length=8793
FT   gap             4364929..4364948
FT                   /estimated_length=20
FT   gap             4385471..4385490
FT                   /estimated_length=20
FT   gap             4390509..4390528
FT                   /estimated_length=20
FT   gap             4392079..4392098
FT                   /estimated_length=20
FT   gap             4412753..4412928
FT                   /estimated_length=176
FT   gap             4415262..4415767
FT                   /estimated_length=506
FT   gap             4417143..4417162
FT                   /estimated_length=20
FT   gap             4420659..4421097
FT                   /estimated_length=439
FT   gap             4435423..4435442
FT                   /estimated_length=20
FT   gap             4460004..4460023
FT                   /estimated_length=20
FT   gap             4461716..4461735
FT                   /estimated_length=20
FT   gene            complement(4518529..4544861)
FT                   /gene="Tnfrsf11b"
FT                   /locus_tag="mCG_3137"
FT                   /note="gene_id=mCG3137.1"
FT   mRNA            complement(join(4518529..4518946,4520605..4520829,
FT                   4522548..4522739,4526367..4526733,4544739..4544861))
FT                   /gene="Tnfrsf11b"
FT                   /locus_tag="mCG_3137"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 11b (osteoprotegerin)"
FT                   /note="gene_id=mCG3137.1 transcript_id=mCT2427.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(4518558..4518946,4520605..4520829,
FT                   4522548..4522739,4526367..4526733,4544739..4544771))
FT                   /codon_start=1
FT                   /gene="Tnfrsf11b"
FT                   /locus_tag="mCG_3137"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 11b (osteoprotegerin)"
FT                   /note="gene_id=mCG3137.1 transcript_id=mCT2427.1
FT                   protein_id=mCP5520.2"
FT                   /protein_id="EDL29259.1"
FT                   /translation="MNKWLCCALLVLLDIIEWTTQETLPPKYLHYDPETGHQLLCDKCA
FT                   PGTYLKQHCTVRRKTLCVPCPDHSYTDSWHTSDECVYCSPVCKELQSVKQECNRTHNRV
FT                   CECEEGRYLEIEFCLKHRSCPPGSGVVQAGTPEQNTVCKKCPDGFFSGETSSKAPCRKH
FT                   TNCSTFGLLLIQKGNATHDNVCSGNREATQKCGIDVTLCEEAFFRFAVPTKIIPNWLSV
FT                   LVDSLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSV
FT                   QRHLGHSNLTTEQLLALMESLPGKKISPEEIERTRKTCKSSEQLLKLLSLWRIKNGDQD
FT                   TLKGLMYALKHLKTSHFPKTVTHSLRKTMRFLHSFTMYRLYQKLFLEMIGNQVQSVKIS
FT                   CL"
FT   gap             4556751..4556770
FT                   /estimated_length=20
FT   gap             4557261..4557708
FT                   /estimated_length=448
FT   gap             4564695..4564936
FT                   /estimated_length=242
FT   gap             4596607..4596626
FT                   /estimated_length=20
FT   gap             4608956..4609631
FT                   /estimated_length=676
FT   gene            4678090..>4724666
FT                   /gene="Colec10"
FT                   /locus_tag="mCG_3134"
FT                   /note="gene_id=mCG3134.2"
FT   mRNA            join(4678090..4678246,4703495..4703566,4707662..4707733,
FT                   4719404..4719457,4721787..4721882,4724275..>4724666)
FT                   /gene="Colec10"
FT                   /locus_tag="mCG_3134"
FT                   /product="collectin sub-family member 10"
FT                   /note="gene_id=mCG3134.2 transcript_id=mCT2437.2 created on
FT                   31-OCT-2002"
FT   CDS             join(4678099..4678246,4703495..4703566,4707662..4707733,
FT                   4719404..4719457,4721787..4721882,4724275..4724666)
FT                   /codon_start=1
FT                   /gene="Colec10"
FT                   /locus_tag="mCG_3134"
FT                   /product="collectin sub-family member 10"
FT                   /note="gene_id=mCG3134.2 transcript_id=mCT2437.2
FT                   protein_id=mCP5557.2"
FT                   /protein_id="EDL29260.1"
FT                   /translation="MNGFRVLLRSNLSMLLLLALLHFQSLGLDVDSRSAAEVCATHTIS
FT                   PGPKGDDGERGDTGEEGKDGKVGRQGPKGVKGELGDMGAQGNIGKSGPIGKKGDKGEKG
FT                   LLGIPGEKGKAGTICDCGRYRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIV
FT                   QEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVF
FT                   TDNTPLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK"
FT   gap             4705899..4705958
FT                   /estimated_length=60
FT   gap             4714970..4715634
FT                   /estimated_length=665
FT   gap             4750520..4750539
FT                   /estimated_length=20
FT   gap             4757506..4757938
FT                   /estimated_length=433
FT   gap             4766899..4766918
FT                   /estimated_length=20
FT   gap             4769020..4769039
FT                   /estimated_length=20
FT   gap             4801757..4801776
FT                   /estimated_length=20
FT   gene            4833741..4864876
FT                   /gene="Mal2"
FT                   /locus_tag="mCG_3135"
FT                   /note="gene_id=mCG3135.1"
FT   mRNA            join(4833741..4833892,4850341..4850511,4860426..4860581,
FT                   4862684..4863050,4863066..4864876)
FT                   /gene="Mal2"
FT                   /locus_tag="mCG_3135"
FT                   /product="mal, T-cell differentiation protein 2"
FT                   /note="gene_id=mCG3135.1 transcript_id=mCT2439.1 created on
FT                   31-OCT-2002"
FT   CDS             join(4833764..4833892,4850341..4850511,4860426..4860581,
FT                   4862684..4862755)
FT                   /codon_start=1
FT                   /gene="Mal2"
FT                   /locus_tag="mCG_3135"
FT                   /product="mal, T-cell differentiation protein 2"
FT                   /note="gene_id=mCG3135.1 transcript_id=mCT2439.1
FT                   protein_id=mCP5560.2"
FT                   /db_xref="GOA:Q2KHK7"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="InterPro:IPR013295"
FT                   /db_xref="MGI:MGI:2146021"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KHK7"
FT                   /protein_id="EDL29261.1"
FT                   /translation="MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVL
FT                   GGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGLFLSGMVTQIDANWNFLDFVY
FT                   HFIVFVFYFGAFLLEAAATSLHDLQCNTTMTVKPLLNDNQYNINVAATVFAFMTTACYG
FT                   CSLGLALRRWRP"
FT   gap             4833992..4834013
FT                   /estimated_length=22
FT   gap             4845126..4845235
FT                   /estimated_length=110
FT   gap             4856837..4857203
FT                   /estimated_length=367
FT   gap             4918473..4918522
FT                   /estimated_length=50
FT   gap             4921724..4922283
FT                   /estimated_length=560
FT   gap             4942589..4942936
FT                   /estimated_length=348
FT   gap             4944868..4945070
FT                   /estimated_length=203
FT   gap             4947294..4947907
FT                   /estimated_length=614
FT   gap             4963395..4963593
FT                   /estimated_length=199
FT   gap             4977367..4977386
FT                   /estimated_length=20
FT   gap             4978576..4978595
FT                   /estimated_length=20
FT   gap             4983212..4983231
FT                   /estimated_length=20
FT   gap             4989445..4989654
FT                   /estimated_length=210
FT   gap             4995798..4995846
FT                   /estimated_length=49
FT   gene            4996198..5004172
FT                   /gene="Nov"
FT                   /locus_tag="mCG_3138"
FT                   /note="gene_id=mCG3138.3"
FT   mRNA            join(4996198..4996533,4996668..4996893,4998219..4998479,
FT                   4999574..4999788,5002645..5004172)
FT                   /gene="Nov"
FT                   /locus_tag="mCG_3138"
FT                   /product="nephroblastoma overexpressed gene"
FT                   /note="gene_id=mCG3138.3 transcript_id=mCT2428.3 created on
FT                   12-JUN-2003"
FT   CDS             join(4996468..4996533,4996668..4996893,4998219..4998479,
FT                   4999574..4999788,5002645..5002941)
FT                   /codon_start=1
FT                   /gene="Nov"
FT                   /locus_tag="mCG_3138"
FT                   /product="nephroblastoma overexpressed gene"
FT                   /note="gene_id=mCG3138.3 transcript_id=mCT2428.3
FT                   protein_id=mCP5526.2"
FT                   /protein_id="EDL29262.1"
FT                   /translation="MSLFLRKRCLCLGFLLFHLLSQVSASLRCPSRCPPKCPSISPTCA
FT                   PGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNC
FT                   VFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCE
FT                   KWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVS
FT                   TRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSL
FT                   YTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEA
FT                   FLQDLELKTSRGEI"
FT   gene            complement(5002884..>5003365)
FT                   /locus_tag="mCG_116454"
FT                   /note="gene_id=mCG116454.2"
FT   mRNA            complement(join(5002884..5003210,5003319..>5003365))
FT                   /locus_tag="mCG_116454"
FT                   /product="mCG116454"
FT                   /note="gene_id=mCG116454.2 transcript_id=mCT117576.2
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(5003062..5003210,5003319..>5003364))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116454"
FT                   /product="mCG116454"
FT                   /note="gene_id=mCG116454.2 transcript_id=mCT117576.2
FT                   protein_id=mCP60313.2"
FT                   /protein_id="EDL29263.1"
FT                   /translation="IYIYIYIYIYIYIYIYHLCDLNLYKFALVINSTGKEVTFKPYPEL
FT                   TLILSLHSEHLSLKKKRQI"
FT   gap             5029383..5030950
FT                   /estimated_length=1568
FT   gap             5032191..5032210
FT                   /estimated_length=20
FT   gap             5033417..5033436
FT                   /estimated_length=20
FT   gap             5054912..5054931
FT                   /estimated_length=20
FT   gap             5057852..5058268
FT                   /estimated_length=417
FT   gap             5059802..5060013
FT                   /estimated_length=212
FT   gap             5068522..5068953
FT                   /estimated_length=432
FT   gene            complement(5093569..5207849)
FT                   /gene="Enpp2"
FT                   /locus_tag="mCG_3131"
FT                   /note="gene_id=mCG3131.2"
FT   mRNA            complement(join(5093569..5094205,5099049..5099205,
FT                   5100483..5100615,5101919..5101996,5102847..5102982,
FT                   5104661..5104797,5114738..5114789,5117193..5117377,
FT                   5118433..5118520,5118679..5118766,5120605..5120732,
FT                   5121422..5121453,5124866..5124991,5130382..5130490,
FT                   5136864..5136936,5137707..5137772,5142718..5142773,
FT                   5152246..5152365,5153453..5153532,5153842..5153939,
FT                   5155902..5155962,5161370..5161495,5164578..5164733,
FT                   5174545..5174644,5207505..5207849))
FT                   /gene="Enpp2"
FT                   /locus_tag="mCG_3131"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   2, transcript variant mCT171580"
FT                   /note="gene_id=mCG3131.2 transcript_id=mCT171580.0 created
FT                   on 08-AUG-2002"
FT   mRNA            complement(join(5093569..5094205,5099049..5099205,
FT                   5100483..5100615,5101919..5101996,5102847..5102982,
FT                   5104661..5104797,5114738..5114789,5117193..5117377,
FT                   5118433..5118520,5118679..5118766,5120605..5120732,
FT                   5121422..5121453,5124866..5124991,5130382..5130490,
FT                   5136864..5136936,5137707..5137772,5142718..5142773,
FT                   5152246..5152365,5153453..5153532,5153842..5153939,
FT                   5155902..5155962,5161370..5161495,5164578..5164733,
FT                   5174545..5174644,5174875..5175062))
FT                   /gene="Enpp2"
FT                   /locus_tag="mCG_3131"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   2, transcript variant mCT2434"
FT                   /note="gene_id=mCG3131.2 transcript_id=mCT2434.2 created on
FT                   08-AUG-2002"
FT   CDS             complement(join(5094035..5094205,5099049..5099205,
FT                   5100483..5100615,5101919..5101996,5102847..5102982,
FT                   5104661..5104797,5114738..5114789,5117193..5117377,
FT                   5118433..5118520,5118679..5118766,5120605..5120732,
FT                   5121422..5121453,5124866..5124991,5130382..5130490,
FT                   5136864..5136936,5137707..5137772,5142718..5142773,
FT                   5152246..5152365,5153453..5153532,5153842..5153939,
FT                   5155902..5155962,5161370..5161495,5164578..5164733,
FT                   5174545..5174644,5207505..5207723))
FT                   /codon_start=1
FT                   /gene="Enpp2"
FT                   /locus_tag="mCG_3131"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG3131.2 transcript_id=mCT171580.0
FT                   protein_id=mCP94499.0 isoform=CRA_a"
FT                   /protein_id="EDL29264.1"
FT                   /translation="MESLSPGDSGGPLTPSALEKSQKQTVQRKQAQSGAGSAGLSSQVP
FT                   GPQPRLCPQRPGWSEAPGRRSMSRHADPVISLFTFAIGVNLCLGFTASRIKRAEWDEGP
FT                   PTVLSDSPWTNTSGSCKGRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWE
FT                   CTKDRCGEVRNEENACHCSEDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGF
FT                   VRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATG
FT                   LYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVS
FT                   IPHERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQ
FT                   LMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKI
FT                   PNNLKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYANNRRIEDLHLLVERRWHVAR
FT                   KPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCD
FT                   LLGLKPAPNNGTHGSLNHLLRTNTFRPTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKVE
FT                   PKNKLEELNKRLHTKGSTEERHLLYGRPAVLYRTSYDILYHTDFESGYSEIFLMPLWTS
FT                   YTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGFLFPPYLSSSPEA
FT                   KYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIED
FT                   EIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSE
FT                   DESKWVEELMKMHTARVRDIEHLTGLDFYRKTSRSYSEILTLKTYLHTYESEI"
FT   CDS             complement(join(5094035..5094205,5099049..5099205,
FT                   5100483..5100615,5101919..5101996,5102847..5102982,
FT                   5104661..5104797,5114738..5114789,5117193..5117377,
FT                   5118433..5118520,5118679..5118766,5120605..5120732,
FT                   5121422..5121453,5124866..5124991,5130382..5130490,
FT                   5136864..5136936,5137707..5137772,5142718..5142773,
FT                   5152246..5152365,5153453..5153532,5153842..5153939,
FT                   5155902..5155962,5161370..5161495,5164578..5164733,
FT                   5174545..5174644,5174875..5174907))
FT                   /codon_start=1
FT                   /gene="Enpp2"
FT                   /locus_tag="mCG_3131"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG3131.2 transcript_id=mCT2434.2
FT                   protein_id=mCP5529.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9R1E6"
FT                   /db_xref="InterPro:IPR001212"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR020436"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR024873"
FT                   /db_xref="MGI:MGI:1321390"
FT                   /db_xref="PDB:3NKM"
FT                   /db_xref="PDB:3NKN"
FT                   /db_xref="PDB:3NKO"
FT                   /db_xref="PDB:3NKP"
FT                   /db_xref="PDB:3NKQ"
FT                   /db_xref="PDB:3NKR"
FT                   /db_xref="PDB:3WAV"
FT                   /db_xref="PDB:3WAW"
FT                   /db_xref="PDB:3WAX"
FT                   /db_xref="PDB:3WAY"
FT                   /db_xref="PDB:4GTW"
FT                   /db_xref="PDB:4GTX"
FT                   /db_xref="PDB:4GTY"
FT                   /db_xref="PDB:4GTZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R1E6"
FT                   /protein_id="EDL29265.1"
FT                   /translation="MARQGCFGSYQVISLFTFAIGVNLCLGFTASRIKRAEWDEGPPTV
FT                   LSDSPWTNTSGSCKGRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTK
FT                   DRCGEVRNEENACHCSEDCLSRGDCCTNYQVVCKGESHWVDDDCEEIRVPECPAGFVRP
FT                   PLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYP
FT                   ESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVRAGTFFWSVSIPH
FT                   ERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMD
FT                   GLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIPNN
FT                   LKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYANNRRIEDLHLLVERRWHVARKPL
FT                   DVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYRTKVPPFENIELYNVMCDLLG
FT                   LKPAPNNGTHGSLNHLLRTNTFRPTLPEEVSRPNYPGIMYLQSDFDLGCTCDDKVEPKN
FT                   KLEELNKRLHTKGSTEERHLLYGRPAVLYRTSYDILYHTDFESGYSEIFLMPLWTSYTI
FT                   SKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYD
FT                   AFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIK
FT                   QYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDES
FT                   KWVEELMKMHTARVRDIEHLTGLDFYRKTSRSYSEILTLKTYLHTYESEI"
FT   gap             5125394..5125598
FT                   /estimated_length=205
FT   gap             5141995..5142449
FT                   /estimated_length=455
FT   gap             5145931..5145975
FT                   /estimated_length=45
FT   gap             5159811..5159830
FT                   /estimated_length=20
FT   gap             5169669..5169688
FT                   /estimated_length=20
FT   gap             5203946..5204479
FT                   /estimated_length=534
FT   gap             5229578..5230485
FT                   /estimated_length=908
FT   gap             5232923..5233664
FT                   /estimated_length=742
FT   gap             5234940..5234959
FT                   /estimated_length=20
FT   gene            complement(5235884..>5241418)
FT                   /locus_tag="mCG_145465"
FT                   /note="gene_id=mCG145465.1"
FT   mRNA            complement(join(5235884..5235986,5236642..5236713,
FT                   5237232..5237346,5237632..5237732,5240720..>5241417))
FT                   /locus_tag="mCG_145465"
FT                   /product="mCG145465, transcript variant mCT184889"
FT                   /note="gene_id=mCG145465.1 transcript_id=mCT184889.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(5235983..5235986,5236642..5236713,
FT                   5237232..5237346,5237632..5237732,5240720..>5240808))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145465"
FT                   /product="mCG145465, isoform CRA_a"
FT                   /note="gene_id=mCG145465.1 transcript_id=mCT184889.0
FT                   protein_id=mCP105333.0 isoform=CRA_a"
FT                   /protein_id="EDL29266.1"
FT                   /translation="VAFLHGASSLPSPGTTWPRYLYTECSLSRRKENEWYTECSLPRDT
FT                   SWRKEIMMSLAKGLNTARTPLHCPFPPDQLLSISPQKRAGLQETTMKHRTTRYNKARIL
FT                   KVYMTPAAKKPLVSQQSKLGTR"
FT   mRNA            complement(join(5236725..5237346,5237632..5237732,
FT                   5241322..>5241418))
FT                   /locus_tag="mCG_145465"
FT                   /product="mCG145465, transcript variant mCT192628"
FT                   /note="gene_id=mCG145465.1 transcript_id=mCT192628.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(5237189..5237346,5237632..5237732,
FT                   5241322..>5241374))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145465"
FT                   /product="mCG145465, isoform CRA_b"
FT                   /note="gene_id=mCG145465.1 transcript_id=mCT192628.0
FT                   protein_id=mCP113571.0 isoform=CRA_b"
FT                   /protein_id="EDL29267.1"
FT                   /translation="GVPLGSRHLRPQRRTRTLKENEWYTECSLPRDTSWRKEIMMSLAK
FT                   GLNTARTPLHCPFPPDQLLSISPQKRAGLQETTMKHRTTRYNKARQELSHQSWTRQPN"
FT   gap             5245067..5245338
FT                   /estimated_length=272
FT   gene            complement(5269585..5326095)
FT                   /locus_tag="mCG_116451"
FT                   /note="gene_id=mCG116451.0"
FT   mRNA            complement(join(5269585..5270610,5270830..5271058,
FT                   5276461..5276583,5281423..5281528,5282569..5282798,
FT                   5285297..5285406,5288414..5288483,5290667..5290806,
FT                   5292361..5292554,5294473..5294583,5297087..5297227,
FT                   5299715..5299940,5301397..5301462,5302203..5302312,
FT                   5302604..5302718,5303372..5303526,5306098..5306233,
FT                   5308216..5308301,5309769..5309868,5312783..5312896,
FT                   5313887..5314071,5316037..5316268,5316977..5317118,
FT                   5318572..5318690,5319844..5320004,5325378..5325432,
FT                   5325832..5326095))
FT                   /locus_tag="mCG_116451"
FT                   /product="mCG116451"
FT                   /note="gene_id=mCG116451.0 transcript_id=mCT117573.1
FT                   created on 31-OCT-2002"
FT   CDS             complement(join(5270550..5270610,5270830..5271058,
FT                   5276461..5276583,5281423..5281528,5282569..5282798,
FT                   5285297..5285406,5288414..5288483,5290667..5290806,
FT                   5292361..5292554,5294473..5294583,5297087..5297227,
FT                   5299715..5299940,5301397..5301462,5302203..5302312,
FT                   5302604..5302718,5303372..5303526,5306098..5306233,
FT                   5308216..5308301,5309769..5309868,5312783..5312896,
FT                   5313887..5314071,5316037..5316268,5316977..5317118,
FT                   5318572..5318690,5319844..5320004,5325378..5325432,
FT                   5325832..5325914))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116451"
FT                   /product="mCG116451"
FT                   /note="gene_id=mCG116451.0 transcript_id=mCT117573.1
FT                   protein_id=mCP60735.1"
FT                   /protein_id="EDL29268.1"
FT                   /translation="MPPTGLESSRMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSV
FT                   VGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLN
FT                   YFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVV
FT                   PSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVE
FT                   TVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTT
FT                   SYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETP
FT                   LTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEEL
FT                   DKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMR
FT                   LIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQP
FT                   LIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFN
FT                   HTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMEIDPDMSVLRKVEFEQ
FT                   ADFMWQYELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRTSACFCLA
FT                   KIANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRD
FT                   VHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDN
FT                   LNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDASLFKSYAEY
FT                   GHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQTDPVPYVRHKILNMLTKNPPFTKN
FT                   MESPLCNEALVDQLWKLMNSGTAHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNL
FT                   KEKKAVLNPTIIPEAGVGNQESASNPGCHAQLAGFQNPFSSSQDEEEVDMDTVHDSQAF
FT                   ISHHLNMLERPSTPGLSKYRPSGSRSSLMPQHSLGCDITPPTKPQWSMELSRKGAGKEQ
FT                   PLEMGVHSMVAAPLSMFAKEALSSRHSEHHHHHHHEHKKKKKKHKHKHKHKHKHDSKDK
FT                   DREPFAFSSPASGRPIQMLVSCGPTKSGMLESL"
FT   gap             5291714..5291758
FT                   /estimated_length=45
FT   gap             5295391..5295410
FT                   /estimated_length=20
FT   gene            complement(5330085..5344455)
FT                   /gene="2600005O03Rik"
FT                   /locus_tag="mCG_11869"
FT                   /note="gene_id=mCG11869.2"
FT   mRNA            complement(join(5330085..5330251,5334180..5334328,
FT                   5336145..5336299,5337024..5337076,5338027..5338165,
FT                   5340719..5340809,5341568..5341702,5342915..5343083,
FT                   5344186..5344455))
FT                   /gene="2600005O03Rik"
FT                   /locus_tag="mCG_11869"
FT                   /product="RIKEN cDNA 2600005O03"
FT                   /note="gene_id=mCG11869.2 transcript_id=mCT12351.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5330143..5330251,5334180..5334328,
FT                   5336145..5336299,5337024..5337076,5338027..5338165,
FT                   5340719..5340809,5341568..5341702,5342915..5343083,
FT                   5344186..5344385))
FT                   /codon_start=1
FT                   /gene="2600005O03Rik"
FT                   /locus_tag="mCG_11869"
FT                   /product="RIKEN cDNA 2600005O03"
FT                   /note="gene_id=mCG11869.2 transcript_id=mCT12351.2
FT                   protein_id=mCP5562.1"
FT                   /protein_id="EDL29269.1"
FT                   /translation="MSPPSASRRTREEVDATLQVAKLNATELLPTVHCLSFSSGTGGAA
FT                   TGDFCLLELEPALCQQLEAGDSFVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGC
FT                   KTPDQLKEEETPSAIVHTEIFGFSNNYWELRRCRPKLKKLKRLLMENTYEGPDSQKEED
FT                   ASRSKYTTEDLLNHIQASEEEIMAQLQVLNACEIGGYWRILEFDYEIKLLNHVTQLVDS
FT                   ESWSLDRVPLTVCLQELGPLEPEEMIEHCLKCYGKRYVDKDDVYFELDADKICRVTAEM
FT                   LLQNAVKFNLAEFQEVWQQSVPEGMTTRLDQLKGLALVDRNSRPEIIFLLKVDDLPEGT
FT                   QDRFNSLFSLREKWTEEDITPYIQDLCGEKQTIGALLTKYSRSSMQNGIKVYNSRRLIS
FT                   "
FT   gap             5335896..5335915
FT                   /estimated_length=20
FT   gap             5350668..5350757
FT                   /estimated_length=90
FT   gap             5352195..5352989
FT                   /estimated_length=795
FT   gene            complement(5354272..>5369609)
FT                   /locus_tag="mCG_116457"
FT                   /note="gene_id=mCG116457.0"
FT   mRNA            complement(join(5354272..5354400,5368228..5368481,
FT                   5369225..>5369609))
FT                   /locus_tag="mCG_116457"
FT                   /product="mCG116457"
FT                   /note="gene_id=mCG116457.0 transcript_id=mCT117579.0
FT                   created on 31-OCT-2002"
FT   CDS             complement(join(5354327..5354400,5368228..5368481,
FT                   5369225..>5369403))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116457"
FT                   /product="mCG116457"
FT                   /note="gene_id=mCG116457.0 transcript_id=mCT117579.0
FT                   protein_id=mCP60343.0"
FT                   /protein_id="EDL29270.1"
FT                   /translation="HTSFRWDWARGSSSGRAGFIWSGNLIYNPQYQGSCGSTSLKHMPK
FT                   KREQEAMGMSKEPWGTSAMRSSSLCCTPPLPPALLSLLPLPPLLPSSMLLTARLPLCLC
FT                   CPGGCAWRLDQCALPEAAPAIFVPGGAVAQTRLAGEGIPAEPGMAPPTTEKMPYSWISW
FT                   RDFLN"
FT   gap             5357808..5358105
FT                   /estimated_length=298
FT   gap             5359188..5359207
FT                   /estimated_length=20
FT   gap             5363457..5363556
FT                   /estimated_length=100
FT   gene            <5367840..5508674
FT                   /gene="Depdc6"
FT                   /locus_tag="mCG_11862"
FT                   /note="gene_id=mCG11862.1"
FT   mRNA            join(<5367840..5368504,5405333..5405511,5407780..5407903,
FT                   5436557..5436735,5464338..5464523,5468071..5468205,
FT                   5471391..5471461,5474072..5474176,5507903..5508674)
FT                   /gene="Depdc6"
FT                   /locus_tag="mCG_11862"
FT                   /product="DEP domain containing 6"
FT                   /note="gene_id=mCG11862.1 transcript_id=mCT12344.2 created
FT                   on 31-OCT-2002"
FT   CDS             join(<5368320..5368504,5405333..5405511,5407780..5407903,
FT                   5436557..5436735,5464338..5464523,5468071..5468205,
FT                   5471391..5471461,5474072..5474176,5507903..5508031)
FT                   /codon_start=1
FT                   /gene="Depdc6"
FT                   /locus_tag="mCG_11862"
FT                   /product="DEP domain containing 6"
FT                   /note="gene_id=mCG11862.1 transcript_id=mCT12344.2
FT                   protein_id=mCP5535.1"
FT                   /protein_id="EDL29271.1"
FT                   /translation="SKRQAHPPGQQRQSGNRAVRSMEEGSSGGSGSSDSNAGGSGGVQQ
FT                   RELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRE
FT                   TAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFALDSEVKAFMRGQRLYEK
FT                   LMSPETTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMDHGIIQH
FT                   VSNKHPFVDSNLLYQFRMNFRRRRRLMELLNETSPSSQETHDSPFCLRKQSHDSRKSTS
FT                   FMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEEL
FT                   LTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSVNGL
FT                   NVLNVDYRTVSNLILTGPRTIVMEVMEELDC"
FT   gap             5380696..5381009
FT                   /estimated_length=314
FT   gap             5433156..5433230
FT                   /estimated_length=75
FT   gap             5450929..5451040
FT                   /estimated_length=112
FT   gap             5465125..5465409
FT                   /estimated_length=285
FT   gap             5482116..5482288
FT                   /estimated_length=173
FT   gap             5491224..5491285
FT                   /estimated_length=62
FT   gap             5495320..5495564
FT                   /estimated_length=245
FT   gap             5502678..5502697
FT                   /estimated_length=20
FT   gap             5505262..5505537
FT                   /estimated_length=276
FT   gap             5531301..5531820
FT                   /estimated_length=520
FT   gap             5535222..5535241
FT                   /estimated_length=20
FT   gap             5535979..5535998
FT                   /estimated_length=20
FT   gap             5545776..5545795
FT                   /estimated_length=20
FT   gap             5554010..5554049
FT                   /estimated_length=40
FT   gap             5560875..5560894
FT                   /estimated_length=20
FT   gene            5563475..5768390
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /note="gene_id=mCG11867.1"
FT   mRNA            join(5563475..5563714,5584909..5585033,5594160..5594276,
FT                   5597435..5597578,5600624..5600713,5617035..5617190,
FT                   5618118..5618237,5620692..5620856,5627043..5627204,
FT                   5633947..5634098,5635174..5635303,5636871..5637016,
FT                   5640644..5640773,5643026..5643165,5654078..5654204,
FT                   5655164..5655303,5656260..5656392,5657621..5657680,
FT                   5659014..5659156,5666198..5666327,5668355..5668477,
FT                   5670918..5671067,5675409..5675525,5684413..5684559,
FT                   5688772..5688828,5692025..5692164,5693209..5693332,
FT                   5693626..5693769,5694836..5695000,5695669..5695707,
FT                   5696203..5696341,5697271..5697413,5699745..5699854,
FT                   5702651..5702809,5711112..5711189,5714024..5714110,
FT                   5715386..5715439,5719047..5719142,5720353..5720406,
FT                   5720706..5720759,5735519..5735572,5736053..5736124,
FT                   5745066..5745101,5746004..5746070,5748967..5749155,
FT                   5763752..5763829,5765770..5765925,5767521..5768390)
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, transcript
FT                   variant mCT12349"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT12349.2 created
FT                   on 14-OCT-2002"
FT   mRNA            join(5563476..5563714,5584909..5585033,5594160..5594276,
FT                   5597435..5597578,5600624..5600713,5617035..5617190,
FT                   5618118..5618237,5620692..5620856,5627043..5627204,
FT                   5666250..5666327,5692025..5692164,5693209..5693332,
FT                   5693626..5693769,5694836..5695000,5695669..5695707,
FT                   5696203..5696341,5697271..5697413,5699745..5699854,
FT                   5702651..5702809,5711112..5711189,5714024..5714110,
FT                   5715386..5715439,5719047..5719142,5720353..5720406,
FT                   5720706..5720759,5735519..5735572,5736053..5736124,
FT                   5745066..5745101,5746004..5746070,5748967..5749111,
FT                   5763752..5763829,5765770..5765925,5767521..5768269)
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, transcript
FT                   variant mCT174539"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT174539.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<5563481..5563714,5584909..5585033,5594160..5594276,
FT                   5597435..5597578,5600624..5600713,5617035..5617190,
FT                   5618118..5618237,5620692..5620856,5627043..5627204,
FT                   5633947..5634098,5635174..5635303,5636871..5637016,
FT                   5640644..5640773,5643026..5643165,5654078..5654204,
FT                   5655164..5655303,5656260..5656392,5657621..5657680,
FT                   5659014..5659165,5666198..5666327,5668355..5668477,
FT                   5670918..5671067,5675409..5675525,5684413..5684559,
FT                   5688772..5688828,5692025..5692164,5693209..5693332,
FT                   5693626..5693769,5694836..5695000,5695669..5695707,
FT                   5696203..5696341,5697271..5697413,5699745..5699854,
FT                   5702651..5702809,5711112..5711189,5714024..5714110,
FT                   5715386..5715439,5719047..5719142,5720353..5720406,
FT                   5720706..5720759,5735519..5735572,5736053..5736124,
FT                   5745066..5745101,5746004..5746070,5748967..5749155,
FT                   5763752..5763829,5765770..5765925,5767521..5768389)
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, transcript
FT                   variant mCT192646"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT192646.0 created
FT                   on 09-MAR-2004"
FT   gap             5578677..5578696
FT                   /estimated_length=20
FT   gap             5583459..5584026
FT                   /estimated_length=568
FT   CDS             join(<5584931..5585033,5594160..5594276,5597435..5597578,
FT                   5600624..5600713,5617035..5617190,5618118..5618237,
FT                   5620692..5620856,5627043..5627204,5633947..5634098,
FT                   5635174..5635303,5636871..5637016,5640644..5640773,
FT                   5643026..5643165,5654078..5654204,5655164..5655303,
FT                   5656260..5656392,5657621..5657680,5659014..5659165,
FT                   5666198..5666327,5668355..5668477,5670918..5671067,
FT                   5675409..5675525,5684413..5684559,5688772..5688828,
FT                   5692025..5692164,5693209..5693332,5693626..5693769,
FT                   5694836..5695000,5695669..5695707,5696203..5696341,
FT                   5697271..5697413,5699745..5699854,5702651..5702809,
FT                   5711112..5711189,5714024..5714110,5715386..5715439,
FT                   5719047..5719142,5720353..5720406,5720706..5720759,
FT                   5735519..5735572,5736053..5736124,5745066..5745101,
FT                   5746004..5746070,5748967..5749155,5763752..5763829,
FT                   5765770..5765925,5767521..5767600)
FT                   /codon_start=1
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT192646.0
FT                   protein_id=mCP113552.0 isoform=CRA_c"
FT                   /protein_id="EDL29274.1"
FT                   /translation="EAENKMMIWQCKMRDWLILAFLAAACFCTIVRGQVAPPTRLRYNV
FT                   ISHDSIQISWKAPRGKFGGYKLLVAPASGGKTNQMNLQNTATKAIIQGLLPEQNYTVQL
FT                   IAYYKDKESKPAQGQFRIKDLEKRKDPTKPKVKVVDKGNGSKPTSPEEVKFFCETPAIA
FT                   DIVILVDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFN
FT                   TKDEVIDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQDDI
FT                   IPPSRNLRESGVELFAIGVKNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTV
FT                   CSRVEEQDKEIKASALATIGPPTELITSEVTARSFMVNWTQSPGKVEKYRVVYYPTRGG
FT                   KPEEVVVDGSVSSTVLKNLMSSTEYQIAVFAVSAHTASEGLRGAETTLALPMASDLELY
FT                   DVTENSMRVRWDAVPGATGYLILYAPLTEGLAGDEKEMKIGETHTDIELSGLFPNTEYT
FT                   VTVYAMFGEEASDPATGQETTLPLTPPRNLRISNVGSNSARLTWDPASGKISGYRIVYT
FT                   SADGTEINEVEVDPITTFPLKGLTPLTEYSIAIFSIYEEGQSLPLVGEFTTEEVPAQQY
FT                   LEIDEVKTDSFRVTWHPLSAEEGQHKLMWIPVYGGKTQEVDLKEEQDSYVIEGLDPGTE
FT                   YEVSLLAVLDDGSESEVVTAVGTTLDDFWTEAPTAIEPTSPVTSVLQTGIRNLVVDDET
FT                   ATSLRVSWDISDSNVEQFRVTYLKAQGDPMEEVVGTVMVPGVQNSLLLKALLPDTEYKV
FT                   TVTPVYTVGEGVSVSAPGKTLPSSGPQNLRVSEEWYNRVRITWDPPSGPVKGYRIVYKP
FT                   VSVPGQTLETFVGADINTIVMTNLLSGMDYNVKIFASQASGFSDALTGLVQTLFLGVTD
FT                   LQANQVEMTSLCARWQIHRHATAYRIVLESLQDTQAQESTVGGGVNRHCFYGLQPDSEY
FT                   KISVYTKLQELEGPSVSIMQKTQSLPTEPPTFPPTIPPAKEVCKAAKADLVFMVDGSWS
FT                   IGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIR
FT                   HISYKGGNTKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKISREMQAD
FT                   GFNIFAIGVADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVCETASATCPM
FT                   VHKDGVDLAGFKMMEMFGLVEKDFSAVEGVSMEPGTFNLFPCYQIHKDALVSQPTKYLH
FT                   PEGLPSDYTMSFLFRILPDTPQEPFALWEILNKNSEPLVGIILDNGGKTLTYFNYDYTG
FT                   DFQTVTFEGPDIRKMFYGSFHKLHVVVSKTLAKVVVDCKEVGQKAINASANITSDGVEV
FT                   LGRMVRSRGPNGNSAPFQLQMFDIVCSTSWASKDRCCELPGLRDEESCPDLPRSCSCSE
FT                   TNEVALGPAGPPGGPGLRGPKGQQGEQGPKGPEGPRGETGPAGPQGPPGPQGPSGLSIQ
FT                   GMPGMPGDKGDKGDAGLPGPQGVPGGVGSPGRDGSPGQRGFPGKDGSSGPPGPPGPIGI
FT                   PGAPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRAVARQVCEQLIQSHM
FT                   ARYTAILNQIPSQSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGTPGFPGNAGVPGTPGE
FT                   RGLTGVKGEKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGPPGHLGVPGPQ
FT                   GPSGQPGYCDPSSCSAYGVGVSHPDQPEFTPVQDEQEAMDLWSAGI"
FT   CDS             join(5584946..5585033,5594160..5594276,5597435..5597578,
FT                   5600624..5600713,5617035..5617190,5618118..5618237,
FT                   5620692..5620856,5627043..5627204,5633947..5634098,
FT                   5635174..5635303,5636871..5637016,5640644..5640773,
FT                   5643026..5643165,5654078..5654204,5655164..5655303,
FT                   5656260..5656392,5657621..5657680,5659014..5659156,
FT                   5666198..5666327,5668355..5668477,5670918..5671067,
FT                   5675409..5675525,5684413..5684559,5688772..5688828,
FT                   5692025..5692164,5693209..5693332,5693626..5693769,
FT                   5694836..5695000,5695669..5695707,5696203..5696341,
FT                   5697271..5697413,5699745..5699854,5702651..5702809,
FT                   5711112..5711189,5714024..5714110,5715386..5715439,
FT                   5719047..5719142,5720353..5720406,5720706..5720759,
FT                   5735519..5735572,5736053..5736124,5745066..5745101,
FT                   5746004..5746070,5748967..5749155,5763752..5763829,
FT                   5765770..5765925,5767521..5767600)
FT                   /codon_start=1
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT12349.2
FT                   protein_id=mCP5547.2 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZNH7"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1341272"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNH7"
FT                   /protein_id="EDL29272.1"
FT                   /translation="MMIWQCKMRDWLILAFLAAACFCTIVRGQVAPPTRLRYNVISHDS
FT                   IQISWKAPRGKFGGYKLLVAPASGGKTNQMNLQNTATKAIIQGLLPEQNYTVQLIAYYK
FT                   DKESKPAQGQFRIKDLEKRKDPTKPKVKVVDKGNGSKPTSPEEVKFFCETPAIADIVIL
FT                   VDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEV
FT                   IDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQDDIIPPSR
FT                   NLRESGVELFAIGVKNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVE
FT                   EQDKEIKASALATIGPPTELITSEVTARSFMVNWTQSPGKVEKYRVVYYPTRGGKPEEV
FT                   VVDGSVSSTVLKNLMSSTEYQIAVFAVSAHTASEGLRGAETTLALPMASDLELYDVTEN
FT                   SMRVRWDAVPGATGYLILYAPLTEGLAGDEKEMKIGETHTDIELSGLFPNTEYTVTVYA
FT                   MFGEEASDPATGQETTLPLTPPRNLRISNVGSNSARLTWDPASGKISGYRIVYTSADGT
FT                   EINEVEVDPITTFPLKGLTPLTEYSIAIFSIYEEGQSLPLVGEFTTEEVPAQQYLEIDE
FT                   VKTDSFRVTWHPLSAEEGQHKLMWIPVYGGKTQEVDLKEEQDSYVIEGLDPGTEYEVSL
FT                   LAVLDDGSESEVVTAVGTTLDDFWTEAPTAIEPTSPVTSVLQTGIRNLVVDDETATSLR
FT                   VSWDISDSNVEQFRVTYLKAQGDPMEEVVMVPGVQNSLLLKALLPDTEYKVTVTPVYTV
FT                   GEGVSVSAPGKTLPSSGPQNLRVSEEWYNRVRITWDPPSGPVKGYRIVYKPVSVPGQTL
FT                   ETFVGADINTIVMTNLLSGMDYNVKIFASQASGFSDALTGLVQTLFLGVTDLQANQVEM
FT                   TSLCARWQIHRHATAYRIVLESLQDTQAQESTVGGGVNRHCFYGLQPDSEYKISVYTKL
FT                   QELEGPSVSIMQKTQSLPTEPPTFPPTIPPAKEVCKAAKADLVFMVDGSWSIGDDNFNK
FT                   IINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIRHISYKGGN
FT                   TKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKISREMQADGFNIFAIG
FT                   VADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVCETASATCPMVHKDGVDL
FT                   AGFKMMEMFGLVEKDFSAVEGVSMEPGTFNLFPCYQIHKDALVSQPTKYLHPEGLPSDY
FT                   TMSFLFRILPDTPQEPFALWEILNKNSEPLVGIILDNGGKTLTYFNYDYTGDFQTVTFE
FT                   GPDIRKMFYGSFHKLHVVVSKTLAKVVVDCKEVGQKAINASANITSDGVEVLGRMVRSR
FT                   GPNGNSAPFQLQMFDIVCSTSWASKDRCCELPGLRDEESCPDLPRSCSCSETNEVALGP
FT                   AGPPGGPGLRGPKGQQGEQGPKGPEGPRGETGPAGPQGPPGPQGPSGLSIQGMPGMPGD
FT                   KGDKGDAGLPGPQGVPGGVGSPGRDGSPGQRGFPGKDGSSGPPGPPGPIGIPGAPGVPG
FT                   ITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRAVARQVCEQLIQSHMARYTAILN
FT                   QIPSQSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGTPGFPGNAGVPGTPGERGLTGVKG
FT                   EKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGPPGHLGVPGPQGPSGQPGY
FT                   CDPSSCSAYGVGVSHPDQPEFTPVQDEQEAMDLWSAGI"
FT   CDS             join(5584946..5585033,5594160..5594276,5597435..5597578,
FT                   5600624..5600713,5617035..5617190,5618118..5618237,
FT                   5620692..5620856,5627043..5627204,5666250..5666327,
FT                   5692025..5692164,5693209..5693332,5693626..5693769,
FT                   5694836..5695000,5695669..5695707,5696203..5696341,
FT                   5697271..5697413,5699745..5699854,5702651..5702809,
FT                   5711112..5711189,5714024..5714110,5715386..5715439,
FT                   5719047..5719142,5720353..5720406,5720706..5720759,
FT                   5735519..5735572,5736053..5736124,5745066..5745101,
FT                   5746004..5746070,5748967..5749111,5763752..5763829,
FT                   5765770..5765893)
FT                   /codon_start=1
FT                   /gene="Col14a1"
FT                   /locus_tag="mCG_11867"
FT                   /product="procollagen, type XIV, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG11867.1 transcript_id=mCT174539.0
FT                   protein_id=mCP97458.0 isoform=CRA_b"
FT                   /protein_id="EDL29273.1"
FT                   /translation="MMIWQCKMRDWLILAFLAAACFCTIVRGQVAPPTRLRYNVISHDS
FT                   IQISWKAPRGKFGGYKLLVAPASGGKTNQMNLQNTATKAIIQGLLPEQNYTVQLIAYYK
FT                   DKESKPAQGQFRIKDLEKRKDPTKPKVKVVDKGNGSKPTSPEEVKFFCETPAIADIVIL
FT                   VDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEV
FT                   IDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQDDIIPPSR
FT                   NLRESGVELFAIGVKNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVE
FT                   EQDKEIKDTEYKVTVTPVYTVGEGVSVSAPGKTLCKAAKADLVFMVDGSWSIGDDNFNK
FT                   IINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIRHISYKGGN
FT                   TKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKISREMQADGFNIFAIG
FT                   VADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVCETASATCPMVHKDGVDL
FT                   AGFKMMEMFGLVEKDFSAVEGVSMEPGTFNLFPCYQIHKDALVSQPTKYLHPEGLPSDY
FT                   TMSFLFRILPDTPQEPFALWEILNKNSEPLVGIILDNGGKTLTYFNYDYTGDFQTVTFE
FT                   GPDIRKMFYGSFHKLHVVVSKTLAKVVVDCKEVGQKAINASANITSDGVEVLGRMVRSR
FT                   GPNGNSAPFQLQMFDIVCSTSWASKDRCCELPGLRDEESCPDLPRSCSCSETNEVALGP
FT                   AGPPGGPGLRGPKGQQGEQGPKGPEGPRGETGPAGPQGPPGPQGPSGLSIQGMPGMPGD
FT                   KGDKGDAGLPGPQGVPGGVGSPGRDGSPGQRGFPGKDGSSGPPGPPGPIGIPGAPGVPG
FT                   ITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRAVARQVCEQLIQSHMARYTAILN
FT                   QIPSQSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGTPGSNWCQRRERKSRHWNSRPKRS
FT                   PWASRTFRGKSSWKSWATWLSWTKGSPGPPGSTWTSGSFWPAWVL"
FT   gap             5605120..5605139
FT                   /estimated_length=20
FT   gap             5609045..5609064
FT                   /estimated_length=20
FT   gap             5619524..5619549
FT                   /estimated_length=26
FT   gap             5623345..5623708
FT                   /estimated_length=364
FT   gap             5641177..5641196
FT                   /estimated_length=20
FT   gap             5661447..5661729
FT                   /estimated_length=283
FT   gap             5666673..5666710
FT                   /estimated_length=38
FT   gap             5681594..5681613
FT                   /estimated_length=20
FT   gene            complement(5683587..5686493)
FT                   /locus_tag="mCG_148007"
FT                   /note="gene_id=mCG148007.0"
FT   mRNA            complement(join(5683587..5684211,5686301..5686493))
FT                   /locus_tag="mCG_148007"
FT                   /product="mCG148007"
FT                   /note="gene_id=mCG148007.0 transcript_id=mCT188270.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5683806..5684153)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148007"
FT                   /product="mCG148007"
FT                   /note="gene_id=mCG148007.0 transcript_id=mCT188270.0
FT                   protein_id=mCP108971.0"
FT                   /db_xref="GOA:Q9D9P0"
FT                   /db_xref="MGI:MGI:1920584"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9P0"
FT                   /protein_id="EDL29275.1"
FT                   /translation="MLSHQPSSAKSKKAKTLHLPQTRTAGKKSRQFSSKSSGKVQKTAN
FT                   KDKKTLPWIPKRKTSEKTTPPTKKTLKAKGKVLFGHYHLLMEEMKTSTETEPDHSTVKS
FT                   SSVSMSDKESQ"
FT   gap             5705725..5705907
FT                   /estimated_length=183
FT   gap             5732170..5732466
FT                   /estimated_length=297
FT   gene            complement(5781679..5805312)
FT                   /gene="Mrpl13"
FT                   /locus_tag="mCG_11868"
FT                   /note="gene_id=mCG11868.2"
FT   mRNA            complement(join(5781679..5781928,5786621..5786742,
FT                   5787714..5787800,5790915..5790975,5795706..5795799,
FT                   5802884..5803007,5804822..5805311))
FT                   /gene="Mrpl13"
FT                   /locus_tag="mCG_11868"
FT                   /product="mitochondrial ribosomal protein L13, transcript
FT                   variant mCT12350"
FT                   /note="gene_id=mCG11868.2 transcript_id=mCT12350.1 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(5781709..5781928,5786621..5786742,
FT                   5787714..5787800,5790915..5790975,5802884..5803007,
FT                   5804822..5805312))
FT                   /gene="Mrpl13"
FT                   /locus_tag="mCG_11868"
FT                   /product="mitochondrial ribosomal protein L13, transcript
FT                   variant mCT174540"
FT                   /note="gene_id=mCG11868.2 transcript_id=mCT174540.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5781907..5781928,5786621..5786742,
FT                   5787714..5787800,5790915..5790975,5795706..5795799,
FT                   5802884..5803007,5804822..5804848))
FT                   /codon_start=1
FT                   /gene="Mrpl13"
FT                   /locus_tag="mCG_11868"
FT                   /product="mitochondrial ribosomal protein L13, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11868.2 transcript_id=mCT12350.1
FT                   protein_id=mCP5571.2 isoform=CRA_a"
FT                   /protein_id="EDL29276.1"
FT                   /translation="MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKP
FT                   VYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIV
FT                   KLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEI
FT                   EAFPRVWTPPDDFRM"
FT   CDS             complement(join(5790950..5790975,5802884..5803007,
FT                   5804822..5804848))
FT                   /codon_start=1
FT                   /gene="Mrpl13"
FT                   /locus_tag="mCG_11868"
FT                   /product="mitochondrial ribosomal protein L13, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11868.2 transcript_id=mCT174540.0
FT                   protein_id=mCP97459.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E909"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="MGI:MGI:2137218"
FT                   /db_xref="UniProtKB/TrEMBL:G5E909"
FT                   /protein_id="EDL29277.1"
FT                   /translation="MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKP
FT                   VYHQLTTQAALDK"
FT   gap             5791243..5791262
FT                   /estimated_length=20
FT   gene            5804822..5874179
FT                   /gene="Mtbp"
FT                   /locus_tag="mCG_11863"
FT                   /note="gene_id=mCG11863.2"
FT   mRNA            join(5804822..5805301,5806065..5806145,5810267..5810340,
FT                   5810501..5810652,5812177..5812235,5813758..5813902,
FT                   5814742..5814859,5816610..5816723,5818859..5818953,
FT                   5820460..5820532,5825011..5825128,5833874..5834047,
FT                   5836219..5836326,5844750..5844911,5850596..5850713,
FT                   5854056..5854211,5858350..5858445,5865239..5865505,
FT                   5867395..5867632,5868380..5868493,5873148..5873213,
FT                   5873895..5874179)
FT                   /gene="Mtbp"
FT                   /locus_tag="mCG_11863"
FT                   /product="Mdm2, transformed 3T3 cell double minute p53
FT                   binding protein"
FT                   /note="gene_id=mCG11863.2 transcript_id=mCT12345.2 created
FT                   on 26-NOV-2002"
FT   CDS             join(5805184..5805301,5806065..5806145,5810267..5810340,
FT                   5810501..5810652,5812177..5812235,5813758..5813902,
FT                   5814742..5814859,5816610..5816723,5818859..5818953,
FT                   5820460..5820532,5825011..5825128,5833874..5834047,
FT                   5836219..5836326,5844750..5844911,5850596..5850713,
FT                   5854056..5854211,5858350..5858445,5865239..5865505,
FT                   5867395..5867632,5868380..5868493,5873148..5873213,
FT                   5873895..5873933)
FT                   /codon_start=1
FT                   /gene="Mtbp"
FT                   /locus_tag="mCG_11863"
FT                   /product="Mdm2, transformed 3T3 cell double minute p53
FT                   binding protein"
FT                   /note="gene_id=mCG11863.2 transcript_id=mCT12345.2
FT                   protein_id=mCP5543.1"
FT                   /protein_id="EDL29278.1"
FT                   /translation="MDRYLLLVTWREGKFRSVAGGEIEPGTEATSLESTDKQPDLTATN
FT                   IYHLLKRSISDSIHPDDSTFPACSVGGTPHSRKWFFAVQAICGFYQFCSSDWQEIHFDA
FT                   EKDKIEDVLQANIEECQSAVECFEEDDSNSRESLPLADLYEESAENLHQLSDKLPAPGR
FT                   AMIDIILLPSDKDPPKLKECLPIVGALKHLKEWHSAKVIIAGSYCEINCQKIAEYLSAS
FT                   VVPLEEFRNAIDPRELWRGEIQMRERKFGFEISFPEFCLKGVTPTNVSAYNLNTCFLAK
FT                   KIASSKVFHYYGPALEFVQMIKLSDLPSCYMSDIEFELEVTGHCTRQNSMLLLEQISSL
FT                   CGKVGALFVLPCTVSNVLIPPPSQLASRKWKEYMAKKPKTISVPDVAVKGEFSGYHLLL
FT                   QGMGKRKCRATLLHSASQINGSFALSVIHGKMKTKAGEARPSFPFDFSSLPRFSEEQVL
FT                   QREKQLASFQVLALKECLKRRKAANQPEAFSADELKSLLALTRERFLGHFDVLPTEAAL
FT                   AQTDTVKAAGVVNDDGTVEPYSSSLMETNPLEWPERHVLQNLETSEKAKQKMRTGSLPR
FT                   SSEQLLGHKEGPRDSLTLLDAKELLKYFTSDGLPVGDLQPLHIQRGEKPFVLTPELSPG
FT                   KLQVLPFEKASECHYHGIEYCLDDQKALERDGGFSELQSRLIRYETQTTCTRDSFPVPT
FT                   VLSPLPSPAVLSEPQSVPEGEALQGELRTEVSGLKRRSKDPSCLYPQKRLTRSESSDCL
FT                   PSQASCNSNHHHHTGKPRKPQAERCVSGLPLPGREASKDTSKTSSGQKRAHESKSSKQM
FT                   KESRSQKHTRMLKEVVKDTLKRHHITEAHESFTACSQRLFDISKFYLKDLKTSRGLFEE
FT                   MKKTANNNVVQVIEWVVEKMSKK"
FT   gap             5823364..5823383
FT                   /estimated_length=20
FT   gap             5841213..5841821
FT                   /estimated_length=609
FT   gap             5842816..5843272
FT                   /estimated_length=457
FT   gap             5861240..5861259
FT                   /estimated_length=20
FT   gene            complement(5886609..6147333)
FT                   /gene="Sntb1"
FT                   /locus_tag="mCG_11864"
FT                   /note="gene_id=mCG11864.2"
FT   mRNA            complement(join(5886609..5887185,5890413..5890603,
FT                   5895717..5895913,5917989..5918128,5990380..5990587,
FT                   6033188..6033405,6146365..6147333))
FT                   /gene="Sntb1"
FT                   /locus_tag="mCG_11864"
FT                   /product="syntrophin, basic 1"
FT                   /note="gene_id=mCG11864.2 transcript_id=mCT12346.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(5887093..5887185,5890413..5890603,
FT                   5895717..5895913,5917989..5918128,5990380..5990587,
FT                   6033188..6033234))
FT                   /codon_start=1
FT                   /gene="Sntb1"
FT                   /locus_tag="mCG_11864"
FT                   /product="syntrophin, basic 1"
FT                   /note="gene_id=mCG11864.2 transcript_id=mCT12346.2
FT                   protein_id=mCP5565.2"
FT                   /protein_id="EDL29279.1"
FT                   /translation="MCYVTRNMTLADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSA
FT                   IHSNAGDLLTRVVADIREQLGKTGIAGSREIRHLGWLAEKVPGESEKQWKPALVVLTEK
FT                   DLLIYDSMPRRKEAWFSPVHSYPLLATRLVHSGPGKGSPQAGMDLSFATRTGTKQGIET
FT                   HLFRAEISRDLSHWTRSIVQGCHNSAELTAEITTACTYRNQECRLTIHYDNGFSISTEP
FT                   QDGAFPKTIIQSPYEKLKMSSDDGIRMLYLDFGGKEGEIQLDLHSCPKPIVFIIHSFLS
FT                   AKITRLGLVA"
FT   gap             5893115..5893291
FT                   /estimated_length=177
FT   gap             5898397..5898416
FT                   /estimated_length=20
FT   gap             5917856..5917875
FT                   /estimated_length=20
FT   gap             5919756..5925560
FT                   /estimated_length=5805
FT   gap             5929591..5929610
FT                   /estimated_length=20
FT   gap             6026372..6026391
FT                   /estimated_length=20
FT   gap             6055818..6055837
FT                   /estimated_length=20
FT   gap             6063822..6063992
FT                   /estimated_length=171
FT   gap             6075090..6075109
FT                   /estimated_length=20
FT   gap             6122951..6122970
FT                   /estimated_length=20
FT   gap             6160344..6160363
FT                   /estimated_length=20
FT   gap             6174547..6174869
FT                   /estimated_length=323
FT   gap             6212764..6213226
FT                   /estimated_length=463
FT   gap             6221548..6221746
FT                   /estimated_length=199
FT   gap             6274225..6274284
FT                   /estimated_length=60
FT   gap             6287068..6287087
FT                   /estimated_length=20
FT   gap             6304110..6304129
FT                   /estimated_length=20
FT   gap             6308849..6308926
FT                   /estimated_length=78
FT   gap             6314016..6314172
FT                   /estimated_length=157
FT   gap             6345354..6345466
FT                   /estimated_length=113
FT   gap             6363619..6365262
FT                   /estimated_length=1644
FT   gap             6417717..6421125
FT                   /estimated_length=3409
FT   gap             6441246..6441265
FT                   /estimated_length=20
FT   gap             6447537..6447591
FT                   /estimated_length=55
FT   gap             6452237..6452842
FT                   /estimated_length=606
FT   gap             6474646..6475143
FT                   /estimated_length=498
FT   gap             6483006..6483025
FT                   /estimated_length=20
FT   gap             6483875..6484239
FT                   /estimated_length=365
FT   gap             6491274..6491421
FT                   /estimated_length=148
FT   gap             6494641..6494660
FT                   /estimated_length=20
FT   gap             6496252..6496271
FT                   /estimated_length=20
FT   gap             6498948..6501973
FT                   /estimated_length=3026
FT   gap             6507892..6508144
FT                   /estimated_length=253
FT   gap             6550472..6550506
FT                   /estimated_length=35
FT   gap             6603171..6603190
FT                   /estimated_length=20
FT   gap             6686007..6686026
FT                   /estimated_length=20
FT   gap             6729251..6729270
FT                   /estimated_length=20
FT   gap             6759695..6759745
FT                   /estimated_length=51
FT   gap             6760890..6762323
FT                   /estimated_length=1434
FT   gap             6779525..6779700
FT                   /estimated_length=176
FT   gap             6780499..6780555
FT                   /estimated_length=57
FT   gap             6787824..6788161
FT                   /estimated_length=338
FT   gap             6798823..6798842
FT                   /estimated_length=20
FT   gap             6827245..6827849
FT                   /estimated_length=605
FT   gap             6829633..6830241
FT                   /estimated_length=609
FT   gap             6832015..6832034
FT                   /estimated_length=20
FT   gap             6835685..6835730
FT                   /estimated_length=46
FT   gap             6844605..6844624
FT                   /estimated_length=20
FT   gap             6870079..6870103
FT                   /estimated_length=25
FT   gene            complement(6904903..6933805)
FT                   /gene="Has2"
FT                   /locus_tag="mCG_11859"
FT                   /note="gene_id=mCG11859.1"
FT   mRNA            complement(join(6904903..6907862,6909163..6909264,
FT                   6920876..6921502,6933295..6933805))
FT                   /gene="Has2"
FT                   /locus_tag="mCG_11859"
FT                   /product="hyaluronan synthase 2"
FT                   /note="gene_id=mCG11859.1 transcript_id=mCT12162.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(6906933..6907862,6909163..6909264,
FT                   6920876..6921502))
FT                   /codon_start=1
FT                   /gene="Has2"
FT                   /locus_tag="mCG_11859"
FT                   /product="hyaluronan synthase 2"
FT                   /note="gene_id=mCG11859.1 transcript_id=mCT12162.0
FT                   protein_id=mCP5553.1"
FT                   /db_xref="GOA:P70312"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026107"
FT                   /db_xref="InterPro:IPR028371"
FT                   /db_xref="MGI:MGI:107821"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70312"
FT                   /protein_id="EDL29280.1"
FT                   /translation="MHCERFLCVLRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFS
FT                   FGLYGAFLASHLIIQSLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQ
FT                   SVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEES
FT                   HKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASS
FT                   VEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCIS
FT                   GPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTET
FT                   PIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFY
FT                   RGKIWNILLFLLTVQLVGLIKSSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATI
FT                   NKAGWGTSGRKTIVVNFIGLIPVSVWFTILLGGVIFTIYKESKKPFSESKQTVLIVGTL
FT                   IYACYWVMLLTLYVVLINKCGRRKKGQQYDMVLDV"
FT   gap             6920647..6920666
FT                   /estimated_length=20
FT   gap             6923289..6923308
FT                   /estimated_length=20
FT   gap             6935240..6935259
FT                   /estimated_length=20
FT   gap             6996461..6996664
FT                   /estimated_length=204
FT   gap             7005120..7005304
FT                   /estimated_length=185
FT   gene            complement(7022041..7022835)
FT                   /pseudo
FT                   /locus_tag="mCG_11860"
FT                   /note="gene_id=mCG11860.1"
FT   mRNA            complement(join(7022041..7022427,7022615..7022835))
FT                   /pseudo
FT                   /locus_tag="mCG_11860"
FT                   /note="gene_id=mCG11860.1 transcript_id=mCT12163.1 created
FT                   on 31-OCT-2002"
FT   gap             7033274..7033293
FT                   /estimated_length=20
FT   gap             7076967..7077077
FT                   /estimated_length=111
FT   gap             7105999..7106387
FT                   /estimated_length=389
FT   gap             7134772..7135669
FT                   /estimated_length=898
FT   gap             7141085..7141287
FT                   /estimated_length=203
FT   gap             7143869..7146035
FT                   /estimated_length=2167
FT   gap             7154347..7154643
FT                   /estimated_length=297
FT   gap             7175848..7176006
FT                   /estimated_length=159
FT   gap             7181866..7186007
FT                   /estimated_length=4142
FT   gap             7204230..7204249
FT                   /estimated_length=20
FT   gap             7220808..7220827
FT                   /estimated_length=20
FT   gap             7232297..7232389
FT                   /estimated_length=93
FT   gap             7281053..7281072
FT                   /estimated_length=20
FT   gap             7287295..7287314
FT                   /estimated_length=20
FT   gap             7353304..7353338
FT                   /estimated_length=35
FT   gap             7369537..7370135
FT                   /estimated_length=599
FT   gap             7375309..7375444
FT                   /estimated_length=136
FT   gap             7410760..7410789
FT                   /estimated_length=30
FT   gap             7420381..7421180
FT                   /estimated_length=800
FT   gene            complement(7482488..7503866)
FT                   /gene="BC026439"
FT                   /locus_tag="mCG_15298"
FT                   /note="gene_id=mCG15298.2"
FT   mRNA            complement(join(7482488..7482796,7483518..7483721,
FT                   7486145..7486253,7488266..7488480,7489569..7489684,
FT                   7492900..7493023,7493794..7493962,7495187..7495341,
FT                   7497782..7497885,7501978..7502393,7503799..7503866))
FT                   /gene="BC026439"
FT                   /locus_tag="mCG_15298"
FT                   /product="cDNA sequence BC026439"
FT                   /note="gene_id=mCG15298.2 transcript_id=mCT15446.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(7482727..7482796,7483518..7483721,
FT                   7486145..7486253,7488266..7488480,7489569..7489684,
FT                   7492900..7493023,7493794..7493962,7495187..7495341,
FT                   7497782..7497885,7501978..7502376))
FT                   /codon_start=1
FT                   /gene="BC026439"
FT                   /locus_tag="mCG_15298"
FT                   /product="cDNA sequence BC026439"
FT                   /note="gene_id=mCG15298.2 transcript_id=mCT15446.2
FT                   protein_id=mCP5567.2"
FT                   /db_xref="GOA:Q8R0S9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2446114"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0S9"
FT                   /protein_id="EDL29281.1"
FT                   /translation="MDFDEILHHVGDSGRFQICMIILLNILSLVLSPHDVLENFTAAIP
FT                   AHHCSINLDNSRSEVSTDMNLTTEDLMKVSIPMGPNQKPEQCRRFRYTQWQFLDSNIST
FT                   FNSTELETEPCLDGWTYDHSVFTSTIVTEWDLVCDFQSFKYYAQATSLAGHLVSCPLSG
FT                   IISDRFGRKPLLMYCSLAYGAVGTYCAFAPNFSVYCVLRFLLSAFQSTILINSLILVLE
FT                   EASVQWHPTIIVLSGLFNSIGQGVLGGLAYVISDWHLLQLAYALPFFIFFVLFCWVPES
FT                   VRWLIITGKTDQAWKELQRIASINGKKGIAQNLTTEDLRSKLKKDVNSTGKLFRIKDIF
FT                   INPLIRKIVLSNSSLLFAELFSFVGLLLDVQLLGKNMFLTQIFLGAIDVPSKSLTYFTI
FT                   RNVSRRPLIAFLLLTTGSCITITIFISEEMYVLRTIIFILGKGCFAAFTCISTTYINEL
FT                   SPVELRSTLNGVFLAVVRLAGVLSALTLATRKYFVYLPMILYGVLPIVATISILFLPET
FT                   FNLPHTDIIKDMEKRKRLMSKNISKKEGQDFLETTEC"
FT   gap             7484512..7484531
FT                   /estimated_length=20
FT   gap             7487206..7487242
FT                   /estimated_length=37
FT   gap             7519039..7519630
FT                   /estimated_length=592
FT   gap             7523217..7523821
FT                   /estimated_length=605
FT   gap             7526870..7526889
FT                   /estimated_length=20
FT   gap             7549258..7549277
FT                   /estimated_length=20
FT   gap             7599962..7599981
FT                   /estimated_length=20
FT   gap             7619625..7619644
FT                   /estimated_length=20
FT   gap             7632158..7632177
FT                   /estimated_length=20
FT   gap             7654464..7662393
FT                   /estimated_length=7930
FT   gap             7687746..7687970
FT                   /estimated_length=225
FT   gap             7741227..7741561
FT                   /estimated_length=335
FT   gap             7750249..7750268
FT                   /estimated_length=20
FT   gap             7769048..7769227
FT                   /estimated_length=180
FT   gap             7786109..7786763
FT                   /estimated_length=655
FT   gap             7788787..7788901
FT                   /estimated_length=115
FT   gap             7824939..7825097
FT                   /estimated_length=159
FT   gap             7831306..7831325
FT                   /estimated_length=20
FT   gap             7848017..7848516
FT                   /estimated_length=500
FT   gap             7924499..7924518
FT                   /estimated_length=20
FT   gap             7926154..7926173
FT                   /estimated_length=20
FT   gene            <7929688..8080364
FT                   /gene="Zhx2"
FT                   /locus_tag="mCG_63089"
FT                   /note="gene_id=mCG63089.2"
FT   mRNA            join(<7929688..7930005,7998373..7998446,8056869..8059588,
FT                   8074624..8075555,8080315..8080364)
FT                   /gene="Zhx2"
FT                   /locus_tag="mCG_63089"
FT                   /product="zinc fingers and homeoboxes protein 2, transcript
FT                   variant mCT63272"
FT                   /note="gene_id=mCG63089.2 transcript_id=mCT63272.2 created
FT                   on 09-DEC-2002"
FT   mRNA            join(<7929914..7930005,7998373..7998446,8056869..8059588,
FT                   8074624..8075858)
FT                   /gene="Zhx2"
FT                   /locus_tag="mCG_63089"
FT                   /product="zinc fingers and homeoboxes protein 2, transcript
FT                   variant mCT192596"
FT                   /note="gene_id=mCG63089.2 transcript_id=mCT192596.0 created
FT                   on 09-MAR-2004"
FT   gene            complement(7943115..7943929)
FT                   /locus_tag="mCG_148005"
FT                   /note="gene_id=mCG148005.0"
FT   mRNA            complement(join(7943115..7943641,7943890..7943929))
FT                   /locus_tag="mCG_148005"
FT                   /product="mCG148005"
FT                   /note="gene_id=mCG148005.0 transcript_id=mCT188268.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7943268..7943498)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148005"
FT                   /product="mCG148005"
FT                   /note="gene_id=mCG148005.0 transcript_id=mCT188268.0
FT                   protein_id=mCP108965.0"
FT                   /protein_id="EDL29284.1"
FT                   /translation="MRIESAIPLHCEAQLGPFLSYRFKCCLTFLNCSMEIPQASFRRRE
FT                   TAMTSHGWSEQASAIVLWKGGTLTAGVNWGR"
FT   gap             7946198..7946472
FT                   /estimated_length=275
FT   gene            complement(7951312..>7973087)
FT                   /gene="9330154K18Rik"
FT                   /locus_tag="mCG_144785"
FT                   /note="gene_id=mCG144785.0"
FT   mRNA            complement(join(7951312..7952401,7953042..7954710,
FT                   7955201..7955285,7960472..7960592,7968602..7968741,
FT                   7972208..7972463,7972718..>7973087))
FT                   /gene="9330154K18Rik"
FT                   /locus_tag="mCG_144785"
FT                   /product="RIKEN cDNA 9330154K18"
FT                   /note="gene_id=mCG144785.0 transcript_id=mCT184209.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(7954302..7954710,7955201..7955285,
FT                   7960472..>7960481))
FT                   /codon_start=1
FT                   /gene="9330154K18Rik"
FT                   /locus_tag="mCG_144785"
FT                   /product="RIKEN cDNA 9330154K18"
FT                   /note="gene_id=mCG144785.0 transcript_id=mCT184209.0
FT                   protein_id=mCP105329.0"
FT                   /protein_id="EDL29285.1"
FT                   /translation="FDVGQKCKFKEKKKVFIFFLLKAQGEHLVQNSCLSGSPLCLRGSE
FT                   AAQLVELYHLLSPKHQHQILPALKRKPSSTLFQTVHNPGHAPLTRYFCGCSTSPTITEA
FT                   ERVCAGVCTLRGGEWSVLRFASHGLSSCSAAHGLPLCSTGLDFHSPRRKTFGHICGAFL
FT                   DRVN"
FT   gap             7970630..7970649
FT                   /estimated_length=20
FT   gap             7979086..7979268
FT                   /estimated_length=183
FT   gap             7991743..7991762
FT                   /estimated_length=20
FT   gap             8037210..8037229
FT                   /estimated_length=20
FT   gap             8041998..8042356
FT                   /estimated_length=359
FT   gap             8043899..8044190
FT                   /estimated_length=292
FT   gene            complement(8053627..8128594)
FT                   /locus_tag="mCG_115497"
FT                   /note="gene_id=mCG115497.1"
FT   mRNA            complement(join(8053627..8053641,8107677..8108063,
FT                   8111654..8111764,8113575..8113627,8114636..8114731,
FT                   8115200..8115226,8116151..8116215,8119586..8119697,
FT                   8128294..8128594))
FT                   /locus_tag="mCG_115497"
FT                   /product="mCG115497, transcript variant mCT116608"
FT                   /note="gene_id=mCG115497.1 transcript_id=mCT116608.1
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(8053627..8053641,8107677..8108063,
FT                   8111679..8111764,8113575..8113627,8114636..8114756,
FT                   8116151..8116215,8119586..8119697,8128294..8128578))
FT                   /locus_tag="mCG_115497"
FT                   /product="mCG115497, transcript variant mCT176752"
FT                   /note="gene_id=mCG115497.1 transcript_id=mCT176752.0
FT                   created on 06-DEC-2002"
FT   CDS             <8056996..8059584
FT                   /codon_start=1
FT                   /gene="Zhx2"
FT                   /locus_tag="mCG_63089"
FT                   /product="zinc fingers and homeoboxes protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG63089.2 transcript_id=mCT192596.0
FT                   protein_id=mCP113601.0 isoform=CRA_a"
FT                   /protein_id="EDL29282.1"
FT                   /translation="SQKLRISLSCTHPPTPERSCCSEADGMASKRKSTTPCMVRTSQVL
FT                   EQDMLEEADRAKDKGAGMPQSDVTKDSWAAEPEHSSKETEVVEVKSMGENLSKKLQGGY
FT                   ECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGET
FT                   NFKLKLIKRNNQTVLEQSIEATNHVVPITASGPGSSDNDPGVSVGKTPMTKTGKLKADA
FT                   KKVPKKPDEAAPENHMEGTARLVTDTAEILARLGSVELLQDSLGHVMPSVQLPPNINLV
FT                   PKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQR
FT                   LKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLTPTKVSQPILQTALPCQILGQ
FT                   PSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPK
FT                   VANTPLTPASDRKKTKLQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHR
FT                   YRCQRGIVHITSESLAKDQMAITGTRHGRTYHVYPDFAPQKFKEKSQGQLKTLEDSFLK
FT                   SSFPTQAEVERLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGSDAVAPNG
FT                   ALSRLDQLSGAQLAGSLPSPSSAIVQNQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLV
FT                   RTEIVRWFKENRCLLKTGTLSWLEQYQRHHMSDDRGRDAVSRKVAKQVAESPKNGSEAA
FT                   HQYAKDPKALSEEDSEKLVPRMKVGGDPTKDCLAGKPSEATSDRSEGSRDGQGSEENEE
FT                   SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA"
FT   CDS             <8056996..8059584
FT                   /codon_start=1
FT                   /gene="Zhx2"
FT                   /locus_tag="mCG_63089"
FT                   /product="zinc fingers and homeoboxes protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG63089.2 transcript_id=mCT63272.2
FT                   protein_id=mCP28270.2 isoform=CRA_a"
FT                   /protein_id="EDL29283.1"
FT                   /translation="SQKLRISLSCTHPPTPERSCCSEADGMASKRKSTTPCMVRTSQVL
FT                   EQDMLEEADRAKDKGAGMPQSDVTKDSWAAEPEHSSKETEVVEVKSMGENLSKKLQGGY
FT                   ECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGET
FT                   NFKLKLIKRNNQTVLEQSIEATNHVVPITASGPGSSDNDPGVSVGKTPMTKTGKLKADA
FT                   KKVPKKPDEAAPENHMEGTARLVTDTAEILARLGSVELLQDSLGHVMPSVQLPPNINLV
FT                   PKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQR
FT                   LKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLTPTKVSQPILQTALPCQILGQ
FT                   PSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPK
FT                   VANTPLTPASDRKKTKLQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHR
FT                   YRCQRGIVHITSESLAKDQMAITGTRHGRTYHVYPDFAPQKFKEKSQGQLKTLEDSFLK
FT                   SSFPTQAEVERLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGSDAVAPNG
FT                   ALSRLDQLSGAQLAGSLPSPSSAIVQNQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLV
FT                   RTEIVRWFKENRCLLKTGTLSWLEQYQRHHMSDDRGRDAVSRKVAKQVAESPKNGSEAA
FT                   HQYAKDPKALSEEDSEKLVPRMKVGGDPTKDCLAGKPSEATSDRSEGSRDGQGSEENEE
FT                   SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA"
FT   gap             8059770..8060331
FT                   /estimated_length=562
FT   gap             8067518..8067789
FT                   /estimated_length=272
FT   gap             8077127..8077394
FT                   /estimated_length=268
FT   gap             8089145..8089244
FT                   /estimated_length=100
FT   gap             8090945..8091006
FT                   /estimated_length=62
FT   gap             8093740..8093901
FT                   /estimated_length=162
FT   gap             8105582..8105613
FT                   /estimated_length=32
FT   CDS             complement(join(8107925..8108063,8111654..8111764,
FT                   8113575..8113627,8114636..8114731,8115200..8115226,
FT                   8116151..8116215,8119586..8119697,8128294..8128446))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115497"
FT                   /product="mCG115497, isoform CRA_a"
FT                   /note="gene_id=mCG115497.1 transcript_id=mCT116608.1
FT                   protein_id=mCP60647.1 isoform=CRA_a"
FT                   /protein_id="EDL29286.1"
FT                   /translation="MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEA
FT                   FLYRFQIWRPFTATFYFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLF
FT                   NWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFN
FT                   YIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGV
FT                   PPASMRRAADQNGGGGRHNWGQGFRLGDQ"
FT   CDS             complement(join(8114637..8114756,8116151..8116215,
FT                   8119586..8119697,8128294..8128446))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115497"
FT                   /product="mCG115497, isoform CRA_b"
FT                   /note="gene_id=mCG115497.1 transcript_id=mCT176752.0
FT                   protein_id=mCP99674.0 isoform=CRA_b"
FT                   /protein_id="EDL29287.1"
FT                   /translation="MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEA
FT                   FLYRFQIWRPFTATFYFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLF
FT                   NWICIVLPVLTSFAAADDPSDHVSALRLGPAEQRPDRVVLVRNAI"
FT   gap             8130071..8130147
FT                   /estimated_length=77
FT   gene            8148330..8206257
FT                   /locus_tag="mCG_52512"
FT                   /note="gene_id=mCG52512.1"
FT   mRNA            join(8148330..8148521,8149985..8150100,8152100..8152246,
FT                   8156061..8156176,8159087..8159265,8168660..8168811,
FT                   8172276..8172435,8174087..8174287,8176808..8176984,
FT                   8178555..8178634,8178718..8178864,8185134..8185267,
FT                   8187159..8187292,8187817..8187996,8188940..8189172,
FT                   8189672..8189824,8191457..8191592,8194522..8194614,
FT                   8197028..8197168,8198254..8198406,8199989..8200109,
FT                   8204094..8204189,8205909..8206257)
FT                   /locus_tag="mCG_52512"
FT                   /product="mCG52512, transcript variant mCT52695"
FT                   /note="gene_id=mCG52512.1 transcript_id=mCT52695.2 created
FT                   on 31-OCT-2002"
FT   mRNA            join(<8148383..8148521,8152100..8152246,8156061..8156176,
FT                   8159087..8159265,8168660..8168811,8172276..8172435,
FT                   8174087..8174287,8176808..8176984,8178555..8178634,
FT                   8178718..8178864,8185134..8185267,8187159..8187292,
FT                   8187817..8187996,8188940..8189172,8189672..8189824,
FT                   8191457..8191592,8194522..8194614,8197028..8197168,
FT                   8199989..8200109,8204094..8204189,8205909..8206246)
FT                   /locus_tag="mCG_52512"
FT                   /product="mCG52512, transcript variant mCT192645"
FT                   /note="gene_id=mCG52512.1 transcript_id=mCT192645.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8148430..8148521,8152100..8152246,8156061..8156176,
FT                   8159087..8159265,8168660..8168811,8172276..8172435,
FT                   8174087..8174287,8176808..8176984,8178555..8178634,
FT                   8178718..8178864,8185134..8185267,8187159..8187292,
FT                   8187817..8187996,8188940..8189172,8189672..8189824,
FT                   8191457..8191592,8194522..8194614,8197028..8197168,
FT                   8199989..8200109,8204094..8204189,8205909..8206042)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52512"
FT                   /product="mCG52512, isoform CRA_a"
FT                   /note="gene_id=mCG52512.1 transcript_id=mCT192645.0
FT                   protein_id=mCP113598.0 isoform=CRA_a"
FT                   /protein_id="EDL29288.1"
FT                   /translation="GSGFDMQSTDLGNKESGKIWHRKPSPATHDGIIVNIVHSTSEYHP
FT                   KVLRFLNVAFDGSGDSFIAGDHQGNIYVFDLHGNRFNLVQRTAQACTALAFNLRRKSEF
FT                   LVALADYSIKCFDTVTKELVSWMRGHESSVCSISVHASGRYAITTSSDTAQLWDLDTFQ
FT                   RKRKLNIRQSVGIQKVFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPGPPEGSNILY
FT                   KVFAVTRDGRILAAGGKSNHLHLWCLEATGLFRIIQMPAKVRAVRHLEFLPDSFDAGSN
FT                   QVLGVLSQDGIMRFVNIQTCKLLFEIGTVEEGISSSVISPHGRYIASIMENGSLNVYSV
FT                   QALTQEINKPPPPLVKVIEDLPSNTVSSSNLKMKIMPGRVQRPARCKESKIPTRVLKQD
FT                   LTGDLENKENELSEGLNKKRLQILLKGYGEYPTKYRMFIWRSLLQLPENHTAFSSLVDK
FT                   GTHAAYLSLQKKYPIKSRKLLRVLQRTLSALAHWSAIFSDTPYLPLLAFPFVKLFQNNQ
FT                   LICFEVVATLIINWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHFIDRDITSQVYA
FT                   WPLLETLFSEVLTREEWLRLFDNIFSNHPSFLLMTVVAYSTCSRAPLLNCTLKNDFEYF
FT                   FHHRNNLDINVVIREVYHLMETTPADIHPNSMLDAFVALTKGQYPIFNQYPKFIVDYQT
FT                   REWERIRNDELDFLRERQTVENMQAEVDEQRAKDEAWYQKQELLRRAEETRREILLQEE
FT                   EKMAQQRQRLAAVKRELEIKEIHLQDAARRRLLKLQQDQREMELRRLEDEIERKVQMRD
FT                   QEIAATAKDLEIRQLELEAQKRLYEKDLTTSQEAVAKEIREDTDAHRRKAALEEHMFQK
FT                   LLENSQMGGRRAQRWKEAEEKEFHLQSAKKASALSDASRKWFLRQETSAALEHEEMPWL
FT                   QRQYMDSAYLPQTSRLHDVSDMDPSTHIFSRNYPTEWNHMEHDLLKNVRDLRRRLTARA
FT                   RNSCRHPHLLVT"
FT   CDS             join(8159110..8159265,8168660..8168811,8172276..8172435,
FT                   8174087..8174287,8176808..8176984,8178555..8178634,
FT                   8178718..8178864,8185134..8185267,8187159..8187292,
FT                   8187817..8187996,8188940..8189172,8189672..8189824,
FT                   8191457..8191592,8194522..8194614,8197028..8197168,
FT                   8198254..8198406,8199989..8200109,8204094..8204189,
FT                   8205909..8206042)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52512"
FT                   /product="mCG52512, isoform CRA_b"
FT                   /note="gene_id=mCG52512.1 transcript_id=mCT52695.2
FT                   protein_id=mCP28260.2 isoform=CRA_b"
FT                   /protein_id="EDL29289.1"
FT                   /translation="MRGHESSVCSISVHASGRYAITTSSDTAQLWDLDTFQRKRKLNIR
FT                   QSVGIQKVFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPGPPEGSNILYKVFAVTRD
FT                   GRILAAGGKSNHLHLWCLEATGLFRIIQMPAKVRAVRHLEFLPDSFDAGSNQVLGVLSQ
FT                   DGIMRFVNIQTCKLLFEIGTVEEGISSSVISPHGRYIASIMENGSLNVYSVQALTQEIN
FT                   KPPPPLVKVIEDLPSNTVSSSNLKMKIMPGRVQRPARCKESKIPTRVLKQDLTGDLENK
FT                   ENELSEGLNKKRLQILLKGYGEYPTKYRMFIWRSLLQLPENHTAFSSLVDKGTHAAYLS
FT                   LQKKYPIKSRKLLRVLQRTLSALAHWSAIFSDTPYLPLLAFPFVKLFQNNQLICFEVVA
FT                   TLIINWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHFIDRDITSQVYAWPLLETLF
FT                   SEVLTREEWLRLFDNIFSNHPSFLLMTVVAYSTCSRAPLLNCTLKNDFEYFFHHRNNLD
FT                   INVVIREVYHLMETTPADIHPNSMLDAFVALTKGQYPIFNQYPKFIVDYQTREWERIRN
FT                   DELDFLRERQTVENMQAEVDEQRAKDEAWYQKQELLRRAEETRREILLQEEEKMAQQRQ
FT                   RLAAVKRELEIKEIHLQDAARRRLLKLQQDQREMELRRLEDEIERKVQMRDQEIAATAK
FT                   DLEIRQLELEAQKRLYEKDLTTSQEAVAKEIREDTDAHRRKAALEEHMFQKLLENSQMG
FT                   GRRAQRVMEDNLAKAEQACLNADWQIQTLHKQKCADQQRSQGYYDVATLLRENRRKEWK
FT                   EAEEKEFHLQSAKKASALSDASRKWFLRQETSAALEHEEMPWLQRQYMDSAYLPQTSRL
FT                   HDVSDMDPSTHIFSRNYPTEWNHMEHDLLKNVRDLRRRLTARARNSCRHPHLLVT"
FT   gap             8163255..8163274
FT                   /estimated_length=20
FT   gap             8170766..8170837
FT                   /estimated_length=72
FT   gene            8222087..>8245573
FT                   /gene="BC030396"
FT                   /locus_tag="mCG_7717"
FT                   /note="gene_id=mCG7717.2"
FT   mRNA            join(8222087..8222725,8228725..8228892,8231032..8231156,
FT                   8245036..>8245573)
FT                   /gene="BC030396"
FT                   /locus_tag="mCG_7717"
FT                   /product="cDNA sequence BC030396"
FT                   /note="gene_id=mCG7717.2 transcript_id=mCT6645.2 created on
FT                   31-OCT-2002"
FT   CDS             join(8222246..8222725,8228725..8228892,8231032..8231156,
FT                   8245036..8245573)
FT                   /codon_start=1
FT                   /gene="BC030396"
FT                   /locus_tag="mCG_7717"
FT                   /product="cDNA sequence BC030396"
FT                   /note="gene_id=mCG7717.2 transcript_id=mCT6645.2
FT                   protein_id=mCP5544.2"
FT                   /protein_id="EDL29290.1"
FT                   /translation="MSRSRHVGKIRKRLEDVKNQWTRPARADFSDNESARLATDALLDG
FT                   GPEAYWRALSQEGEVDFLSSAEAQYIQAQAKEPPDAPDSAGGAESGPRGLDSCSLQSGT
FT                   YFPVASEGSEPALLHTWTLAEKPYLKEKSSATIYFQMDKHNNIRDLVRRCISRASQVLA
FT                   ILMDVFTDVEILCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQISDIHLKNISIRS
FT                   VEGEVYCAKSGRKFAGQIQEKFIISDWRFVLSGSYSFSWLCGHVHRNILSKFTGQAVEL
FT                   FDEEFRRLYASSKPLMGLKSPRLVAPFQPNKGPEAPNGRLSGTSDSASDRTSSNPFSSL
FT                   STGSNAHNQSLSTSSGPSSPLAPIPPTVPRLQPYHSTRRAVAPQPLLVPMRPHEGAPAP
FT                   YSSLMAYRPTRLQLQQLGLVPRVTHPWRPFLQALPHF"
FT   gap             8226244..8226263
FT                   /estimated_length=20
FT   gap             8231829..8232081
FT                   /estimated_length=253
FT   gene            complement(8253292..8311704)
FT                   /locus_tag="mCG_7720"
FT                   /note="gene_id=mCG7720.3"
FT   mRNA            complement(join(8253292..8256135,8257744..8258048,
FT                   8260759..8260891,8264099..8264529,8266442..8266585,
FT                   8304801..8304911,8311640..8311669))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT180768"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT180768.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(8253292..8256135,8257744..8258048,
FT                   8260759..8260891,8264099..8264529,8266442..8266585,
FT                   8267469..8267564,8304801..8304911,8311640..8311669))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT174570"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT174570.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(8253292..8256135,8257744..8258048,
FT                   8260759..8260891,8264099..8264529,8266442..8266585,
FT                   8282024..8282238))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT185634"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT185634.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(8253292..8256135,8257744..8258048,
FT                   8260759..8260891,8264099..8264529,8266442..8266585,
FT                   8267469..8267564,8269569..8269813))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT6641"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT6641.2 created on
FT                   11-JUN-2003"
FT   CDS             complement(join(8257851..8258048,8260759..8260891,
FT                   8264099..8264529,8266442..8266585,8304801..8304821))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_a"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT180768.1
FT                   protein_id=mCP103690.0 isoform=CRA_a"
FT                   /protein_id="EDL29291.1"
FT                   /translation="MLKKLWQKALQEYSSISEQLPSTNFAMKRDVQEGQARCLAHLGRH
FT                   EEALEMAADLESKATNTDHLTVVLHLHLAVFSSLQSREHTILCLHKLIALHPLNPWSWC
FT                   KLAEAYLSPGPGLPAGVSPQGQKSSASSDKAVGPSSVHSGTGSLLSLPTTLPENALLSV
FT                   EASGSAQENMPSLARRREEAQMEARRKACASLLRARLLLQLAQSQQTSFALEKNLRTQQ
FT                   EIAGKVKDFNFREDTLLLMEEAMGEDIVPEKIKEELHSEVKCVGPGALTAMVVASSKEF
FT                   EDKWFRKIKDHFCPLGNQFHVEVEIIA"
FT   CDS             complement(join(8257851..8258048,8260759..8260891,
FT                   8264099..8264529,8266442..8266585,8267469..8267564,
FT                   8304801..8304821))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_d"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT174570.1
FT                   protein_id=mCP97489.0 isoform=CRA_d"
FT                   /protein_id="EDL29294.1"
FT                   /translation="MLKKLWQWFYEETECSDDIEVLTLKKFRGDLAYRRQEYEKALQEY
FT                   SSISEQLPSTNFAMKRDVQEGQARCLAHLGRHEEALEMAADLESKATNTDHLTVVLHLH
FT                   LAVFSSLQSREHTILCLHKLIALHPLNPWSWCKLAEAYLSPGPGLPAGVSPQGQKSSAS
FT                   SDKAVGPSSVHSGTGSLLSLPTTLPENALLSVEASGSAQENMPSLARRREEAQMEARRK
FT                   ACASLLRARLLLQLAQSQQTSFALEKNLRTQQEIAGKVKDFNFREDTLLLMEEAMGEDI
FT                   VPEKIKEELHSEVKCVGPGALTAMVVASSKEFEDKWFRKIKDHFCPLGNQFHVEVEIIA
FT                   "
FT   CDS             complement(join(8257851..8258048,8260759..8260891,
FT                   8264099..8264529,8266442..8266585,8267469..8267564,
FT                   8269569..8269685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_e"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT6641.2
FT                   protein_id=mCP5523.2 isoform=CRA_e"
FT                   /protein_id="EDL29296.1"
FT                   /translation="METGCWVLGGEFEDSVFEQRPERRPEPPSPYRAKLCEPQWFYEET
FT                   ECSDDIEVLTLKKFRGDLAYRRQEYEKALQEYSSISEQLPSTNFAMKRDVQEGQARCLA
FT                   HLGRHEEALEMAADLESKATNTDHLTVVLHLHLAVFSSLQSREHTILCLHKLIALHPLN
FT                   PWSWCKLAEAYLSPGPGLPAGVSPQGQKSSASSDKAVGPSSVHSGTGSLLSLPTTLPEN
FT                   ALLSVEASGSAQENMPSLARRREEAQMEARRKACASLLRARLLLQLAQSQQTSFALEKN
FT                   LRTQQEIAGKVKDFNFREDTLLLMEEAMGEDIVPEKIKEELHSEVKCVGPGALTAMVVA
FT                   SSKEFEDKWFRKIKDHFCPLGNQFHVEVEIIA"
FT   CDS             complement(join(8257851..8258048,8260759..8260891,
FT                   8264099..8264529,8266442..8266528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_b"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT185634.0
FT                   protein_id=mCP106892.0 isoform=CRA_b"
FT                   /protein_id="EDL29292.1"
FT                   /translation="MKRDVQEGQARCLAHLGRHEEALEMAADLESKATNTDHLTVVLHL
FT                   HLAVFSSLQSREHTILCLHKLIALHPLNPWSWCKLAEAYLSPGPGLPAGVSPQGQKSSA
FT                   SSDKAVGPSSVHSGTGSLLSLPTTLPENALLSVEASGSAQENMPSLARRREEAQMEARR
FT                   KACASLLRARLLLQLAQSQQTSFALEKNLRTQQEIAGKVKDFNFREDTLLLMEEAMGED
FT                   IVPEKIKEELHSEVKCVGPGALTAMVVASSKEFEDKWFRKIKDHFCPLGNQFHVEVEII
FT                   A"
FT   mRNA            complement(join(8282786..8284265,8287704..8290562,
FT                   8304801..8304911,8311640..8311704))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT175832"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT175832.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(8282786..8284265,8287704..8290562,
FT                   8299537..8299662,8304801..8304911,8311640..8311697))
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, transcript variant mCT185635"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT185635.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(8287707..8290328)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_c"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT185635.0
FT                   protein_id=mCP106893.0 isoform=CRA_c"
FT                   /protein_id="EDL29293.1"
FT                   /translation="MASRRKSTTPCMVLASEQDPDLELISDLDEGPPILTPVENAKAES
FT                   VSSDEEVHGSVDSDNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVC
FT                   VECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENT
FT                   EQGESIDVSSSGISISKTPIMKMMKNKVENKRITVHHNSAEGTSEEKENGVKASQEENA
FT                   ESVSSSALESNTSTSTINRVHPSPASTVVTPTAVLPGLAQVITAVSAQQNSNLLPKVLI
FT                   PVNSIPTYNAALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHG
FT                   VSWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLT
FT                   QVAGTNTLPVTAPIALTVAGVPNQTNVQKSQVPAAQPATDTKPATAAVPSSPSVRPEAA
FT                   LVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRY
FT                   NQRNSKSNQCLHLNNDSSATIIIDSSDETPEPPAAAASQQKQSWNPFPDFAPQKFKEKT
FT                   AEQLRALQASFLNSSVLTDEEVNRLRAQTKLTRREIDAWFTEKNKTKALKDEKIEVDES
FT                   NVGSSKEEPGESSPGDETVAPKSGGTGKICKKTPEQLHMLKSAFVRTQWPSAEEYDKLA
FT                   EESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSSNSSSLNGLSSLRRRGRGRPKGRGR
FT                   GRPRGRPRGGKRMNTWDRVPSLIKFKTGTAILKDYYLKHKFLNEQDLDELVNRSHMGYE
FT                   QVREWFAERQRRSELGIELFEENEEEDEVVDDQEEDEEETDDSDTWEPPRHVKRKLSKS
FT                   DD"
FT   CDS             complement(8287707..8290328)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7720"
FT                   /product="mCG7720, isoform CRA_c"
FT                   /note="gene_id=mCG7720.3 transcript_id=mCT175832.0
FT                   protein_id=mCP98754.0 isoform=CRA_c"
FT                   /protein_id="EDL29295.1"
FT                   /translation="MASRRKSTTPCMVLASEQDPDLELISDLDEGPPILTPVENAKAES
FT                   VSSDEEVHGSVDSDNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVC
FT                   VECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENT
FT                   EQGESIDVSSSGISISKTPIMKMMKNKVENKRITVHHNSAEGTSEEKENGVKASQEENA
FT                   ESVSSSALESNTSTSTINRVHPSPASTVVTPTAVLPGLAQVITAVSAQQNSNLLPKVLI
FT                   PVNSIPTYNAALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHG
FT                   VSWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLT
FT                   QVAGTNTLPVTAPIALTVAGVPNQTNVQKSQVPAAQPATDTKPATAAVPSSPSVRPEAA
FT                   LVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRY
FT                   NQRNSKSNQCLHLNNDSSATIIIDSSDETPEPPAAAASQQKQSWNPFPDFAPQKFKEKT
FT                   AEQLRALQASFLNSSVLTDEEVNRLRAQTKLTRREIDAWFTEKNKTKALKDEKIEVDES
FT                   NVGSSKEEPGESSPGDETVAPKSGGTGKICKKTPEQLHMLKSAFVRTQWPSAEEYDKLA
FT                   EESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSSNSSSLNGLSSLRRRGRGRPKGRGR
FT                   GRPRGRPRGGKRMNTWDRVPSLIKFKTGTAILKDYYLKHKFLNEQDLDELVNRSHMGYE
FT                   QVREWFAERQRRSELGIELFEENEEEDEVVDDQEEDEEETDDSDTWEPPRHVKRKLSKS
FT                   DD"
FT   gene            complement(8329526..8370478)
FT                   /locus_tag="mCG_7707"
FT                   /note="gene_id=mCG7707.1"
FT   mRNA            complement(join(8329526..8331054,8332060..8332188,
FT                   8332735..8332868,8333842..8334231,8335194..8335337,
FT                   8335450..8335572,8337721..8337880,8338542..8338738,
FT                   8339775..8339910,8340821..8341006,8342069..8342255,
FT                   8343425..8343539,8343647..8343961,8345292..8345382,
FT                   8346461..8346620,8349514..8349602,8351016..8351190,
FT                   8352112..8352227,8352582..8352690,8353689..8353793,
FT                   8356336..8356453,8357847..8357996,8361136..8361223,
FT                   8361442..8361544,8361943..8362108,8363604..8363650,
FT                   8367588..8367736,8370202..8370478))
FT                   /locus_tag="mCG_7707"
FT                   /product="mCG7707"
FT                   /note="gene_id=mCG7707.1 transcript_id=mCT6651.2 created on
FT                   14-OCT-2002"
FT   CDS             complement(join(8331010..8331054,8332060..8332188,
FT                   8332735..8332868,8333842..8334231,8335194..8335337,
FT                   8335450..8335572,8337721..8337880,8338542..8338738,
FT                   8339775..8339910,8340821..8341006,8342069..8342255,
FT                   8343425..8343539,8343647..8343961,8345292..8345382,
FT                   8346461..8346620,8349514..8349602,8351016..8351190,
FT                   8352112..8352227,8352582..8352690,8353689..8353793,
FT                   8356336..8356453,8357847..8357996,8361136..8361223,
FT                   8361442..8361544,8361943..8362108,8363604..8363650,
FT                   8367588..8367736,8370202..8370369))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7707"
FT                   /product="mCG7707"
FT                   /note="gene_id=mCG7707.1 transcript_id=mCT6651.2
FT                   protein_id=mCP5566.2"
FT                   /db_xref="GOA:G3X963"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1917722"
FT                   /db_xref="UniProtKB/TrEMBL:G3X963"
FT                   /protein_id="EDL29297.1"
FT                   /translation="MVVLRSSLELHSRSTTSSATDSLDLSSEFLSLQDSGGRRPRLRRA
FT                   GRKSTASKAAGDGFTVKGAETYHNTRSLRSLRNQAQTSSESSFDKNVDRTEKYSNGRHF
FT                   TRQFARQQADKKEECKEDKVIPVIRSLRNRNIAPTAEHLHEQSGDVEVRRSCRIRSRYS
FT                   TMNQSVLFDKLITNTAEAVLQKMDDMKKMRRQRMKKLEDLGVFNETEESNLTMYTRGKL
FT                   KAIQRADEETTDNQDGSVESSEEGEEQEDDDGEDEDDEDEEEGEEDNQKRYYLRQRKTT
FT                   VYYQSPLESKPRHQRKPNMFYSGPASPARPRFRLSSTGPRSPYCKRMSRRRHAIHSSDS
FT                   TSSSSSEDDCFERRTKRNRNRAINRCLPLNFRKDEIRGIYKDRMKIGASLADVDPMQLD
FT                   TSVRFDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARA
FT                   LANECSRGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAP
FT                   VRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFS
FT                   LPDKNARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCALRRRYP
FT                   QIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHR
FT                   ILDALQKVFPHVEVGTNKSLNSDVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHL
FT                   NRNACYQPMSFRPRLLIVGEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGISTTSPE
FT                   EACSQMIREAKRTAPSIVYVPHIHLWWEIVGPTLKATFTTLLQTIPSFAPVLLLATSEK
FT                   PYSALPEEVQELFTHDYGEIFNVQLPDKEERTKFFEDLILKQASKPPVSQKKAVLQALE
FT                   VLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPD
FT                   EVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIR
FT                   HRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSPPV
FT                   GDKKPDQEQNEKLKVPCTPVACSTPAQLKRKFHKKSKWHVGTKIKRRKISQAKDNSLNA
FT                   MNSSSRSDTEDSQHTHAEHTEPGNTDESSVEESDKQNRLESNIDLKNNSSSSNIENELE
FT                   EPKETTEGTELRKDRIVCRGDASASQVTDIPEDSESKEMDFLRMTLARGSQVEQQELIS
FT                   MEQALAILSQPTPSLVLDHKQLTNILKTVVKKSQKYNIFQLENLYAVISQCIYEHRRDY
FT                   DKTALVQKMEQAVENFNCSRS"
FT   gap             8336973..8336992
FT                   /estimated_length=20
FT   gap             8355915..8355934
FT                   /estimated_length=20
FT   gene            8356945..8357317
FT                   /pseudo
FT                   /locus_tag="mCG_7718"
FT                   /note="gene_id=mCG7718.1"
FT   mRNA            join(8356945..8357079,8357115..8357317)
FT                   /pseudo
FT                   /locus_tag="mCG_7718"
FT                   /note="gene_id=mCG7718.1 transcript_id=mCT6646.1 created on
FT                   07-NOV-2002"
FT   gap             8376564..8376604
FT                   /estimated_length=41
FT   gene            8376855..8394102
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /note="gene_id=mCG7710.1"
FT   mRNA            join(8376855..8377030,8383783..8383882,8386055..8386105,
FT                   8388046..8388194,8389029..8389153,8393351..8394102)
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, transcript variant
FT                   mCT6654"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT6654.1 created on
FT                   26-FEB-2003"
FT   mRNA            join(8376856..8377030,8383783..8383882,8386055..8386105,
FT                   8388046..8388194,8389029..8389153,8390588..8390774)
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, transcript variant
FT                   mCT180766"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT180766.0 created
FT                   on 26-FEB-2003"
FT   mRNA            join(8376867..8377030,8383783..8383882,8386055..8386105,
FT                   8393351..8394101)
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, transcript variant
FT                   mCT174568"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT174568.0 created
FT                   on 26-FEB-2003"
FT   CDS             join(8376942..8377030,8383783..8383882,8386055..8386105,
FT                   8388046..8388194,8389029..8389153,8393351..8393466)
FT                   /codon_start=1
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, isoform CRA_c"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT6654.1
FT                   protein_id=mCP5573.2 isoform=CRA_c"
FT                   /protein_id="EDL29300.1"
FT                   /translation="MEGDGPAATAPQYQPVCPTRDACVYNSCYCEENIWKLCEYIKTHN
FT                   QYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWDYHVVLLHVSREGQSFIYDLDTIL
FT                   PFPCPFDIYIEDALKSDDDIHLQFRRKFRVVRADSYLKHFASDRSHMKDSSGNWREPPP
FT                   EYPCIETGDSKMNLNDFISMDPAVGWGAVYTLPEFVHRFSSKTYQA"
FT   CDS             join(8376942..8377030,8383783..8383882,8386055..8386105,
FT                   8393351..8393362)
FT                   /codon_start=1
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, isoform CRA_a"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT174568.0
FT                   protein_id=mCP97487.0 isoform=CRA_a"
FT                   /protein_id="EDL29298.1"
FT                   /translation="MEGDGPAATAPQYQPVCPTRDACVYNSCYCEENIWKLCEYIKTHN
FT                   QYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWTPK"
FT   CDS             join(8376942..8377030,8383783..8383882,8386055..8386105,
FT                   8388046..8388194,8389029..8389153,8390588..8390652)
FT                   /codon_start=1
FT                   /gene="2410187C16Rik"
FT                   /locus_tag="mCG_7710"
FT                   /product="RIKEN cDNA 2410187C16, isoform CRA_b"
FT                   /note="gene_id=mCG7710.1 transcript_id=mCT180766.0
FT                   protein_id=mCP103688.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CWD7"
FT                   /db_xref="InterPro:IPR023128"
FT                   /db_xref="MGI:MGI:1924023"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CWD7"
FT                   /protein_id="EDL29299.1"
FT                   /translation="MEGDGPAATAPQYQPVCPTRDACVYNSCYCEENIWKLCEYIKTHN
FT                   QYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWDYHVVLLHVSREGQSFIYDLDTIL
FT                   PFPCPFDIYIEDALKSDDDIHLQFRRKFRVVRADSYLKHFASDRSHMKDSSGNWREPPP
FT                   EYPCIETGAQDGWIPEAGYVSWTSEVQLP"
FT   gap             8396933..8396992
FT                   /estimated_length=60
FT   gap             8409043..8409073
FT                   /estimated_length=31
FT   gene            complement(8415509..8450285)
FT                   /gene="Fbxo32"
FT                   /locus_tag="mCG_7703"
FT                   /note="gene_id=mCG7703.1"
FT   mRNA            complement(join(8415509..8416985,8418265..8418408,
FT                   8419512..8419694,8426715..8426899,8427701..8427794,
FT                   8440646..8440738,8441632..8441681,8443362..8443474,
FT                   8449907..8450285))
FT                   /gene="Fbxo32"
FT                   /locus_tag="mCG_7703"
FT                   /product="F-box only protein 32"
FT                   /note="gene_id=mCG7703.1 transcript_id=mCT6661.0 created on
FT                   09-AUG-2002"
FT   CDS             complement(join(8416896..8416985,8418265..8418408,
FT                   8419512..8419694,8426715..8426899,8427701..8427794,
FT                   8440646..8440738,8441632..8441681,8443362..8443474,
FT                   8449907..8450022))
FT                   /codon_start=1
FT                   /gene="Fbxo32"
FT                   /locus_tag="mCG_7703"
FT                   /product="F-box only protein 32"
FT                   /note="gene_id=mCG7703.1 transcript_id=mCT6661.0
FT                   protein_id=mCP5555.1"
FT                   /protein_id="EDL29301.1"
FT                   /translation="MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEV
FT                   YSKENLFSSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAF
FT                   NRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNI
FT                   RLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNSIQISRPAFKG
FT                   LTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRK
FT                   RLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESC
FT                   SVSLSPQDFINLFKF"
FT   gene            complement(8428466..8444869)
FT                   /locus_tag="mCG_148003"
FT                   /note="gene_id=mCG148003.0"
FT   mRNA            complement(join(8428466..8430872,8444821..8444869))
FT                   /locus_tag="mCG_148003"
FT                   /product="mCG148003"
FT                   /note="gene_id=mCG148003.0 transcript_id=mCT188266.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8429671..8430009)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148003"
FT                   /product="mCG148003"
FT                   /note="gene_id=mCG148003.0 transcript_id=mCT188266.0
FT                   protein_id=mCP108968.0"
FT                   /protein_id="EDL29302.1"
FT                   /translation="MVLSRLPCRSRLQTARLLFSFISLYASHVRLWALINHWPGLLEPA
FT                   AVAQGENERFVFFFHCHVLIGGRTELGGHRALRSLCMDRASPTHPPHIPGRVLMSTLSA
FT                   SLLSAPDF"
FT   gap             8442856..8442916
FT                   /estimated_length=61
FT   gap             8461261..8461317
FT                   /estimated_length=57
FT   gap             8463718..8463737
FT                   /estimated_length=20
FT   gap             8465471..8465818
FT                   /estimated_length=348
FT   gap             8517205..8517311
FT                   /estimated_length=107
FT   gene            complement(8550006..>8559776)
FT                   /gene="8230402K04Rik"
FT                   /locus_tag="mCG_7706"
FT                   /note="gene_id=mCG7706.2"
FT   mRNA            complement(join(8550006..8550547,8551658..8551763,
FT                   8557588..8558938,8559565..>8559776))
FT                   /gene="8230402K04Rik"
FT                   /locus_tag="mCG_7706"
FT                   /product="RIKEN cDNA 8230402K04"
FT                   /note="gene_id=mCG7706.2 transcript_id=mCT6650.2 created on
FT                   11-NOV-2002"
FT   CDS             complement(join(8550258..8550547,8551658..8551763,
FT                   8557588..8558938,8559565..>8559704))
FT                   /codon_start=1
FT                   /gene="8230402K04Rik"
FT                   /locus_tag="mCG_7706"
FT                   /product="RIKEN cDNA 8230402K04"
FT                   /note="gene_id=mCG7706.2 transcript_id=mCT6650.2
FT                   protein_id=mCP5559.2"
FT                   /protein_id="EDL29303.1"
FT                   /translation="TNPELSEDRELANGKARALWFYSEPKVEILRGQDRPSISGCHCSK
FT                   TRMDEELPDGVVFKDHSFSSDLLRQLNGLRQSKILTDVSICSGAWEVPCHRSVLASSSP
FT                   YFKAMFCSHFRESREAKVQMKGISSTTLEQVITYVYTGEVHISAANVLPLMEAAAMLQY
FT                   PRVFEACSSYLQSQLAPSNCLGLVRLAEILSCDSLKKKAKEVALTYFPEVAASADLKEL
FT                   CAMELRDYLGDDRLCGEEEKVFEALMAWVKHDLQARWRHMQELLQQVRLQYIHPAFFHH
FT                   FIANDALLQSSPACQAILEMARKQIFSLYGPSAQDCKLLWRMPPRSSYQDFLLLLGGRK
FT                   DNQQTTRDVLLYSGQTGQWQSLAKLPIRLYKASAVTLHRSVYVLGGMTVSEGKSLISCG
FT                   VYIFSLKLNQWRVGEPMLAARYSHRSTTHRNFIFSIGGTGEGQELLASMERYDSIRDVW
FT                   ESMAGMPVAVLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNTWYKMETRMIKNV
FT                   CAPAVVLGEQIVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGR
FT                   RLTTDCNIEDSASFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPHMTSLS"
FT   gap             8552500..8552955
FT                   /estimated_length=456
FT   gap             8572335..8572354
FT                   /estimated_length=20
FT   gene            complement(8577095..8632979)
FT                   /gene="Anxa13"
FT                   /locus_tag="mCG_115521"
FT                   /note="gene_id=mCG115521.0"
FT   mRNA            complement(join(8577095..8577620,8580552..8580664,
FT                   8583903..8583978,8592320..8592399,8592504..8592537,
FT                   8596284..8596454,8599754..8599848,8607644..8607722,
FT                   8632951..8632979))
FT                   /gene="Anxa13"
FT                   /locus_tag="mCG_115521"
FT                   /product="annexin A13"
FT                   /note="gene_id=mCG115521.0 transcript_id=mCT116627.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(8577501..8577620,8580552..8580664,
FT                   8583903..8583978,8592320..8592399,8592504..8592537,
FT                   8596284..8596454,8599754..8599848,8607644..8607722,
FT                   8632951..8632965))
FT                   /codon_start=1
FT                   /gene="Anxa13"
FT                   /locus_tag="mCG_115521"
FT                   /product="annexin A13"
FT                   /note="gene_id=mCG115521.0 transcript_id=mCT116627.0
FT                   protein_id=mCP60461.1"
FT                   /protein_id="EDL29304.1"
FT                   /translation="MGNRHAKERSHHHGFDADRDAKKLYKACKGMGTDEAAIIEVLSSR
FT                   TSEERQQIKQKYKEKYGKDLEEVLNSELSGNFKKTALALLDRPNEYAARQLQKAMKGVG
FT                   TDEAMLIEILCTRSNKEIVAIKEAYQRLFGRSLESDVKEDTSGNLRKILVSLLQLIGKD
FT                   MEETIEEETSGDLKKAYLTIVRCAQDLEGYFADLLYKAMKGMGTDEETLIRIIVTRAEV
FT                   DLQGIKAKFQEKYQKSLSDMVHSDTSGDFRKLLVALLH"
FT   gap             8584328..8584880
FT                   /estimated_length=553
FT   gap             8585965..8590769
FT                   /estimated_length=4805
FT   gap             8600732..8600751
FT                   /estimated_length=20
FT   gap             8629985..8630076
FT                   /estimated_length=92
FT   gap             8630953..8631500
FT                   /estimated_length=548
FT   gene            8649557..8655061
FT                   /locus_tag="mCG_148014"
FT                   /note="gene_id=mCG148014.0"
FT   mRNA            join(8649557..8649772,8653886..8655061)
FT                   /locus_tag="mCG_148014"
FT                   /product="mCG148014"
FT                   /note="gene_id=mCG148014.0 transcript_id=mCT188277.0
FT                   created on 13-JAN-2004"
FT   CDS             8654358..8654591
FT                   /codon_start=1
FT                   /locus_tag="mCG_148014"
FT                   /product="mCG148014"
FT                   /note="gene_id=mCG148014.0 transcript_id=mCT188277.0
FT                   protein_id=mCP108978.0"
FT                   /protein_id="EDL29305.1"
FT                   /translation="MLYEISPWWPPSVLQLSSFGVEAFWVDTWNLPFHIRHGDWNTNRL
FT                   QKIDIEYSIFTHRYGVLEFLEGCMAEHLSASL"
FT   gene            8659222..8701972
FT                   /gene="D15Ertd621e"
FT                   /locus_tag="mCG_115519"
FT                   /note="gene_id=mCG115519.1"
FT   mRNA            join(8659222..8659512,8663935..8664019,8665482..8665633,
FT                   8667057..8667114,8667933..8668000,8668513..8668626,
FT                   8670330..8670420,8670790..8670852,8673728..8673834,
FT                   8673915..8673953,8674398..8674510,8674942..8675057,
FT                   8676251..8676363,8676630..8676716,8678400..8678532,
FT                   8685750..8685898,8687004..8687138,8687333..8687446,
FT                   8691758..8691830,8692515..8692664,8694103..8694207,
FT                   8694710..8694833,8697155..8697224,8698922..8701972)
FT                   /gene="D15Ertd621e"
FT                   /locus_tag="mCG_115519"
FT                   /product="DNA segment, Chr 15, ERATO Doi 621, expressed,
FT                   transcript variant mCT116625"
FT                   /note="gene_id=mCG115519.1 transcript_id=mCT116625.1
FT                   created on 11-NOV-2002"
FT   mRNA            join(<8659411..8659490,8685801..8685898,8687004..8687138,
FT                   8687333..8687446,8691758..8691830,8692515..8692664,
FT                   8694103..8694207,8694710..8694833,8697155..8697224,
FT                   8698922..8701909)
FT                   /gene="D15Ertd621e"
FT                   /locus_tag="mCG_115519"
FT                   /product="DNA segment, Chr 15, ERATO Doi 621, expressed,
FT                   transcript variant mCT175822"
FT                   /note="gene_id=mCG115519.1 transcript_id=mCT175822.0
FT                   created on 11-NOV-2002"
FT   CDS             join(8659441..8659512,8663935..8664019,8665482..8665633,
FT                   8667057..8667114,8667933..8668000,8668513..8668626,
FT                   8670330..8670420,8670790..8670852,8673728..8673834,
FT                   8673915..8673953,8674398..8674510,8674942..8675057,
FT                   8676251..8676363,8676630..8676716,8678400..8678532,
FT                   8685750..8685898,8687004..8687138,8687333..8687446,
FT                   8691758..8691830,8692515..8692664,8694103..8694207,
FT                   8694710..8694833,8697155..8697224,8698922..8699104)
FT                   /codon_start=1
FT                   /gene="D15Ertd621e"
FT                   /locus_tag="mCG_115519"
FT                   /product="DNA segment, Chr 15, ERATO Doi 621, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG115519.1 transcript_id=mCT116625.1
FT                   protein_id=mCP60442.1 isoform=CRA_a"
FT                   /db_xref="GOA:B6YY24"
FT                   /db_xref="InterPro:IPR028091"
FT                   /db_xref="InterPro:IPR028097"
FT                   /db_xref="MGI:MGI:1277178"
FT                   /db_xref="UniProtKB/TrEMBL:B6YY24"
FT                   /protein_id="EDL29306.1"
FT                   /translation="MNIDVEFHIRHNYPWSKLPTNVKQSLGNSQREYEKQVVLYSIRNQ
FT                   LRYRNNLVKHVKKDERKYYEELLKYSRDHLMLYPYHLSDIMVKGLRITPFSYYAGIMED
FT                   IMNSEKSYDSLPNFTAADCLRLLGIGRNQYIDLMNQCRSSKKFFRRKTARDLLPMKPVE
FT                   IAIEAWWVVQAGYITEDDIKICTFPEKGAIDKIIDSGPQLSGSLDYNVVHSLYNKGFIY
FT                   LDVPISDDSCIAVPPLEGFVMNRVQGDYFETLLYKIFVSIDEHTNVAELANVLEIDLSL
FT                   VKNAVSMYCRLGFAHKKGQVINLDQLHSSWKNVPSVNRLKSTLDPQKMLLSWDGGESRS
FT                   PVQEASSATDTDTNSQEDPADTASVSSLSLSTGYTKRIAFLFDSTLTAFLMMGNLSPNL
FT                   KSHAVTMFEVGKLSDESLDSFLIELEKVQSTGEGEAQRYFDHALTLRNTILFLRHNKDL
FT                   VAQTSQPDQPNYGFPLDLLRCESLLGLDPATCSRVLNKNYTLLVSMAPLTNEIRPVSSC
FT                   TPQHIGPAIPEVSSVWFKLYIYHVTGQGPPSLLLSKGTRLRKLPDIFQGYDRLLITSWG
FT                   HDPGVVPASNVLTMLNDALTHSAVLIQGHGLHGVGETVHIPFPFDEAELQGEFTRASMG
FT                   VHKALQILRSRVDLQHFCGYVTMLNASSQLASRKLSEASDERGEPDLASSSDVNGSTES
FT                   FEMVIEEASTDLATKPNSGATAEADWVPLELCFGIPLFSSELNRKVCQKIATHGLCRKE
FT                   SLQSLLHSSRKLSLQVLNFVHSFQEGAATLDLHAEPGFSSVLSQSPCADMGVPLPAKNL
FT                   MFKDGVLSEWSGRSPSSLLIASLHL"
FT   CDS             join(<8659445..8659490,8685801..8685898,8687004..8687138,
FT                   8687333..8687446,8691758..8691830,8692515..8692664,
FT                   8694103..8694207,8694710..8694833,8697155..8697224,
FT                   8698922..8699104)
FT                   /codon_start=1
FT                   /gene="D15Ertd621e"
FT                   /locus_tag="mCG_115519"
FT                   /product="DNA segment, Chr 15, ERATO Doi 621, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG115519.1 transcript_id=mCT175822.0
FT                   protein_id=mCP98744.0 isoform=CRA_b"
FT                   /protein_id="EDL29307.1"
FT                   /translation="TSTLSSTSGTIILGATTCSRVLNKNYTLLVSMAPLTNEIRPVSSC
FT                   TPQHIGPAIPEVSSVWFKLYIYHVTGQGPPSLLLSKGTRLRKLPDIFQGYDRLLITSWG
FT                   HDPGVVPASNVLTMLNDALTHSAVLIQGHGLHGVGETVHIPFPFDEAELQGEFTRASMG
FT                   VHKALQILRSRVDLQHFCGYVTMLNASSQLASRKLSEASDERGEPDLASSSDVNGSTES
FT                   FEMVIEEASTDLATKPNSGATAEADWVPLELCFGIPLFSSELNRKVCQKIATHGLCRKE
FT                   SLQSLLHSSRKLSLQVLNFVHSFQEGAATLDLHAEPGFSSVLSQSPCADMGVPLPAKNL
FT                   MFKDGVLSEWSGRSPSSLLIASLHL"
FT   gap             8682746..8684131
FT                   /estimated_length=1386
FT   gap             8721670..8722023
FT                   /estimated_length=354
FT   gap             8726103..8726204
FT                   /estimated_length=102
FT   gap             8731401..8731778
FT                   /estimated_length=378
FT   gap             8769994..8770013
FT                   /estimated_length=20
FT   gene            8802199..8907957
FT                   /locus_tag="mCG_115513"
FT                   /note="gene_id=mCG115513.1"
FT   mRNA            join(8802199..8802277,8802598..8802754,8803527..8803713,
FT                   8804822..8805014,8808293..8808645,8813580..8813688,
FT                   8815846..8816029,8818063..8818183,8827803..8827958,
FT                   8834858..8835031,8839315..8839443,8844781..8844915,
FT                   8846626..8846775,8863470..8863580,8863822..8863983,
FT                   8865372..8865539,8875723..8875848,8878755..8878882,
FT                   8883016..8883186,8885182..8885342,8886915..8887057,
FT                   8888494..8888582,8888955..8889053,8892009..8892250,
FT                   8893728..8893911,8905806..8905931,8907786..8907957)
FT                   /locus_tag="mCG_115513"
FT                   /product="mCG115513"
FT                   /note="gene_id=mCG115513.1 transcript_id=mCT116620.1
FT                   created on 11-NOV-2002"
FT   CDS             join(8803615..8803713,8804822..8805014,8808293..8808645,
FT                   8813580..8813688,8815846..8816029,8818063..8818183,
FT                   8827803..8827958,8834858..8835031,8839315..8839443,
FT                   8844781..8844915,8846626..8846775,8863470..8863580,
FT                   8863822..8863983,8865372..8865539,8875723..8875848,
FT                   8878755..8878882,8883016..8883186,8885182..8885342,
FT                   8886915..8887057,8888494..8888582,8888955..8889053,
FT                   8892009..8892250,8893728..8893911,8905806)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115513"
FT                   /product="mCG115513"
FT                   /note="gene_id=mCG115513.1 transcript_id=mCT116620.1
FT                   protein_id=mCP60688.1"
FT                   /protein_id="EDL29308.1"
FT                   /translation="MNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADP
FT                   VWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFG
FT                   PAWINLYGSPRNHSLMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALK
FT                   ELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPPEIIPEKYE
FT                   DFLLFGAFFEATMIDRKIGDKPISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPL
FT                   LHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRL
FT                   HWSNMLEKMADLLQPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKI
FT                   KTHFLKLPGKRPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPP
FT                   SALLYTAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWN
FT                   QMLLFNELVLHGEEKELLESPPHVVVELYDSDAVGKPEYLGATVAAPVVTLADQDYEPP
FT                   KLSYHPIFCGNLSGGDLLAVFELLQVPPSGLQGLPPTGPPDITQIYPVPSNIRPVLSKY
FT                   RVEVLFWGVREMKKVQLLSVDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVEL
FT                   PENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCKPRETFALTSQTDGDGSFCI
FT                   YKSPEDSTSEDSGQLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLG
FT                   KTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLE
FT                   NRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFRPGKIQIGKK
FT                   VFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDIPEAGWRLVPEHIETRPLYHKDKPGM
FT                   EQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSS
FT                   DIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSL
FT                   EKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQEN
FT                   KISIFQQKRVRGWWPFAKSKELTVSDSCR"
FT   gap             8807532..8807762
FT                   /estimated_length=231
FT   gap             8847460..8847688
FT                   /estimated_length=229
FT   gap             8852256..8858941
FT                   /estimated_length=6686
FT   gap             8867924..8867943
FT                   /estimated_length=20
FT   gap             8871500..8871888
FT                   /estimated_length=389
FT   gap             8901007..8901143
FT                   /estimated_length=137
FT   gap             8932052..8932071
FT                   /estimated_length=20
FT   gap             8938065..8938690
FT                   /estimated_length=626
FT   gap             8984219..8984238
FT                   /estimated_length=20
FT   gap             8993728..8994268
FT                   /estimated_length=541
FT   gap             9008843..9008868
FT                   /estimated_length=26
FT   gap             9013488..9014509
FT                   /estimated_length=1022
FT   gap             9016821..9020219
FT                   /estimated_length=3399
FT   gap             9027100..9027137
FT                   /estimated_length=38
FT   gene            complement(9027140..>9067982)
FT                   /gene="Tmem65"
FT                   /locus_tag="mCG_7711"
FT                   /note="gene_id=mCG7711.1"
FT   mRNA            complement(join(9027140..9029883,9031983..9032088,
FT                   9034259..9034301,9035028..9035082,9039201..9039268,
FT                   9042060..9042104,9067697..>9067982))
FT                   /gene="Tmem65"
FT                   /locus_tag="mCG_7711"
FT                   /product="transmembrane protein 65"
FT                   /note="gene_id=mCG7711.1 transcript_id=mCT6656.2 created on
FT                   14-OCT-2002"
FT   CDS             complement(join(9029782..9029883,9031983..9032088,
FT                   9034259..9034301,9035028..9035082,9039201..9039268,
FT                   9042060..9042104,9067697..9067982))
FT                   /codon_start=1
FT                   /gene="Tmem65"
FT                   /locus_tag="mCG_7711"
FT                   /product="transmembrane protein 65"
FT                   /note="gene_id=mCG7711.1 transcript_id=mCT6656.2
FT                   protein_id=mCP5530.2"
FT                   /protein_id="EDL29309.1"
FT                   /translation="MSRLLPLLGSRTARSLRPGPAAAPRLPSWCCCGRGLLALGVPGGP
FT                   RLLGTHPKKEPMEALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEALPPT
FT                   PGQLRYVFFHNAIPFVGFGFLDNAIMIVAGTQIELSIGIILGISTMAAAALGNLVSDLA
FT                   GLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRVSTHLGKAVGVTIGCILGMFPLIFFG
FT                   GSEEDEKLETTN"
FT   gap             9038389..9038447
FT                   /estimated_length=59
FT   gap             9068149..9068168
FT                   /estimated_length=20
FT   gap             9069469..9069894
FT                   /estimated_length=426
FT   gene            <9117357..9121595
FT                   /locus_tag="mCG_51593"
FT                   /note="gene_id=mCG51593.1"
FT   mRNA            join(<9117357..9120857,9121099..9121595)
FT                   /locus_tag="mCG_51593"
FT                   /product="mCG51593"
FT                   /note="gene_id=mCG51593.1 transcript_id=mCT51776.1 created
FT                   on 12-JUN-2003"
FT   CDS             9117357..9118697
FT                   /codon_start=1
FT                   /locus_tag="mCG_51593"
FT                   /product="mCG51593"
FT                   /note="gene_id=mCG51593.1 transcript_id=mCT51776.1
FT                   protein_id=mCP28271.0"
FT                   /protein_id="EDL29310.1"
FT                   /translation="MERECEESVVVAVVTEPRFTQRYRDYLEEQKLLDRLHRVAKLRDG
FT                   AVALPVLAESLSEQHLQELRDRVAPGSTCVLTRLPDPLPSKKARVRSPAQILCLEVRRW
FT                   VEDRGVTWSAELEADLPRSWQRHGDLMLLSEDCFQATLWKGLEPELWETVASALGVQRL
FT                   AKRGRVLPDGTRTPSVTLLLGDHGWVEHMDNGIRYKFDVTQCMFSFGNITEKLRVASLS
FT                   CAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHF
FT                   GDNRKLKLSDIADRVNLGLIPSSKEGWPVACQVLRKDVGGILHIHQNVESFSGKTPQPP
FT                   GSNNVEKEHWPRPQKITTDTQGNGTTENFRGEISSANKPEWWRWAESAETQIASLLHQV
FT                   HGKPWRTRILHVHPVKSYAPHVDHIVLDLECRPLTSSWPEGVDLLTQ"
FT   gap             9120858..9121098
FT                   /estimated_length=241
FT   gap             9133823..9134372
FT                   /estimated_length=550
FT   gene            <9143045..>9144811
FT                   /gene="Rnf139"
FT                   /locus_tag="mCG_51686"
FT                   /note="gene_id=mCG51686.1"
FT   mRNA            <9143045..>9144811
FT                   /gene="Rnf139"
FT                   /locus_tag="mCG_51686"
FT                   /product="ring finger protein 139"
FT                   /note="gene_id=mCG51686.1 transcript_id=mCT51869.1 created
FT                   on 19-NOV-2002"
FT   CDS             9143045..9144811
FT                   /codon_start=1
FT                   /gene="Rnf139"
FT                   /locus_tag="mCG_51686"
FT                   /product="ring finger protein 139"
FT                   /note="gene_id=mCG51686.1 transcript_id=mCT51869.1
FT                   protein_id=mCP28285.1"
FT                   /protein_id="EDL29311.1"
FT                   /translation="MYSSAFLLAATSVLVNYYAALHIDFYGAYNTSAFGIELLPRKGPS
FT                   LWMALIVLQLTFGIGYVTLLQIQSIYSQLMILNILVPIIGLITELPLHIRETVVLMSSL
FT                   ILIFNTVLVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWL
FT                   TRITAQATVLMYILRMANETESFFISWDDFWDVICNLIISGCDSTLTVLGMSAVISSIA
FT                   HYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLT
FT                   AVLHFIHGMTDPVLMSLSASHVSSFHRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL
FT                   FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYFVRSTGNIIEFIFGVVM
FT                   FGNGAYTMMFESGSKIRACMMCLHAYFNIYLQVKNGWKTFMNRRTAVKKINSLPEIKGS
FT                   HLQEIDDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDEIKD
FT                   NSNASNNNGFIAPNENPNPEEALREDAAGSDRELNEDDSTDCDDDAQRERNGGIQHTGA
FT                   AAAAAEFNDDTD"
FT   gene            complement(9145229..9179070)
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /note="gene_id=mCG7713.2"
FT   mRNA            complement(join(9145229..9145747,9149411..9149537,
FT                   9150418..9150488,9166395..9166437,9166529..9166672,
FT                   9169160..9169223,9171691..9171740,9173939..9174004,
FT                   9178934..9179070))
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, transcript
FT                   variant mCT6647"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT6647.2 created on
FT                   26-FEB-2003"
FT   mRNA            complement(join(9145229..9145747,9149411..9149537,
FT                   9150418..9150488,9154410..9154486,9161407..9161447,
FT                   9166395..9166437,9166529..9166672,9171691..9171740,
FT                   9173939..9174004,9178934..9178977))
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, transcript
FT                   variant mCT174569"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT174569.0 created
FT                   on 26-FEB-2003"
FT   CDS             complement(join(9145651..9145747,9149411..9149537,
FT                   9150418..9150488,9166395..9166437,9166529..9166672,
FT                   9169160..9169223,9171691..9171740,9173939..9174004,
FT                   9178934..9178955))
FT                   /codon_start=1
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT6647.2
FT                   protein_id=mCP5531.2 isoform=CRA_c"
FT                   /protein_id="EDL29314.1"
FT                   /translation="MSLFKFVDIGINLTDPMFRGIYRGVQKHQDDLQDVIERAIQIGVK
FT                   KFMITGGSLQDSKDALQLAQTNDMFFSTVGCHPTRCDEFEKGSPDQYLAGLLSLAENNK
FT                   GKVVAIGECGLDFDRLQFCPKDTQLNSLKTEANLEVLKSIPSEKLMIETDAPWCGVKST
FT                   HAGSKYINTSFPTKKKWENGHCLKDRNEPCHIIQILEIMSAVREEDPLELANTLYNNTI
FT                   KVFFS"
FT   mRNA            complement(join(9145652..9145747,9149411..9149537,
FT                   9150418..9150488,9161407..9161447,9161532..9161617,
FT                   9166395..9166437,9166529..9166672,9171691..9171740,
FT                   9173799..9174004,9178934..>9178994))
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, transcript
FT                   variant mCT180767"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT180767.0 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(<9145653..9145747,9149411..9149537,
FT                   9150418..9150488,9154410..9154486,9161407..9161447,
FT                   9161532..9161617,9166395..9166437,9166529..9166672,
FT                   9169160..9169223,9171691..9171740,9173939..9174004,
FT                   9178934..>9178982))
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, transcript
FT                   variant mCT192605"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT192605.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<9145653..9145747,9149411..9149537,
FT                   9150418..9150488,9154410..9154486,9161407..9161447,
FT                   9161532..9161617,9166395..9166437,9166529..9166672,
FT                   9169160..9169223,9171691..9171740,9173939..9174004,
FT                   9178934..>9178982))
FT                   /codon_start=1
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT192605.0
FT                   protein_id=mCP113602.0 isoform=CRA_b"
FT                   /protein_id="EDL29313.1"
FT                   /translation="SLGGACRAVMSLFKFVDIGINLTDPMFRGIYRGVQKHQDDLQDVI
FT                   ERAIQIGVKKFMITGGSLQDSKDALQLAQTNDMFFSTVGCHPTRCDEFEKGSPDQYLAG
FT                   LLSLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTQLPMFLHCRNSH
FT                   TEFLDIMRRNRDRYVGGVVHSFDGTKEAAAALVDLGLYIGFNGCSLKTEANLEVLKSIP
FT                   SEKLMIETDAPWCGVKSTHAGSKYINTSFPTKKKWENGHCLKDRNEPCHIIQILEIMSA
FT                   VREEDPLELANTLYNNTIKVFFS"
FT   CDS             complement(join(9150474..9150488,9161407..9161447,
FT                   9161532..9161617,9166395..9166437,9166529..9166672,
FT                   9171691..>9171694))
FT                   /codon_start=1
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, isoform CRA_d"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT180767.0
FT                   protein_id=mCP103689.0 isoform=CRA_d"
FT                   /protein_id="EDL29315.1"
FT                   /translation="KDMFFSTVGCHPTRCDEFEKGSPDQYLAGLLSLAENNKGKVVAIG
FT                   ECGLDFDRLQFCPKDTQLKYFEKQFELSEQTQLPMFLHCRNSHTEFLDIMRRNRDRYVG
FT                   GVLSEN"
FT   gap             9152981..9153323
FT                   /estimated_length=343
FT   CDS             complement(join(9166595..9166672,9171691..9171740,
FT                   9173939..9174004,9178934..9178955))
FT                   /codon_start=1
FT                   /gene="Tatdn1"
FT                   /locus_tag="mCG_7713"
FT                   /product="TatD DNase domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG7713.2 transcript_id=mCT174569.0
FT                   protein_id=mCP97488.0 isoform=CRA_a"
FT                   /protein_id="EDL29312.1"
FT                   /translation="MSLFKFVDIGINLTDPMFRGIYRGVQKHQDDLQDVIERAIQIGVK
FT                   KTCFSVQWGVTPRDVMSLRRVALIST"
FT   gene            9179058..9185005
FT                   /gene="Ndufb9"
FT                   /locus_tag="mCG_7705"
FT                   /note="gene_id=mCG7705.1"
FT   mRNA            join(9179058..9179193,9181523..9181715,9182607..9182720,
FT                   9184530..9185005)
FT                   /gene="Ndufb9"
FT                   /locus_tag="mCG_7705"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 9"
FT                   /note="gene_id=mCG7705.1 transcript_id=mCT6655.1 created on
FT                   14-OCT-2002"
FT   CDS             join(9179093..9179193,9181523..9181715,9182607..9182720,
FT                   9184530..9184661)
FT                   /codon_start=1
FT                   /gene="Ndufb9"
FT                   /locus_tag="mCG_7705"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 9"
FT                   /note="gene_id=mCG7705.1 transcript_id=mCT6655.1
FT                   protein_id=mCP5561.1"
FT                   /protein_id="EDL29316.1"
FT                   /translation="MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMR
FT                   ARFEEHKNEKDMMRATQLLREAEEEFWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCL
FT                   DYWHPSEKAMYPDYFSKREQWKKLRMESWDREVKQLQEETSPDGIMTEALPPARREGDL
FT                   PPLWWHIVTRPRERPT"
FT   gene            complement(9186490..>9327219)
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /note="gene_id=mCG116708.2"
FT   mRNA            complement(join(9186490..9189385,9190617..9190779,
FT                   9191101..9191274,9192572..9192766,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9209713..9209724,9214055..9214129,9216193..9216284,
FT                   9217692..9217776,9300161..9300234,9303555..9303616,
FT                   9326652..9326724))
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, transcript variant
FT                   mCT117836"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT117836.2
FT                   created on 03-APR-2003"
FT   mRNA            complement(join(9186496..9189385,9190572..9190779,
FT                   9191101..9191274,9193569..9193688,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9214055..9214129,9216193..9216284,9217692..9217776,
FT                   9300161..9300234,9303555..9303616,9326652..>9327219))
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, transcript variant
FT                   mCT192652"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT192652.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(9188503..9189320,9192650..9192766,
FT                   9196700..9196910,9198744..9198841,9200336..9200443,
FT                   9201663..9201820,9214055..9214129,9216193..9216284,
FT                   9217692..9217776,9300161..9300234,9303555..9303616,
FT                   9326652..9327185))
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, transcript variant
FT                   mCT174538"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT174538.1
FT                   created on 03-APR-2003"
FT   mRNA            complement(join(9188503..9189385,9190617..9190779,
FT                   9191101..9191274,9192572..9192766,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9214044..9214129,9216193..9216284,9217692..9217776,
FT                   9300161..9300234,9303555..9303616,9326652..>9327185))
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, transcript variant
FT                   mCT192651"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT192651.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(9188503..9189385,9190617..9190779,
FT                   9191101..9191274,9192572..9192766,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9214055..9214129,9216193..9216284,9217692..9217776,
FT                   9236455..9236507,9300161..9300234,9303555..9303616,
FT                   9326652..9327185))
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, transcript variant
FT                   mCT174537"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT174537.1
FT                   created on 03-APR-2003"
FT   CDS             complement(join(9188685..9189385,9190572..9190779,
FT                   9191101..9191274,9193569..9193688,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9214055..9214129,9216193..9216284,9217692..9217776,
FT                   9300161..9300234,9303555..9303616,9326652..>9326807))
FT                   /codon_start=1
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, isoform CRA_d"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT192652.0
FT                   protein_id=mCP113605.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q6ZQB7"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR013606"
FT                   /db_xref="MGI:MGI:2384818"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZQB7"
FT                   /protein_id="EDL29320.1"
FT                   /translation="NRSRAERARPRAQCSRPESVSCPRRAGKMEAVIEKECSALGGLFQ
FT                   TIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIG
FT                   SALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQ
FT                   EIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGR
FT                   FCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYS
FT                   WSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPV
FT                   RLSSVSSHDSGFISQDAFQSKSPSPMPPEAANQNSSSSASSEASETCQSVSECSSPTSV
FT                   SSGSTMGAWVSTEKDWAKPGPYDQPLVNTLQRRKEKREPDSNGGGPTTTGGPPAGAEEA
FT                   QRPRSMTVSAATRPGEEMAACEELTLALSRGLQLDVQRSSRDSLQCSSGYSTQTTTPCC
FT                   SEDTIPSQGTRRPACRPAFRAGPVSDYDYFSVSGDQEAEQQEFDKSSTIPRNSDISQSY
FT                   RRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIP
FT                   VKTPTVPDLPGVLPSPPDGPEERGEHSPESPSAGEGPQGVSNIPSSLWSGQAPVNPPLP
FT                   GPKPSIPEEHRQAIPESEAEDQERDPPSATVSPGPIPESDPADLSPRESPQGEDMLNAI
FT                   RRGVKLKKTTTNDRSAPRFS"
FT   CDS             complement(join(9188685..9189320,9192650..9192766,
FT                   9196700..9196910,9198744..9198841,9200336..9200443,
FT                   9201663..9201820,9214055..9214129,9216193..9216284,
FT                   9217692..9217776,9300161..9300234,9303555..9303616,
FT                   9326652..9326723))
FT                   /codon_start=1
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, isoform CRA_b"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT174538.1
FT                   protein_id=mCP97456.1 isoform=CRA_b"
FT                   /protein_id="EDL29318.1"
FT                   /translation="MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLR
FT                   TTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCL
FT                   INPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLD
FT                   SALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTI
FT                   SEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVN
FT                   SSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPP
FT                   EAANQLSNGFSHCSLSSESHAGPVGAGPFPHCLPASRLLPRVTSSSTIPRNSDISQSYR
FT                   RMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPV
FT                   KTPTVPDLPGVLPSPPDGPEERGEHSPESPSAGEGPQGVSNIPSSLWSGQAPVNPPLPG
FT                   PKPSIPEEHRQAIPESEAEDQERDPPSATVSPGPIPESDPADLSPRESPQGEDMLNAIR
FT                   RGVKLKKTTTNDRSAPRFS"
FT   CDS             complement(join(9188685..9189385,9190617..9190779,
FT                   9191101..9191274,9192572..9192766,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9209713..9209724,9214055..9214129,9216193..9216284,
FT                   9217692..9217776,9300161..9300234,9303555..9303616,
FT                   9326652..9326723))
FT                   /codon_start=1
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, isoform CRA_e"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT117836.2
FT                   protein_id=mCP60381.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3X9H7"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR013606"
FT                   /db_xref="MGI:MGI:2384818"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H7"
FT                   /protein_id="EDL29321.1"
FT                   /translation="MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLR
FT                   TTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCL
FT                   INPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDAQGRGDIQ
FT                   PQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITH
FT                   LQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSL
FT                   NSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPS
FT                   PMPPEAANQLSNGFSHCSLSSESHAGPVGAGPFPHCLPASRLLPRVTSVHLPDYAHYYT
FT                   IGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEKREPDSNGGGPTTTGGPPAGAEE
FT                   AQRPRSMTVSAATRPGEEMAACEELTLALSRGLQLDVQRSSRDSLQCSSGYSTQTTTPC
FT                   CSEDTIPSQVSDYDYFSVSGDQEAEQQEFDKSSTIPRNSDISQSYRRMFQAKRPASTAG
FT                   LPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVLP
FT                   SPPDGPEERGEHSPESPSAGEGPQGVSNIPSSLWSGQAPVNPPLPGPKPSIPEEHRQAI
FT                   PESEAEDQERDPPSATVSPGPIPESDPADLSPRESPQGEDMLNAIRRGVKLKKTTTNDR
FT                   SAPRFS"
FT   CDS             complement(join(9188685..9189385,9190617..9190779,
FT                   9191101..9191274,9192572..9192766,9196700..9196910,
FT                   9198744..9198841,9200336..9200443,9201663..9201820,
FT                   9214044..>9214050))
FT                   /codon_start=1
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, isoform CRA_c"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT192651.0
FT                   protein_id=mCP113604.0 isoform=CRA_c"
FT                   /protein_id="EDL29319.1"
FT                   /translation="RKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFC
FT                   TFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWS
FT                   YQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRL
FT                   SSVSSHDSGFISQDAFQSKSPSPMPPEAANQLSNGFSHCSLSSESHAGPVGAGPFPHCL
FT                   PASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEK
FT                   REPDSNGGGPTTTGGPPAGAEEAQRPRSMTVSAATRPGEEMAACEELTLALSRGLQLDV
FT                   QRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEAEQQEFDKSSTIPR
FT                   NSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPI
FT                   PIKTPVIPVKTPTVPDLPGVLPSPPDGPEERGEHSPESPSAGEGPQGVSNIPSSLWSGQ
FT                   APVNPPLPGPKPSIPEEHRQAIPESEAEDQERDPPSATVSPGPIPESDPADLSPRESPQ
FT                   GEDMLNAIRRGVKLKKTTTNDRSAPRFS"
FT   gap             9192204..9192490
FT                   /estimated_length=287
FT   gap             9195144..9195163
FT                   /estimated_length=20
FT   CDS             complement(join(9217705..9217776,9236455..9236507,
FT                   9300161..9300234,9303555..9303616,9326652..9326723))
FT                   /codon_start=1
FT                   /gene="Mtss1"
FT                   /locus_tag="mCG_116708"
FT                   /product="metastasis suppressor 1, isoform CRA_a"
FT                   /note="gene_id=mCG116708.2 transcript_id=mCT174537.1
FT                   protein_id=mCP97457.1 isoform=CRA_a"
FT                   /protein_id="EDL29317.1"
FT                   /translation="MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLR
FT                   TTVVAAAAFLDAFQKVADMATNTRGKVAFSSRGSRSRQLLAKVVPGRSAQLSPECACGT
FT                   GASRPS"
FT   gene            9229352..>9234121
FT                   /locus_tag="mCG_147991"
FT                   /note="gene_id=mCG147991.0"
FT   mRNA            join(9229352..9229782,9232829..>9234121)
FT                   /locus_tag="mCG_147991"
FT                   /product="mCG147991"
FT                   /note="gene_id=mCG147991.0 transcript_id=mCT188254.0
FT                   created on 13-JAN-2004"
FT   CDS             9233927..>9234121
FT                   /codon_start=1
FT                   /locus_tag="mCG_147991"
FT                   /product="mCG147991"
FT                   /note="gene_id=mCG147991.0 transcript_id=mCT188254.0
FT                   protein_id=mCP108956.0"
FT                   /protein_id="EDL29322.1"
FT                   /translation="MTPRAVPPPAPLSSGRRRPLFSVQSLARNSTQKIFAECWGKKKNK
FT                   SLERLGGGSLRARERHKFTH"
FT   gap             9273930..9274554
FT                   /estimated_length=625
FT   gap             9279682..9279737
FT                   /estimated_length=56
FT   gap             9296689..9296708
FT                   /estimated_length=20
FT   gap             9301290..9301344
FT                   /estimated_length=55
FT   gap             9346262..9346722
FT                   /estimated_length=461
FT   gap             9355426..9355445
FT                   /estimated_length=20
FT   gap             9417391..9417410
FT                   /estimated_length=20
FT   gap             9425519..9427573
FT                   /estimated_length=2055
FT   gene            <9456926..>9457738
FT                   /locus_tag="mCG_18633"
FT                   /note="gene_id=mCG18633.0"
FT   mRNA            <9456926..>9457738
FT                   /locus_tag="mCG_18633"
FT                   /product="mCG18633"
FT                   /note="gene_id=mCG18633.0 transcript_id=mCT14991.0 created
FT                   on 12-NOV-2002"
FT   CDS             9456926..9457738
FT                   /codon_start=1
FT                   /locus_tag="mCG_18633"
FT                   /product="mCG18633"
FT                   /note="gene_id=mCG18633.0 transcript_id=mCT14991.0
FT                   protein_id=mCP5525.0"
FT                   /protein_id="EDL29323.1"
FT                   /translation="MEAVPEKKKKVATVPGTLKKKVPAGPKTLKKKVPAVPETLKKKRR
FT                   NFAELKVKCLPKKFALKTLRKARRKLIYEKAKCYHKEYRQMYCTEIRMARMARKAGSFY
FT                   VLAEPKMAFVIRIRDINGVSPKVRKVPQLLRLRQIFNGTFAKLNKASINMLRIVEPYIA
FT                   WGYPNLKSVNELIYKRGYGKINKKQIALTDNSLIARSLGKFGIICMEDLIHEISTVGKR
FT                   FKEANNFLWPFKLSSPQGGMKKKTTHFVEGGDAGNREDQINRLIRRMN"
FT   gap             9459132..9459151
FT                   /estimated_length=20
FT   gap             9461785..9461850
FT                   /estimated_length=66
FT   gene            9484565..9485110
FT                   /pseudo
FT                   /locus_tag="mCG_18634"
FT                   /note="gene_id=mCG18634.1"
FT   mRNA            9484565..9485110
FT                   /pseudo
FT                   /locus_tag="mCG_18634"
FT                   /note="gene_id=mCG18634.1 transcript_id=mCT14994.2 created
FT                   on 09-DEC-2002"
FT   gap             9490113..9490159
FT                   /estimated_length=47
FT   gap             9509310..9509329
FT                   /estimated_length=20
FT   gene            <9521381..9537933
FT                   /locus_tag="mCG_145467"
FT                   /note="gene_id=mCG145467.0"
FT   mRNA            join(<9521381..9521461,9533507..9533587,9536929..9537075,
FT                   9537568..9537933)
FT                   /locus_tag="mCG_145467"
FT                   /product="mCG145467"
FT                   /note="gene_id=mCG145467.0 transcript_id=mCT184891.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<9521430..9521461,9533507..9533587,9536929..9537001)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145467"
FT                   /product="mCG145467"
FT                   /note="gene_id=mCG145467.0 transcript_id=mCT184891.0
FT                   protein_id=mCP105334.0"
FT                   /protein_id="EDL29324.1"
FT                   /translation="SHFEGCVNKPRCELPAPATRPACCCDSQSGCILILLELYLLHLCF
FT                   KCYPEKIVLLLPHPPP"
FT   gap             9551237..9551256
FT                   /estimated_length=20
FT   gene            9552986..9558119
FT                   /locus_tag="mCG_148013"
FT                   /note="gene_id=mCG148013.0"
FT   mRNA            join(9552986..9553008,9557042..9558119)
FT                   /locus_tag="mCG_148013"
FT                   /product="mCG148013"
FT                   /note="gene_id=mCG148013.0 transcript_id=mCT188276.0
FT                   created on 13-JAN-2004"
FT   gap             9555949..9556210
FT                   /estimated_length=262
FT   CDS             9557829..9558080
FT                   /codon_start=1
FT                   /locus_tag="mCG_148013"
FT                   /product="mCG148013"
FT                   /note="gene_id=mCG148013.0 transcript_id=mCT188276.0
FT                   protein_id=mCP108977.0"
FT                   /protein_id="EDL29325.1"
FT                   /translation="MEERKLTKVQTVRDASAEMLTLVSTAKYTSRSPQPLKVGHILHEW
FT                   TPPPNIHGKWSRSFHFWPQNYSQVPEPAGVYSFPFSPY"
FT   gene            9561344..9577296
FT                   /gene="Sqle"
FT                   /locus_tag="mCG_18625"
FT                   /note="gene_id=mCG18625.0"
FT   mRNA            join(9561344..9562233,9563900..9564152,9567418..9567598,
FT                   9568940..9569036,9569718..9569831,9569911..9570082,
FT                   9570566..9570661,9572139..9572281,9572674..9572770,
FT                   9575844..9575931,9576829..9577296)
FT                   /gene="Sqle"
FT                   /locus_tag="mCG_18625"
FT                   /product="squalene epoxidase"
FT                   /note="gene_id=mCG18625.0 transcript_id=mCT14985.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(9561949..9562233,9563900..9564152,9567418..9567598,
FT                   9568940..9569036,9569718..9569831,9569911..9570082,
FT                   9570566..9570661,9572139..9572281,9572674..9572770,
FT                   9575844..9575931,9576829..9577021)
FT                   /codon_start=1
FT                   /gene="Sqle"
FT                   /locus_tag="mCG_18625"
FT                   /product="squalene epoxidase"
FT                   /note="gene_id=mCG18625.0 transcript_id=mCT14985.0
FT                   protein_id=mCP5528.1"
FT                   /db_xref="GOA:Q3TQK8"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="MGI:MGI:109296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQK8"
FT                   /protein_id="EDL29326.1"
FT                   /translation="MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRC
FT                   RHRHGGLLGRHQSGAQFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSE
FT                   TTLTGAATSVSTSFVTDPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGE
FT                   LLQPGGYRVLQELGLGDTVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAF
FT                   HHGRFIMSLRKAAMAEPNVKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVV
FT                   ADGLFSKFRKSLISSKVSVSSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSET
FT                   RVLVDIRGELPRNLREYMAEQIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKR
FT                   GVLILGDAYNLRHPLTGGGMTVALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKR
FT                   THSFVVNVLAQALYELFSATDDSLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVL
FT                   IRHFFSVAIYATYFCFKSEPWATKPRALFSSGAVLYKACSILFPLIYSEMKYLVH"
FT   gene            complement(9577564..9620634)
FT                   /gene="E430025E21Rik"
FT                   /locus_tag="mCG_116698"
FT                   /note="gene_id=mCG116698.1"
FT   mRNA            complement(join(9577564..9578463,9579722..9579809,
FT                   9581192..9581345,9583297..9583393,9585018..9585147,
FT                   9585918..9586021,9586996..9587075,9587164..9587266,
FT                   9588043..9588205,9590128..9590252,9591575..9591754,
FT                   9592451..9592552,9593057..9593137,9594622..9594762,
FT                   9595530..9595640,9596369..9596444,9596524..9596690,
FT                   9597709..9597821,9598738..9598867,9602071..9602198,
FT                   9605500..9605671,9607360..9607473,9609296..9609448,
FT                   9612265..9612457,9613497..9613597,9614478..9614562,
FT                   9615255..9615400,9615982..9616288,9620523..9620634))
FT                   /gene="E430025E21Rik"
FT                   /locus_tag="mCG_116698"
FT                   /product="RIKEN cDNA E430025E21"
FT                   /note="gene_id=mCG116698.1 transcript_id=mCT117823.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(9578407..9578463,9579722..9579809,
FT                   9581192..9581345,9583297..9583393,9585018..9585147,
FT                   9585918..9586021,9586996..9587075,9587164..9587266,
FT                   9588043..9588205,9590128..9590252,9591575..9591754,
FT                   9592451..9592552,9593057..9593137,9594622..9594762,
FT                   9595530..9595640,9596369..9596444,9596524..9596690,
FT                   9597709..9597821,9598738..9598867,9602071..9602198,
FT                   9605500..9605671,9607360..9607473,9609296..9609448,
FT                   9612265..9612457,9613497..9613597,9614478..9614562,
FT                   9615255..9615400,9615982..9616017))
FT                   /codon_start=1
FT                   /gene="E430025E21Rik"
FT                   /locus_tag="mCG_116698"
FT                   /product="RIKEN cDNA E430025E21"
FT                   /note="gene_id=mCG116698.1 transcript_id=mCT117823.1
FT                   protein_id=mCP60606.1"
FT                   /protein_id="EDL29327.1"
FT                   /translation="METSSLTSGYFKGPEFWESKLEAKPELQDLDEEFRENNIEIVTRF
FT                   YLAFQSVHKYIVDLNRYLDDLNEGVYIQQTLETVLLSEDGKQLLCEALYLYGVMLLVID
FT                   QKIEGEVRERMLVSYYRYSAARSSADSNMDDICKLLRSTGYSSQPGAKRPPNYPESYFQ
FT                   RVPINETFISMVIGRLRSDDIYNQVSAYPLPEHRSTALANQAAMLYVILYFEPSILHTH
FT                   QAKMREIVDKYFPDNWVISIYMGITVNLADAWEPYKAAKTALNNTLDLANVKEQASRYA
FT                   SVSDRVRAQVQQFLKEGYLREEVLLDNIPRLLNCLRDCNVAIRWLMLHTADSACDPNNK
FT                   RLRQIKDQILADSRYNPKILFQLLLDTAQFEFILKEMFKQMLSEKQSKWEHYKKEGSER
FT                   MTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEV
FT                   QEFHQLESNLQVCQFLADTRKFLHQMIRTINIKEEVLITVQIIGDLSFAWQLIDSFTSI
FT                   MQESIRVNPSMVTKLRATFLKLASALDLPLLRINQANSPDLLSVSQYYSGELVSYVRKV
FT                   LQIIPESMFTSLLKIIKLQTHDIMEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTE
FT                   GILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAFALHRGLIFNPRAKPSELMPKLKEL
FT                   GATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQS
FT                   THIPIPKFAPVDESITFIGRLCREILRITDPKMTCYIDQLNTWYDVKTHQEVTSSRLFS
FT                   EIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIILKERTVQETLKMLMSAVNPLKS
FT                   IVANSSKVYLSAITKTQKIWSAYLEAIMKVGQMQILRQQIANELNSSCRFDSRHLAAAL
FT                   DNLNKALLADIEAHYRDPSLPYPKEDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYF
FT                   PIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWPPLVLGLLTLLKQFHSRYTEQFLAL
FT                   IGQFIRSTMEQCTSQKMPEMPADAVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRT
FT                   VL"
FT   gap             9590591..9590865
FT                   /estimated_length=275
FT   gap             9608864..9608948
FT                   /estimated_length=85
FT   gap             9619819..9619838
FT                   /estimated_length=20
FT   gene            9620727..9848969
FT                   /gene="Nsmce2"
FT                   /locus_tag="mCG_141318"
FT                   /note="gene_id=mCG141318.0"
FT   mRNA            join(9620727..9620837,9625350..9625520,9662513..9662619,
FT                   9702121..9702274,9838960..9839060,9839401..9839507,
FT                   9848627..9848969)
FT                   /gene="Nsmce2"
FT                   /locus_tag="mCG_141318"
FT                   /product="non-SMC element 2 homolog (MMS21, S. cerevisiae),
FT                   transcript variant mCT174549"
FT                   /note="gene_id=mCG141318.0 transcript_id=mCT174549.1
FT                   created on 25-FEB-2003"
FT   mRNA            join(9620765..9620837,9625350..9625520,9662513..9662619,
FT                   9702121..9702274,9743671..9743748,9838960..9839060,
FT                   9839401..9839507,9848627..9848796)
FT                   /gene="Nsmce2"
FT                   /locus_tag="mCG_141318"
FT                   /product="non-SMC element 2 homolog (MMS21, S. cerevisiae),
FT                   transcript variant mCT174550"
FT                   /note="gene_id=mCG141318.0 transcript_id=mCT174550.0
FT                   created on 25-FEB-2003"
FT   CDS             join(9625364..9625520,9662513..9662619,9702121..9702274,
FT                   9743671..9743748,9838960..9839060,9839401..9839507,
FT                   9848627..9848744)
FT                   /codon_start=1
FT                   /gene="Nsmce2"
FT                   /locus_tag="mCG_141318"
FT                   /product="non-SMC element 2 homolog (MMS21, S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141318.0 transcript_id=mCT174550.0
FT                   protein_id=mCP97469.0 isoform=CRA_a"
FT                   /protein_id="EDL29328.1"
FT                   /translation="MPGRSSTSSGSTRYISFSGIESALSSLKNFQSCISSGMDTVSSVA
FT                   LDLVETQTEVSSEYSMDKAMVEFAKMDRELSHYVKAVQSTINHVKEERPEKVPDLKLLV
FT                   EKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQLVKPKEDGRHSEFDPNKDSSRAGN
FT                   KRDGIHADRENDLTEGVDEDMIVTQSQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVR
FT                   MIESKHKRKKKACCPKIGCSHTDMRMSDLIPDEALRRAIESHNKKKKRHSE"
FT   CDS             join(9625364..9625520,9662513..9662619,9702121..9702274,
FT                   9838960..9839060,9839401..9839507,9848627..9848744)
FT                   /codon_start=1
FT                   /gene="Nsmce2"
FT                   /locus_tag="mCG_141318"
FT                   /product="non-SMC element 2 homolog (MMS21, S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141318.0 transcript_id=mCT174549.1
FT                   protein_id=mCP97468.1 isoform=CRA_b"
FT                   /protein_id="EDL29329.1"
FT                   /translation="MPGRSSTSSGSTRYISFSGIESALSSLKNFQSCISSGMDTVSSVA
FT                   LDLVETQTEVSSEYSMDKAMVEFAKMDRELSHYVKAVQSTINHVKEERPEKVPDLKLLV
FT                   EKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQYGIHADRENDLTEGVDEDMIVTQS
FT                   QTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRM
FT                   SDLIPDEALRRAIESHNKKKKRHSE"
FT   gap             9647247..9647266
FT                   /estimated_length=20
FT   gap             9668052..9669912
FT                   /estimated_length=1861
FT   gap             9679658..9681321
FT                   /estimated_length=1664
FT   gap             9717024..9717106
FT                   /estimated_length=83
FT   gap             9728065..9728084
FT                   /estimated_length=20
FT   gap             9730177..9730196
FT                   /estimated_length=20
FT   gap             9772726..9772745
FT                   /estimated_length=20
FT   gap             9782761..9782881
FT                   /estimated_length=121
FT   gap             9787211..9787230
FT                   /estimated_length=20
FT   gap             9794224..9794344
FT                   /estimated_length=121
FT   gap             9823611..9823630
FT                   /estimated_length=20
FT   gap             9844064..9844083
FT                   /estimated_length=20
FT   gap             9852027..9852080
FT                   /estimated_length=54
FT   gap             9855961..9855980
FT                   /estimated_length=20
FT   gap             9864230..9864552
FT                   /estimated_length=323
FT   gap             9865650..9866000
FT                   /estimated_length=351
FT   gap             9883930..9883954
FT                   /estimated_length=25
FT   gap             9886115..9886696
FT                   /estimated_length=582
FT   gap             9887534..9887556
FT                   /estimated_length=23
FT   gap             9893396..9893415
FT                   /estimated_length=20
FT   gene            9893732..9902178
FT                   /gene="Trib1"
FT                   /locus_tag="mCG_18629"
FT                   /note="gene_id=mCG18629.1"
FT   mRNA            join(9893732..9894602,9896559..9896851,9899316..9902178)
FT                   /gene="Trib1"
FT                   /locus_tag="mCG_18629"
FT                   /product="tribbles homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG18629.1 transcript_id=mCT14992.1 created
FT                   on 12-NOV-2002"
FT   CDS             join(9894243..9894602,9896559..9896851,9899316..9899781)
FT                   /codon_start=1
FT                   /gene="Trib1"
FT                   /locus_tag="mCG_18629"
FT                   /product="tribbles homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG18629.1 transcript_id=mCT14992.1
FT                   protein_id=mCP5542.2"
FT                   /protein_id="EDL29330.1"
FT                   /translation="MRVGPVRFALSGASQPRGPGLLFPAARGTPAKRLLDTDDAGAVAA
FT                   KCPRLSECSSPPDYLSPPGSPCSPQPPPSTQGTGGSCVSSPGPSRIADYLLLPLAEREH
FT                   VSRALCIHTGRELRCKEFPIKHYQDKIRPYIQLPSHSNITGIVEVLLGESKAYVFFEKD
FT                   FGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLR
FT                   LESLEDTHIIKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGR
FT                   YPFHDSDPSALFSKIRRGQFCIPEHVSPKARCLIRSLLRREPSERLTAPQILLHPWFEY
FT                   VLEPGYVDSEIGTSDQIVPEYQEDSDISSFFC"
FT   gap             9920884..9920903
FT                   /estimated_length=20
FT   gap             9925184..9925420
FT                   /estimated_length=237
FT   gap             9948852..9950255
FT                   /estimated_length=1404
FT   gap             9956590..9956684
FT                   /estimated_length=95
FT   gap             9957326..9957876
FT                   /estimated_length=551
FT   gap             9959640..9959659
FT                   /estimated_length=20
FT   gap             9979305..9979533
FT                   /estimated_length=229
FT   gap             9980947..9980989
FT                   /estimated_length=43
FT   gap             10030173..10030226
FT                   /estimated_length=54
FT   gap             10031190..10031586
FT                   /estimated_length=397
FT   gene            complement(10035050..>10041589)
FT                   /locus_tag="mCG_145468"
FT                   /note="gene_id=mCG145468.0"
FT   mRNA            complement(join(10035050..10035880,10036012..10036319,
FT                   10037522..10037930,10041276..>10041589))
FT                   /locus_tag="mCG_145468"
FT                   /product="mCG145468"
FT                   /note="gene_id=mCG145468.0 transcript_id=mCT184892.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10036276..10036319,10037522..>10037759))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145468"
FT                   /product="mCG145468"
FT                   /note="gene_id=mCG145468.0 transcript_id=mCT184892.0
FT                   protein_id=mCP105336.0"
FT                   /protein_id="EDL29331.1"
FT                   /translation="SLGGRSRPFGVGLEVLEPKPTSRPPNFESTMTSSLLFPYSHRHAS
FT                   PTKMGCIASKTTSQDKPFLPIVAPPRISSDCNKQNKATNVYTRSRMQE"
FT   gap             10036499..10036518
FT                   /estimated_length=20
FT   gap             10048107..10048694
FT                   /estimated_length=588
FT   gap             10086513..10087114
FT                   /estimated_length=602
FT   gap             10100729..10100818
FT                   /estimated_length=90
FT   gap             10119598..10119904
FT                   /estimated_length=307
FT   gap             10169328..10169364
FT                   /estimated_length=37
FT   gap             10195129..10195318
FT                   /estimated_length=190
FT   gap             10198387..10198406
FT                   /estimated_length=20
FT   gap             10209554..10209676
FT                   /estimated_length=123
FT   gap             10222505..10222752
FT                   /estimated_length=248
FT   gene            10224265..10225503
FT                   /pseudo
FT                   /locus_tag="mCG_18626"
FT                   /note="gene_id=mCG18626.1"
FT   mRNA            10224265..10225503
FT                   /pseudo
FT                   /locus_tag="mCG_18626"
FT                   /note="gene_id=mCG18626.1 transcript_id=mCT14986.1 created
FT                   on 12-NOV-2002"
FT   gap             10242280..10242299
FT                   /estimated_length=20
FT   gene            complement(10261474..10263222)
FT                   /locus_tag="mCG_147987"
FT                   /note="gene_id=mCG147987.0"
FT   mRNA            complement(10261474..10263222)
FT                   /locus_tag="mCG_147987"
FT                   /product="mCG147987"
FT                   /note="gene_id=mCG147987.0 transcript_id=mCT188250.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10261656..10263197)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147987"
FT                   /product="mCG147987"
FT                   /note="gene_id=mCG147987.0 transcript_id=mCT188250.0
FT                   protein_id=mCP108951.0"
FT                   /protein_id="EDL29332.1"
FT                   /translation="MGSSEEQSVPGDDFYEESGDLNTGLSLVLRPAKSNEGESSLSSPK
FT                   GSKLTLVSQLEASENPSVVLWAGEYCPDSLVPEEERVGSPMDEKVVGLDFLSQPSVETT
FT                   ATGQQVTNLETKGAREHPSPESVCAETEAGSIRRAPQASEEAKFAASAGTFFPKGLEQS
FT                   RSWVTPRKSTTSRMVIGENVHHPTSEPEPLDELNEVQMMRVTICLKDGNHGNQAKNSGP
FT                   AETGDLARHSNVQTRDSFMRMPSSLLVSTTRGLTSGVERQASKEPEPFSSKKKQGTLWG
FT                   KGGSKSSYPEAAAGIGALPKASPRKKMAQKKKPLWDASAVTLGRAFHQWGQRLKSAPAE
FT                   PATFPPISGVGLPGRSNKCSLLPLRPKQCKNLYTGKRSGAKKTKELQLVAKEDTDSTRD
FT                   PSSQVQFPTHRAEPPCQSVHQEFNSGDINARSLQDAGNSQSSALNQRGIMSKKSVLSGD
FT                   QEEPVGLPAPDSEILQLPGTQGCPRCPELQKEIEDLRKQLSALQAVSEKFQTHLS"
FT   gap             10269958..10269977
FT                   /estimated_length=20
FT   gap             10294574..10294624
FT                   /estimated_length=51
FT   gap             10303693..10303800
FT                   /estimated_length=108
FT   gap             10305999..10311426
FT                   /estimated_length=5428
FT   gap             10330525..10331122
FT                   /estimated_length=598
FT   gap             10333207..10333226
FT                   /estimated_length=20
FT   gap             10363780..10363799
FT                   /estimated_length=20
FT   gap             10373731..10373750
FT                   /estimated_length=20
FT   gap             10387168..10387226
FT                   /estimated_length=59
FT   gap             10389041..10389060
FT                   /estimated_length=20
FT   gap             10390139..10390617
FT                   /estimated_length=479
FT   gene            complement(<10391779..10435177)
FT                   /locus_tag="mCG_148012"
FT                   /note="gene_id=mCG148012.0"
FT   mRNA            complement(join(<10391779..10392978,10434853..10435177))
FT                   /locus_tag="mCG_148012"
FT                   /product="mCG148012"
FT                   /note="gene_id=mCG148012.0 transcript_id=mCT188275.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<10391779..10392121)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148012"
FT                   /product="mCG148012"
FT                   /note="gene_id=mCG148012.0 transcript_id=mCT188275.0
FT                   protein_id=mCP108976.0"
FT                   /protein_id="EDL29333.1"
FT                   /translation="MVLVEDFKKDINYSLKEIQENTGKQVEVLKEETQNSLKELQENTT
FT                   KQLKELNKTVQDKTESRNNKENPKGDNSGDRNPRKEIRSHRCEHHQQTTRDGRENLRCR
FT                   RFHKEHGHNN"
FT   gap             10396338..10397091
FT                   /estimated_length=754
FT   gap             10399602..10399621
FT                   /estimated_length=20
FT   gap             10401698..10401987
FT                   /estimated_length=290
FT   gap             10428843..10432188
FT                   /estimated_length=3346
FT   gap             10447925..10449249
FT                   /estimated_length=1325
FT   gap             10473271..10473601
FT                   /estimated_length=331
FT   gap             10474822..10475393
FT                   /estimated_length=572
FT   gap             10481845..10481864
FT                   /estimated_length=20
FT   gap             10508018..10508037
FT                   /estimated_length=20
FT   gap             10564716..10567274
FT                   /estimated_length=2559
FT   gap             10587166..10587389
FT                   /estimated_length=224
FT   gap             10588385..10592021
FT                   /estimated_length=3637
FT   gap             10605835..10605854
FT                   /estimated_length=20
FT   gap             10617219..10617690
FT                   /estimated_length=472
FT   gap             10629060..10629079
FT                   /estimated_length=20
FT   gap             10630169..10630188
FT                   /estimated_length=20
FT   gap             10631748..10631776
FT                   /estimated_length=29
FT   gap             10639271..10644151
FT                   /estimated_length=4881
FT   gap             10649288..10654785
FT                   /estimated_length=5498
FT   gap             10657750..10658051
FT                   /estimated_length=302
FT   gap             10681505..10682721
FT                   /estimated_length=1217
FT   gap             10696842..10696971
FT                   /estimated_length=130
FT   gap             10698037..10699389
FT                   /estimated_length=1353
FT   gap             10703427..10703446
FT                   /estimated_length=20
FT   gap             10729370..10729581
FT                   /estimated_length=212
FT   gap             10760028..10760107
FT                   /estimated_length=80
FT   gap             10767174..10767193
FT                   /estimated_length=20
FT   gap             10783114..10783133
FT                   /estimated_length=20
FT   gap             10814586..10814605
FT                   /estimated_length=20
FT   gap             10831728..10831786
FT                   /estimated_length=59
FT   gap             10884217..10884273
FT                   /estimated_length=57
FT   gap             10888968..10888987
FT                   /estimated_length=20
FT   gap             10908923..10908942
FT                   /estimated_length=20
FT   gap             10911144..10911249
FT                   /estimated_length=106
FT   gap             10948460..10948479
FT                   /estimated_length=20
FT   gap             10962194..10962213
FT                   /estimated_length=20
FT   gene            10981645..10985092
FT                   /locus_tag="mCG_52782"
FT                   /note="gene_id=mCG52782.2"
FT   mRNA            join(10981645..10981807,10982293..10982595,
FT                   10982749..10983042,10983589..10983906,10984808..10985092)
FT                   /locus_tag="mCG_52782"
FT                   /product="mCG52782"
FT                   /note="gene_id=mCG52782.2 transcript_id=mCT52965.2 created
FT                   on 12-NOV-2002"
FT   CDS             join(10981651..10981807,10982293..10982595,
FT                   10982749..10983042,10983589..10983906,10984808..10984824)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52782"
FT                   /product="mCG52782"
FT                   /note="gene_id=mCG52782.2 transcript_id=mCT52965.2
FT                   protein_id=mCP35601.2"
FT                   /protein_id="EDL29334.1"
FT                   /translation="MFQELAHVAIPSVSYQFLLGAVTIGNRGLYHCQSVLGYSSRWREM
FT                   SNLFFFFYSLPRPWILPYPVPWIIPGLITSVLCLGRVKGAAFLLRREGDDDFLEVAENT
FT                   TVFGDETQAGYREQAMFRVYQPGNYSCSYQTHGECTSSTPSRIVTIKKFAKPPPPLLTS
FT                   SESSTVEPPHMARMTLLCSTFLNDVEFQLRQGKREMKVLMFSTSPEQVNFYLKLSDMGD
FT                   QSPFTCRYRLSNMTAWSEDSEPVELMWSDERLPAPVLTAEPSTNQSFEPGSTVQFRCTA
FT                   PKAGLRFESGLRFGLHTEDLYERSLIQILKSSGHETVFQLQNLSAADSASYSCIYTELK
FT                   PPFSGSAPSNLVPLMVDGSYEY"
FT   gap             10995344..10996116
FT                   /estimated_length=773
FT   gap             11008397..11008511
FT                   /estimated_length=115
FT   gap             11010289..11010366
FT                   /estimated_length=78
FT   gap             11014630..11014649
FT                   /estimated_length=20
FT   gap             11026012..11026031
FT                   /estimated_length=20
FT   gap             11028794..11028813
FT                   /estimated_length=20
FT   gap             11031038..11031057
FT                   /estimated_length=20
FT   gene            complement(11050499..11053616)
FT                   /gene="D330050I23Rik"
FT                   /locus_tag="mCG_147990"
FT                   /note="gene_id=mCG147990.0"
FT   mRNA            complement(11050499..11053616)
FT                   /gene="D330050I23Rik"
FT                   /locus_tag="mCG_147990"
FT                   /product="RIKEN cDNA D330050I23"
FT                   /note="gene_id=mCG147990.0 transcript_id=mCT188253.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11053289..11053606)
FT                   /codon_start=1
FT                   /gene="D330050I23Rik"
FT                   /locus_tag="mCG_147990"
FT                   /product="RIKEN cDNA D330050I23"
FT                   /note="gene_id=mCG147990.0 transcript_id=mCT188253.0
FT                   protein_id=mCP108955.0"
FT                   /db_xref="GOA:Q8C775"
FT                   /db_xref="MGI:MGI:3026924"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C775"
FT                   /protein_id="EDL29335.1"
FT                   /translation="MGFPGHKAAETTRSGISRPKPNSPVLSAANTLANSGYRLQKDFTT
FT                   SPSLSPSTSSWEAGSKRSLWLRLQFLPPVTSKSLSRASQGKDSIKVPFCLLCFWPAVVD
FT                   S"
FT   gene            <11054145..11059655
FT                   /locus_tag="mCG_144782"
FT                   /note="gene_id=mCG144782.0"
FT   mRNA            join(<11054145..11055964,11058337..11058367,
FT                   11059126..11059655)
FT                   /locus_tag="mCG_144782"
FT                   /product="mCG144782"
FT                   /note="gene_id=mCG144782.0 transcript_id=mCT184206.0
FT                   created on 05-JUN-2003"
FT   CDS             <11054282..11055046
FT                   /codon_start=1
FT                   /locus_tag="mCG_144782"
FT                   /product="mCG144782"
FT                   /note="gene_id=mCG144782.0 transcript_id=mCT184206.0
FT                   protein_id=mCP105326.0"
FT                   /protein_id="EDL29336.1"
FT                   /translation="HRRASDLVVAPLLHDQVLQALELESVAALSRELNLQTVGLLADAQ
FT                   LATDLELAFAIAAPGRKALGVAPAELALLGAHVGQRVAHYSARAQWLVAIQIVDHAAAP
FT                   ALARIGQEAVAHLQPVQMHHLEIAHVDSPVRVLSLRYKLHQVTRTALVEQVLRCVGAQS
FT                   RRSWREAFLIDALITIKHRAFHLVLPRVVGLRRGQGRPIPGVGQSSAIKPLGRWLRFHI
FT                   LVVIGENIRDSDAGPIVSIHAGRVGRGNFLIT"
FT   gap             11056601..11056838
FT                   /estimated_length=238
FT   gap             11064249..11064268
FT                   /estimated_length=20
FT   gap             11070886..11074362
FT                   /estimated_length=3477
FT   gap             11095118..11095563
FT                   /estimated_length=446
FT   gap             11116617..11116636
FT                   /estimated_length=20
FT   gene            11137246..11190656
FT                   /locus_tag="mCG_1051067"
FT                   /note="gene_id=mCG1051067.0"
FT   mRNA            join(11137246..11137451,11138057..11138174,
FT                   11139784..11139996,11140367..11140448,11140558..11140628,
FT                   11142158..11142254,11143166..11143424,11146767..11146820,
FT                   11152235..11152298,11177705..11177756,11178247..11178351,
FT                   11179491..11179591,11185541..11185649,11190493..11190656)
FT                   /locus_tag="mCG_1051067"
FT                   /product="mCG1051067"
FT                   /note="gene_id=mCG1051067.0 transcript_id=mCT194856.0
FT                   created on 27-JAN-2005"
FT   gene            complement(11141874..11145547)
FT                   /locus_tag="mCG_11373"
FT                   /note="gene_id=mCG11373.1"
FT   mRNA            complement(join(11141874..11142424,11143153..11143449,
FT                   11143910..11144206,11144399..11144671,11144991..11145299,
FT                   11145384..11145419,11145496..11145547))
FT                   /locus_tag="mCG_11373"
FT                   /product="mCG11373"
FT                   /note="gene_id=mCG11373.1 transcript_id=mCT11373.2 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(11142132..11142424,11143153..11143449,
FT                   11143910..11144206,11144399..11144671,11144991..11145299,
FT                   11145384..11145419,11145496..11145529))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11373"
FT                   /product="mCG11373"
FT                   /note="gene_id=mCG11373.1 transcript_id=mCT11373.2
FT                   protein_id=mCP14501.2"
FT                   /db_xref="GOA:Q19LI2"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016332"
FT                   /db_xref="MGI:MGI:2152878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q19LI2"
FT                   /protein_id="EDL29338.1"
FT                   /translation="MSLLATVLLLWGFTLGPGNTLMLDSGSEPKLWAEPQSLLEPWANL
FT                   TLVCAVDLPTKVFELIQNGWFLSQVRLETQVLSYRFSLGAITSNNSGIYRCRCGVEPPV
FT                   DIHLPALNKWTMLSNAVEVTGKEPLPRPLAHADPVDWITPGGLPVYVMCQVAMRGVTYL
FT                   LRQEGVDGVQKPDVQHKGTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIKMYASQAP
FT                   PTLCLMGNYLMIYPQKTYETLACKAPRNAAEFQLRQGGKVLKIHGFSPTRDAILYYVNL
FT                   KELDNPGPFTCRYRMHKYMHVWSEDSKPVELMWSDETLQAPVLTAEPSSRDLEPGSTVQ
FT                   LRCTAPVSGLRFGLQRQGKPELVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAP
FT                   PFSGSSSSEPVELRVNGPPPKPRLEALWKSTVHLGQEAIFRCHGHVPRVSMELVREGFK
FT                   TPFAVASTRSTSAYLKLLFVGPQHAGNYSCRYTALPPFTFESGISDPVEVIVEG"
FT   CDS             join(11143198..11143424,11146767..11146820,
FT                   11152235..11152283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051067"
FT                   /product="mCG1051067"
FT                   /note="gene_id=mCG1051067.0 transcript_id=mCT194856.0
FT                   protein_id=mCP115885.0"
FT                   /protein_id="EDL29337.1"
FT                   /translation="MAVPVPCRYSCSFQSLLLRYCAAQRLLRSQTNSAFAPQLIPVCPG
FT                   VAGQSAGRIRVQYIEAAPLNQAQGPYSMALQSSKTTLILSEEAAVKLQRTLISNWVQKK
FT                   DENRI"
FT   gap             11167463..11169646
FT                   /estimated_length=2184
FT   gap             11181548..11184396
FT                   /estimated_length=2849
FT   gap             11193159..11193444
FT                   /estimated_length=286
FT   gap             11196197..11198304
FT                   /estimated_length=2108
FT   gap             11199319..11200251
FT                   /estimated_length=933
FT   gap             11204058..11204967
FT                   /estimated_length=910
FT   gap             11207040..11207127
FT                   /estimated_length=88
FT   gap             11216157..11218717
FT                   /estimated_length=2561
FT   gap             11246134..11251081
FT                   /estimated_length=4948
FT   gap             11260536..11260555
FT                   /estimated_length=20
FT   gap             11293159..11293254
FT                   /estimated_length=96
FT   gap             11297849..11302444
FT                   /estimated_length=4596
FT   gap             11317813..11317998
FT                   /estimated_length=186
FT   gap             11344310..11344513
FT                   /estimated_length=204
FT   gap             11357726..11358386
FT                   /estimated_length=661
FT   gap             11362569..11362704
FT                   /estimated_length=136
FT   gap             11370174..11370193
FT                   /estimated_length=20
FT   gap             11371876..11371901
FT                   /estimated_length=26
FT   gap             11379722..11379830
FT                   /estimated_length=109
FT   gap             11398528..11398621
FT                   /estimated_length=94
FT   gap             11470734..11470753
FT                   /estimated_length=20
FT   gap             11496531..11496565
FT                   /estimated_length=35
FT   gap             11509891..11509910
FT                   /estimated_length=20
FT   gap             11524998..11525066
FT                   /estimated_length=69
FT   gap             11555264..11555283
FT                   /estimated_length=20
FT   gap             11605149..11606145
FT                   /estimated_length=997
FT   gap             11610870..11610924
FT                   /estimated_length=55
FT   gap             11635399..11635418
FT                   /estimated_length=20
FT   gap             11667992..11668114
FT                   /estimated_length=123
FT   gap             11730186..11730324
FT                   /estimated_length=139
FT   gap             11745849..11746032
FT                   /estimated_length=184
FT   gap             11757373..11757397
FT                   /estimated_length=25
FT   gene            complement(11757437..11765095)
FT                   /locus_tag="mCG_148011"
FT                   /note="gene_id=mCG148011.0"
FT   mRNA            complement(join(11757437..11758560,11765029..11765095))
FT                   /locus_tag="mCG_148011"
FT                   /product="mCG148011"
FT                   /note="gene_id=mCG148011.0 transcript_id=mCT188274.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(11758406..11758560,11765029..11765062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148011"
FT                   /product="mCG148011"
FT                   /note="gene_id=mCG148011.0 transcript_id=mCT188274.0
FT                   protein_id=mCP108975.0"
FT                   /protein_id="EDL29339.1"
FT                   /translation="MLKYLLSPHHKGCLASTRDSSASRSIMWVTLHPMTGKSLKIRRKL
FT                   KHIHVHHPFFSLGVSWN"
FT   gap             11759622..11759641
FT                   /estimated_length=20
FT   gap             11771046..11771065
FT                   /estimated_length=20
FT   gap             11772285..11772424
FT                   /estimated_length=140
FT   gap             11788247..11789052
FT                   /estimated_length=806
FT   gap             11790155..11793271
FT                   /estimated_length=3117
FT   gap             11806012..11806322
FT                   /estimated_length=311
FT   gap             11872546..11872565
FT                   /estimated_length=20
FT   gap             11877059..11877078
FT                   /estimated_length=20
FT   gap             11886981..11887341
FT                   /estimated_length=361
FT   gap             11932764..11932783
FT                   /estimated_length=20
FT   gap             11940247..11940266
FT                   /estimated_length=20
FT   gap             11941991..11942010
FT                   /estimated_length=20
FT   gap             11946021..11946216
FT                   /estimated_length=196
FT   gap             11947853..11947872
FT                   /estimated_length=20
FT   gap             11961947..11963000
FT                   /estimated_length=1054
FT   gap             11966936..11966955
FT                   /estimated_length=20
FT   gap             11970188..11970657
FT                   /estimated_length=470
FT   gap             11983389..11984996
FT                   /estimated_length=1608
FT   gap             12000185..12000308
FT                   /estimated_length=124
FT   gap             12023801..12023897
FT                   /estimated_length=97
FT   gap             12026229..12026319
FT                   /estimated_length=91
FT   gap             12040107..12040228
FT                   /estimated_length=122
FT   gap             12056088..12056107
FT                   /estimated_length=20
FT   gap             12087143..12087293
FT                   /estimated_length=151
FT   gap             12090391..12090410
FT                   /estimated_length=20
FT   gap             12099932..12099951
FT                   /estimated_length=20
FT   gap             12100703..12101142
FT                   /estimated_length=440
FT   gap             12107746..12107765
FT                   /estimated_length=20
FT   gap             12123715..12124976
FT                   /estimated_length=1262
FT   gap             12125736..12125755
FT                   /estimated_length=20
FT   gap             12156846..12156865
FT                   /estimated_length=20
FT   gap             12161748..12161767
FT                   /estimated_length=20
FT   gap             12164684..12165027
FT                   /estimated_length=344
FT   gap             12173970..12174022
FT                   /estimated_length=53
FT   gap             12178216..12178238
FT                   /estimated_length=23
FT   gap             12188662..12188772
FT                   /estimated_length=111
FT   gap             12191010..12191103
FT                   /estimated_length=94
FT   gap             12194717..12194779
FT                   /estimated_length=63
FT   gap             12198055..12198535
FT                   /estimated_length=481
FT   gap             12202961..12202980
FT                   /estimated_length=20
FT   gap             12205418..12205550
FT                   /estimated_length=133
FT   gene            12206253..12211095
FT                   /gene="Myc"
FT                   /locus_tag="mCG_1625"
FT                   /note="gene_id=mCG1625.1"
FT   mRNA            join(12206253..12206818,12208374..12209145,
FT                   12210196..12211095)
FT                   /gene="Myc"
FT                   /locus_tag="mCG_1625"
FT                   /product="myelocytomatosis oncogene"
FT                   /note="gene_id=mCG1625.1 transcript_id=mCT7789.0 created on
FT                   09-AUG-2002"
FT   CDS             join(12208389..12209145,12210196..12210758)
FT                   /codon_start=1
FT                   /gene="Myc"
FT                   /locus_tag="mCG_1625"
FT                   /product="myelocytomatosis oncogene"
FT                   /note="gene_id=mCG1625.1 transcript_id=mCT7789.0
FT                   protein_id=mCP14505.1"
FT                   /protein_id="EDL29340.1"
FT                   /translation="MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAP
FT                   SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMT
FT                   ELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSL
FT                   SPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSD
FT                   SLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGS
FT                   SPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNR
FT                   KCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKA
FT                   TAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA"
FT   gap             12209319..12209338
FT                   /estimated_length=20
FT   gap             12239292..12239654
FT                   /estimated_length=363
FT   gap             12248683..12250321
FT                   /estimated_length=1639
FT   gap             12252200..12253163
FT                   /estimated_length=964
FT   gap             12258562..12259345
FT                   /estimated_length=784
FT   gap             12268879..12268996
FT                   /estimated_length=118
FT   gap             12291642..12291860
FT                   /estimated_length=219
FT   gap             12293135..12293154
FT                   /estimated_length=20
FT   gap             12299402..12299447
FT                   /estimated_length=46
FT   gap             12311639..12311658
FT                   /estimated_length=20
FT   gap             12324601..12324645
FT                   /estimated_length=45
FT   gene            <12328126..12599180
FT                   /locus_tag="mCG_145469"
FT                   /note="gene_id=mCG145469.0"
FT   mRNA            join(<12328126..12328448,12370282..12370395,
FT                   12463218..12463345,12463478..12463605,12534387..12534496,
FT                   12593561..12593683,12593959..12594030,12594670..12594770,
FT                   12597108..12599180)
FT                   /locus_tag="mCG_145469"
FT                   /product="mCG145469"
FT                   /note="gene_id=mCG145469.0 transcript_id=mCT184893.0
FT                   created on 05-JUN-2003"
FT   gap             12341580..12341699
FT                   /estimated_length=120
FT   gap             12359402..12359421
FT                   /estimated_length=20
FT   gap             12376719..12376738
FT                   /estimated_length=20
FT   gap             12377799..12377876
FT                   /estimated_length=78
FT   gap             12395998..12396052
FT                   /estimated_length=55
FT   gap             12440498..12440641
FT                   /estimated_length=144
FT   gap             12489755..12490053
FT                   /estimated_length=299
FT   gap             12529276..12529295
FT                   /estimated_length=20
FT   gap             12530783..12530802
FT                   /estimated_length=20
FT   gap             12538422..12538441
FT                   /estimated_length=20
FT   gap             12588885..12590810
FT                   /estimated_length=1926
FT   CDS             <12597192..12597635
FT                   /codon_start=1
FT                   /locus_tag="mCG_145469"
FT                   /product="mCG145469"
FT                   /note="gene_id=mCG145469.0 transcript_id=mCT184893.0
FT                   protein_id=mCP105337.0"
FT                   /protein_id="EDL29341.1"
FT                   /translation="VYQARGFPETLCKPPCCERRGLCLEGFRLHSTVSDGQRWLCALSH
FT                   YVKKTQPFSYLPQFHSCDLLKTKSGHATLCLTSSGSRPSSRVILSTVMPFPHFSLRTAT
FT                   TVNLIQAKIISKEETSIEKTLPTRLACGAISWLKTDVGGPIPQ"
FT   gap             12607154..12607192
FT                   /estimated_length=39
FT   gap             12621110..12621286
FT                   /estimated_length=177
FT   gap             12628654..12628729
FT                   /estimated_length=76
FT   gap             12664043..12664323
FT                   /estimated_length=281
FT   gap             12686070..12686250
FT                   /estimated_length=181
FT   gap             12692647..12692666
FT                   /estimated_length=20
FT   gap             12693799..12693818
FT                   /estimated_length=20
FT   gap             12695456..12695475
FT                   /estimated_length=20
FT   gap             12698497..12699283
FT                   /estimated_length=787
FT   gap             12721188..12721855
FT                   /estimated_length=668
FT   gap             12733449..12733468
FT                   /estimated_length=20
FT   gap             12738931..12739892
FT                   /estimated_length=962
FT   gap             12772237..12772922
FT                   /estimated_length=686
FT   gap             12837086..12837105
FT                   /estimated_length=20
FT   gap             12850856..12850875
FT                   /estimated_length=20
FT   gap             12852510..12852529
FT                   /estimated_length=20
FT   gap             12854035..12854081
FT                   /estimated_length=47
FT   gap             12859826..12859845
FT                   /estimated_length=20
FT   gap             12868529..12868835
FT                   /estimated_length=307
FT   gap             12870690..12870734
FT                   /estimated_length=45
FT   gap             12880395..12880414
FT                   /estimated_length=20
FT   gap             12901295..12901314
FT                   /estimated_length=20
FT   gap             12924028..12924051
FT                   /estimated_length=24
FT   gap             12931969..12931988
FT                   /estimated_length=20
FT   gap             12971789..12971808
FT                   /estimated_length=20
FT   gap             12975346..12975365
FT                   /estimated_length=20
FT   gap             13044979..13044998
FT                   /estimated_length=20
FT   gap             13066109..13066134
FT                   /estimated_length=26
FT   gap             13074637..13074658
FT                   /estimated_length=22
FT   gap             13076669..13076688
FT                   /estimated_length=20
FT   gap             13080991..13081115
FT                   /estimated_length=125
FT   gap             13103032..13103150
FT                   /estimated_length=119
FT   gap             13120631..13120650
FT                   /estimated_length=20
FT   gap             13166633..13166848
FT                   /estimated_length=216
FT   gene            13191653..13193086
FT                   /pseudo
FT                   /locus_tag="mCG_1627"
FT                   /note="gene_id=mCG1627.0"
FT   mRNA            13191653..13193086
FT                   /pseudo
FT                   /locus_tag="mCG_1627"
FT                   /note="gene_id=mCG1627.0 transcript_id=mCT7805.1 created on
FT                   12-NOV-2002"
FT   gap             13213020..13213115
FT                   /estimated_length=96
FT   gap             13217927..13217946
FT                   /estimated_length=20
FT   gap             13222074..13222438
FT                   /estimated_length=365
FT   gap             13228835..13228985
FT                   /estimated_length=151
FT   gap             13244107..13244662
FT                   /estimated_length=556
FT   gap             13245085..13245104
FT                   /estimated_length=20
FT   gap             13247222..13247587
FT                   /estimated_length=366
FT   gap             13267257..13267276
FT                   /estimated_length=20
FT   gap             13317568..13317587
FT                   /estimated_length=20
FT   gap             13325987..13326006
FT                   /estimated_length=20
FT   gap             13340049..13340068
FT                   /estimated_length=20
FT   gap             13412815..13413631
FT                   /estimated_length=817
FT   gap             13415992..13416011
FT                   /estimated_length=20
FT   gap             13422807..13422826
FT                   /estimated_length=20
FT   gap             13430649..13430848
FT                   /estimated_length=200
FT   gap             13442982..13443106
FT                   /estimated_length=125
FT   gap             13457323..13457342
FT                   /estimated_length=20
FT   gene            13466288..>13477298
FT                   /locus_tag="mCG_148000"
FT                   /note="gene_id=mCG148000.0"
FT   mRNA            join(13466288..13466408,13476419..>13477298)
FT                   /locus_tag="mCG_148000"
FT                   /product="mCG148000"
FT                   /note="gene_id=mCG148000.0 transcript_id=mCT188263.0
FT                   created on 13-JAN-2004"
FT   CDS             13477170..>13477298
FT                   /codon_start=1
FT                   /locus_tag="mCG_148000"
FT                   /product="mCG148000"
FT                   /note="gene_id=mCG148000.0 transcript_id=mCT188263.0
FT                   protein_id=mCP108963.0"
FT                   /protein_id="EDL29342.1"
FT                   /translation="MLERMQEQKKTSPSPLGLQSGTAIWKSMWRILQILQINLQYIS"
FT   gap             13495555..13495752
FT                   /estimated_length=198
FT   gap             13507386..13507405
FT                   /estimated_length=20
FT   gap             13540525..13540958
FT                   /estimated_length=434
FT   gap             13590729..13590748
FT                   /estimated_length=20
FT   gap             13613919..13614741
FT                   /estimated_length=823
FT   gap             13620520..13622122
FT                   /estimated_length=1603
FT   gene            complement(13626382..>13690220)
FT                   /locus_tag="mCG_145473"
FT                   /note="gene_id=mCG145473.0"
FT   mRNA            complement(join(13626382..13626627,13626765..13626811,
FT                   13627947..13627999,13628925..13628985,13653124..13653300,
FT                   13690175..>13690220))
FT                   /locus_tag="mCG_145473"
FT                   /product="mCG145473"
FT                   /note="gene_id=mCG145473.0 transcript_id=mCT184897.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(13627996..13627999,13628925..13628985,
FT                   13653124..13653300,13690175..>13690220))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145473"
FT                   /product="mCG145473"
FT                   /note="gene_id=mCG145473.0 transcript_id=mCT184897.0
FT                   protein_id=mCP105341.0"
FT                   /protein_id="EDL29343.1"
FT                   /translation="YCVKTLPLSQIPKPSGLPEDCLMSGCGSLSSVSTCFWKSLSGDNY
FT                   ARLLSENISLIVSEIGSLTWNVSQVGPIIGTWEVIGFEAHSTGGNLCLAI"
FT   gap             13646926..13647056
FT                   /estimated_length=131
FT   gap             13662756..13662775
FT                   /estimated_length=20
FT   gap             13669212..13669231
FT                   /estimated_length=20
FT   gap             13670639..13670658
FT                   /estimated_length=20
FT   gap             13678708..13678727
FT                   /estimated_length=20
FT   gap             13679914..13679933
FT                   /estimated_length=20
FT   gap             13682774..13682793
FT                   /estimated_length=20
FT   gap             13687414..13687433
FT                   /estimated_length=20
FT   gap             13760646..13760665
FT                   /estimated_length=20
FT   gap             13763196..13772966
FT                   /estimated_length=9771
FT   gap             13785780..13785799
FT                   /estimated_length=20
FT   gap             13807655..13807866
FT                   /estimated_length=212
FT   gap             13818831..13818850
FT                   /estimated_length=20
FT   gap             13838622..13838962
FT                   /estimated_length=341
FT   gap             13850485..13850504
FT                   /estimated_length=20
FT   gap             13855655..13856049
FT                   /estimated_length=395
FT   gap             13865103..13865124
FT                   /estimated_length=22
FT   gap             13865837..13865913
FT                   /estimated_length=77
FT   gap             13867599..13867618
FT                   /estimated_length=20
FT   gap             13890606..13890625
FT                   /estimated_length=20
FT   gap             13893794..13894542
FT                   /estimated_length=749
FT   gap             13913676..13913695
FT                   /estimated_length=20
FT   gap             13916158..13916177
FT                   /estimated_length=20
FT   gap             13931047..13932694
FT                   /estimated_length=1648
FT   gap             13940116..13940135
FT                   /estimated_length=20
FT   gap             13953804..13953828
FT                   /estimated_length=25
FT   gene            13956535..13958091
FT                   /locus_tag="mCG_148002"
FT                   /note="gene_id=mCG148002.0"
FT   mRNA            join(13956535..13956692,13957123..13958091)
FT                   /locus_tag="mCG_148002"
FT                   /product="mCG148002"
FT                   /note="gene_id=mCG148002.0 transcript_id=mCT188265.0
FT                   created on 13-JAN-2004"
FT   CDS             13957802..13958029
FT                   /codon_start=1
FT                   /locus_tag="mCG_148002"
FT                   /product="mCG148002"
FT                   /note="gene_id=mCG148002.0 transcript_id=mCT188265.0
FT                   protein_id=mCP108967.0"
FT                   /protein_id="EDL29344.1"
FT                   /translation="MEKQQPLCCCQLLHRPLTETSLFLDLLGTMTPVVLLWLALCSDFK
FT                   PLLQAQGGPIALLCSSSGTHATELSYQRSS"
FT   gap             13961174..13961193
FT                   /estimated_length=20
FT   gap             13973220..13973940
FT                   /estimated_length=721
FT   gap             13978571..13978590
FT                   /estimated_length=20
FT   gene            complement(13996844..13999758)
FT                   /locus_tag="mCG_113319"
FT                   /note="gene_id=mCG113319.0"
FT   mRNA            complement(join(13996844..13997672,13998197..13998270,
FT                   13998704..13998833,13999324..13999465,13999746..13999758))
FT                   /locus_tag="mCG_113319"
FT                   /product="mCG113319"
FT                   /note="gene_id=mCG113319.0 transcript_id=mCT114400.0
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(13997433..13997672,13998197..13998270,
FT                   13998704..13998833,13999324..13999458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113319"
FT                   /product="mCG113319"
FT                   /note="gene_id=mCG113319.0 transcript_id=mCT114400.0
FT                   protein_id=mCP60614.1"
FT                   /protein_id="EDL29345.1"
FT                   /translation="MCLQNEVSEQTRLLAELSKDVQEVVFSSFLHMLCDRDVLYDLMKM
FT                   LELNQLGHMDGPGGKILDELRKDSSLSWINLKDLILYLLQALMVLSDTQLCLLALSVEM
FT                   RLLPHQVELVKSILQPNFKYPWNIPFTLQPQLLAPLQGEGLAITYELLEECGLKMELNN
FT                   PRSTWDLEAKMPLSALYGSLSFLQQLSEA"
FT   gene            complement(<14000205..14029629)
FT                   /locus_tag="mCG_114005"
FT                   /note="gene_id=mCG114005.1"
FT   mRNA            complement(join(<14000205..14000311,14000530..14000559,
FT                   14000751..14000852,14020148..14020259,14022671..14022833,
FT                   14024337..14024541,14025170..14025384,14029263..14029629))
FT                   /locus_tag="mCG_114005"
FT                   /product="mCG114005"
FT                   /note="gene_id=mCG114005.1 transcript_id=mCT115095.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(14000205..14000311,14000530..14000559,
FT                   14000751..14000852,14020148..14020259,14022671..14022833,
FT                   14024337..14024541,14025170..14025380))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114005"
FT                   /product="mCG114005"
FT                   /note="gene_id=mCG114005.1 transcript_id=mCT115095.1
FT                   protein_id=mCP60640.1"
FT                   /protein_id="EDL29346.1"
FT                   /translation="MSYTFDWLSKDVVKKLQGRDLRPVKCLSDATKFCLFNILQETSSR
FT                   LALKTEYIPVGFTLLHLLEPNIPVPEPEVSAPIPLKHTISQKLKADLDVETIAGGEAGF
FT                   VKSCGYDIEVQSKSIPNPKLESLQNRQDHGGGGGRKLLDQLPTFMKTCWKDGKNLYVVT
FT                   EAYEVTKDTVLEGTSNSKFAIKGIINQLVKVGGSGQWQTEKTDSIPIQKGSVLAYKKQQ
FT                   LVIEDNTCVILTSANTKKKMTFPMRFVGMSGHLRYQDLVIETGSWINDIDPIGTIKEPT
FT                   HLGECVCVCVCVCVFKRGKEIWASTGKP"
FT   gap             14003006..14003025
FT                   /estimated_length=20
FT   gap             14037392..14037550
FT                   /estimated_length=159
FT   gene            <14037998..14042516
FT                   /locus_tag="mCG_1633"
FT                   /note="gene_id=mCG1633.1"
FT   mRNA            join(<14037998..14038092,14039024..14039210,
FT                   14039820..14039990,14040840..14040945,14042393..14042516)
FT                   /locus_tag="mCG_1633"
FT                   /product="mCG1633"
FT                   /note="gene_id=mCG1633.1 transcript_id=mCT7796.2 created on
FT                   22-OCT-2002"
FT   CDS             join(<14038085..14038092,14039024..14039210,
FT                   14039820..14039951)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1633"
FT                   /product="mCG1633"
FT                   /note="gene_id=mCG1633.1 transcript_id=mCT7796.2
FT                   protein_id=mCP14508.2"
FT                   /protein_id="EDL29347.1"
FT                   /translation="GLRGEPQWAHLPLGEVGRRIERGSEPEHWAAGPGDRKWQDHPPLC
FT                   LGCADTLGLPLHLGDAAREEETEVAQALLPPGATQPEGEGESIRVTEAVETLQDAMLQS
FT                   HSHM"
FT   gene            complement(14045165..14055617)
FT                   /locus_tag="mCG_114007"
FT                   /note="gene_id=mCG114007.1"
FT   mRNA            complement(join(14045165..14045970,14046480..14046553,
FT                   14046979..14047108,14047600..14047745,14048578..14048604,
FT                   14048838..14048868,14051576..14051681,14055489..14055617))
FT                   /locus_tag="mCG_114007"
FT                   /product="mCG114007"
FT                   /note="gene_id=mCG114007.1 transcript_id=mCT115097.1
FT                   created on 09-DEC-2002"
FT   CDS             complement(join(14045692..14045970,14046480..14046553,
FT                   14046979..14047108,14047600..14047745,14048578..14048604,
FT                   14048838..14048868,14051576..14051681,14055489..14055571))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114007"
FT                   /product="mCG114007"
FT                   /note="gene_id=mCG114007.1 transcript_id=mCT115097.1
FT                   protein_id=mCP60364.1"
FT                   /protein_id="EDL29348.1"
FT                   /translation="MLGTVDTTSRFRVQASQIQNWKFFKTGKFEARREGRKSIQYLSQR
FT                   VRCWPIRSSNLSLRITLVGLWINDIVPIGRIQEPAHLDFMCLQNEVYKQTEQLAELSKG
FT                   VQEVVLSSILSMLYEGDRKVLYDLMNMLELNQLGHMDGPGGKILDELRKDSSNPCVDLK
FT                   DLILYLLQALMVLSDSQLNLLAQSVEMGILPHQVELVKSILQPNFKYPWNIPFTLQPQL
FT                   LAPLQGEGLAITYELLEECGLKMELNNPRSTWDLEAKMPLSALYGSLSFLQQLRKANSS
FT                   SKPSLRPGYI"
FT   gap             14051802..14052548
FT                   /estimated_length=747
FT   gap             14053913..14054100
FT                   /estimated_length=188
FT   gap             14055661..14058770
FT                   /estimated_length=3110
FT   gap             14059928..14072781
FT                   /estimated_length=12854
FT   gene            complement(14076391..>14130366)
FT                   /locus_tag="mCG_114011"
FT                   /note="gene_id=mCG114011.1"
FT   mRNA            complement(join(14076391..14076433,14109426..14109718,
FT                   14110262..14110335,14110754..14110883,14111375..14111514,
FT                   14112309..14112335,14112566..14112595,14112793..14112900,
FT                   14115360..14115465,14117923..14118088,14119507..14119655,
FT                   14120285..14120496,14130268..>14130366))
FT                   /locus_tag="mCG_114011"
FT                   /product="mCG114011"
FT                   /note="gene_id=mCG114011.1 transcript_id=mCT115101.1
FT                   created on 15-OCT-2002"
FT   gene            complement(<14076473..14079675)
FT                   /locus_tag="mCG_114012"
FT                   /note="gene_id=mCG114012.1"
FT   mRNA            complement(join(<14076473..14076751,14077295..14077368,
FT                   14077794..14077923,14078418..14078563,14079386..14079412,
FT                   14079645..14079675))
FT                   /locus_tag="mCG_114012"
FT                   /product="mCG114012"
FT                   /note="gene_id=mCG114012.1 transcript_id=mCT115102.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(14076473..14076751,14077295..14077368,
FT                   14077794..14077923,14078418..14078465))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114012"
FT                   /product="mCG114012"
FT                   /note="gene_id=mCG114012.1 transcript_id=mCT115102.1
FT                   protein_id=mCP60427.1"
FT                   /protein_id="EDL29350.1"
FT                   /translation="MLYEGDRNVLHDLMKMLELSQLGHMDGPGGKILDELRKDSSNPCV
FT                   DLKDLILYLLQALMVLSDSQLNLLARSVEMRLLPHQVELVTSILQPNFKYPWNIPFTVQ
FT                   PQLLAPLQGEGLAITYELLEECGLKMELNNPRSTWDLEAKMPLSALYGSLSFLQQLQKA
FT                   NSSFKPSLRPGYI"
FT   gap             14082088..14082107
FT                   /estimated_length=20
FT   gap             14083393..14105536
FT                   /estimated_length=22144
FT   CDS             complement(join(14109440..14109718,14110262..14110335,
FT                   14110754..14110883,14111375..14111514,14112309..14112335,
FT                   14112566..14112595,14112793..14112900,14115360..14115465,
FT                   14117923..14118088,14119507..>14119559))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114011"
FT                   /product="mCG114011"
FT                   /note="gene_id=mCG114011.1 transcript_id=mCT115101.1
FT                   protein_id=mCP60419.1"
FT                   /protein_id="EDL29349.1"
FT                   /translation="GMLGTVDTTSRFRVQASHRKLLDKLPTFMKFCRMERKNLYVVTEA
FT                   YEVSKDTMLTGLSSVNLLVKGFFKQLFKVRGKAGRSEKYSIPIPKGSVLAYKKQQLVIE
FT                   NNTCVILPSATKKKMTFPDRPLKLYDLPVTLRYQEEVIETGSWIDDIDPIGTIEEPANL
FT                   NFMCLQHEVSEQTQLLAELSKDVQEVVFSSFLHMLSDRDVLYDLMKMLELNQLGHMDGP
FT                   GGKILDELRKDSSTPHDVLKDLNLYLLQALLVLSDTQLCLLAQSVKMGLLPHQVELVKS
FT                   ILQTNFKYSSNTPFTLQPQLLAPLQGEGLAITYELLEECGLKMELNNPRSTWDLEAKMP
FT                   LSALYGSLSFLQQLQKANSSSKPSLSPGYI"
FT   gap             14119487..14119506
FT                   /estimated_length=20
FT   gap             14124668..14128647
FT                   /estimated_length=3980
FT   gene            <14132528..14143476
FT                   /locus_tag="mCG_17118"
FT                   /note="gene_id=mCG17118.1"
FT   mRNA            join(<14132528..14132600,14133137..14133324,
FT                   14141061..14141236,14141548..14141689,14142132..14142205,
FT                   14142934..14143476)
FT                   /locus_tag="mCG_17118"
FT                   /product="mCG17118"
FT                   /note="gene_id=mCG17118.1 transcript_id=mCT16360.2 created
FT                   on 15-OCT-2002"
FT   CDS             join(<14133243..14133324,14141061..14141236,
FT                   14141548..14141689,14142132..14142205,14142934..14142951)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17118"
FT                   /product="mCG17118"
FT                   /note="gene_id=mCG17118.1 transcript_id=mCT16360.2
FT                   protein_id=mCP23782.2"
FT                   /protein_id="EDL29351.1"
FT                   /translation="YNAAGDERNLVSHPKSFHIGICTITGKGIAFSQESGEESSFHDLR
FT                   DQVDSQLQDLVTLSSEQRDTLLGALQELLQDHQALQELEDTLEQALDTGLLVHLEGPGG
FT                   CVLSILKDSTGNLSCSRSMAVFFILGALAALSEPQRCLLAQSIERQILCEELELEYSVL
FT                   "
FT   gap             14133827..14139634
FT                   /estimated_length=5808
FT   gene            complement(14148964..>14278496)
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /note="gene_id=mCG17120.2"
FT   mRNA            complement(join(14148964..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14188870..14188908,
FT                   14240738..14240788,14278340..14278495))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT16362"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT16362.1 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(14148967..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14240738..14240788,
FT                   14278340..14278496))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT174546"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174546.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(14148967..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14188870..14188908,
FT                   14278340..14278484))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT174545"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174545.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(14148967..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14188870..14188908,
FT                   14215866..14215937))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT174547"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174547.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(14148967..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14175525..14175607,14188870..14188908,
FT                   14215866..14215937))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT174548"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174548.0 created
FT                   on 15-OCT-2002"
FT   CDS             complement(join(14149639..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14175525..14175597))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_b"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174548.0
FT                   protein_id=mCP97467.0 isoform=CRA_b"
FT                   /protein_id="EDL29354.1"
FT                   /translation="MGNLIKVLTRDIDHNAAHFFLDFENAQPTESEKEIYNQVNVVLKD
FT                   AEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAAL
FT                   RGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTL
FT                   SRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTD
FT                   CLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDM
FT                   KGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIRSMLQ"
FT   CDS             complement(join(14149639..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174612))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_a"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174546.0
FT                   protein_id=mCP97464.0 isoform=CRA_a"
FT                   /protein_id="EDL29352.1"
FT                   /translation="MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKD
FT                   AEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAAL
FT                   RGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTL
FT                   SRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTD
FT                   CLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDM
FT                   KGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIRSMLQ"
FT   CDS             complement(join(14149639..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174612))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_a"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174547.0
FT                   protein_id=mCP97465.0 isoform=CRA_a"
FT                   /protein_id="EDL29353.1"
FT                   /translation="MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKD
FT                   AEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAAL
FT                   RGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTL
FT                   SRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTD
FT                   CLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDM
FT                   KGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIRSMLQ"
FT   CDS             complement(join(14149639..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174612))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_a"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT16362.1
FT                   protein_id=mCP23785.2 isoform=CRA_a"
FT                   /protein_id="EDL29356.1"
FT                   /translation="MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKD
FT                   AEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAAL
FT                   RGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTL
FT                   SRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTD
FT                   CLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDM
FT                   KGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIRSMLQ"
FT   CDS             complement(join(14149639..14149702,14153520..14153590,
FT                   14155239..14155365,14156605..14156684,14157586..14157702,
FT                   14159871..14159948,14161124..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174612))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_a"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT174545.0
FT                   protein_id=mCP97466.0 isoform=CRA_a"
FT                   /protein_id="EDL29357.1"
FT                   /translation="MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKD
FT                   AEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAAL
FT                   RGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTL
FT                   SRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTD
FT                   CLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDM
FT                   KGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIRSMLQ"
FT   gap             14150421..14150523
FT                   /estimated_length=103
FT   mRNA            complement(join(<14161188..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14175525..14175607,
FT                   14188870..14188908,14240738..14240788,14278340..>14278496))
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, transcript variant
FT                   mCT192600"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT192600.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<14161188..14161260,14162263..14162368,
FT                   14167946..14168067,14174540..14174622,14175525..>14175526))
FT                   /codon_start=1
FT                   /gene="0910001A06Rik"
FT                   /locus_tag="mCG_17120"
FT                   /product="RIKEN cDNA 0910001A06, isoform CRA_c"
FT                   /note="gene_id=mCG17120.2 transcript_id=mCT192600.0
FT                   protein_id=mCP113572.0 isoform=CRA_c"
FT                   /protein_id="EDL29355.1"
FT                   /translation="KYLNMGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNV
FT                   VLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRL
FT                   EAALRGLLGALTSTPYSPTQHLER"
FT   gap             14192115..14192147
FT                   /estimated_length=33
FT   gap             14235180..14235428
FT                   /estimated_length=249
FT   gap             14249796..14249854
FT                   /estimated_length=59
FT   gap             14255037..14255056
FT                   /estimated_length=20
FT   gap             14278497..14282383
FT                   /estimated_length=3887
FT   gene            complement(14306766..14579320)
FT                   /gene="Ddef1"
FT                   /locus_tag="mCG_17119"
FT                   /note="gene_id=mCG17119.2"
FT   mRNA            complement(join(14306766..14308152,14310380..14310502,
FT                   14312341..14312840,14317861..14317919,14320731..14320800,
FT                   14329238..14329408,14338449..14338677,14340499..14340606,
FT                   14342163..14342230,14342356..14342471,14342806..14342891,
FT                   14343209..14343395,14345873..14345964,14347672..14347805,
FT                   14348605..14348768,14354308..14354356,14356456..14356543,
FT                   14368126..14368195,14371358..14371458,14377410..14377532,
FT                   14378750..14378825,14392523..14392608,14393763..14393892,
FT                   14400370..14400419,14400903..14400977,14419161..14419306,
FT                   14436152..14436224,14579229..14579320))
FT                   /gene="Ddef1"
FT                   /locus_tag="mCG_17119"
FT                   /product="development and differentiation enhancing"
FT                   /note="gene_id=mCG17119.2 transcript_id=mCT16361.2 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(14308123..14308152,14310380..14310502,
FT                   14312341..14312840,14317861..14317919,14320731..14320800,
FT                   14329238..14329408,14338449..14338677,14340499..14340606,
FT                   14342163..14342230,14342356..14342471,14342806..14342891,
FT                   14343209..14343395,14345873..14345964,14347672..14347805,
FT                   14348605..14348768,14354308..14354356,14356456..14356543,
FT                   14368126..14368195,14371358..14371458,14377410..14377532,
FT                   14378750..14378825,14392523..14392608,14393763..14393892,
FT                   14400370..14400419,14400903..14400977,14419161..14419306,
FT                   14436152..14436224,14579229..14579237))
FT                   /codon_start=1
FT                   /gene="Ddef1"
FT                   /locus_tag="mCG_17119"
FT                   /product="development and differentiation enhancing"
FT                   /note="gene_id=mCG17119.2 transcript_id=mCT16361.2
FT                   protein_id=mCP23783.2"
FT                   /protein_id="EDL29358.1"
FT                   /translation="MESALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGS
FT                   NFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLK
FT                   KPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYL
FT                   IKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDE
FT                   EKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSDSQSRQGGYSMHQLQGNKEYGSEKK
FT                   GFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDL
FT                   ISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQ
FT                   RLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELL
FT                   LAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKL
FT                   NELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFL
FT                   VQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKA
FT                   TQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCH
FT                   SSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGK
FT                   GPTGPPSTLPLGTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGN
FT                   DVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTN
FT                   IPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPK
FT                   PQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSR
FT                   DAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGE
FT                   VIIVTGEEDQEWWYPGDDCVDP"
FT   gap             14332022..14332168
FT                   /estimated_length=147
FT   gap             14369057..14369076
FT                   /estimated_length=20
FT   gap             14380580..14380976
FT                   /estimated_length=397
FT   gap             14382543..14385597
FT                   /estimated_length=3055
FT   gap             14387446..14387465
FT                   /estimated_length=20
FT   gap             14395619..14395638
FT                   /estimated_length=20
FT   gap             14397078..14397097
FT                   /estimated_length=20
FT   gap             14447850..14447869
FT                   /estimated_length=20
FT   gap             14457050..14457069
FT                   /estimated_length=20
FT   gap             14504474..14504627
FT                   /estimated_length=154
FT   gap             14539924..14540714
FT                   /estimated_length=791
FT   gene            14542288..14543867
FT                   /locus_tag="mCG_148016"
FT                   /note="gene_id=mCG148016.0"
FT   mRNA            join(14542288..14542324,14543222..14543867)
FT                   /locus_tag="mCG_148016"
FT                   /product="mCG148016"
FT                   /note="gene_id=mCG148016.0 transcript_id=mCT188279.0
FT                   created on 13-JAN-2004"
FT   CDS             14543431..14543622
FT                   /codon_start=1
FT                   /locus_tag="mCG_148016"
FT                   /product="mCG148016"
FT                   /note="gene_id=mCG148016.0 transcript_id=mCT188279.0
FT                   protein_id=mCP108980.0"
FT                   /protein_id="EDL29359.1"
FT                   /translation="MLCVLEVKHQEQDKLVPMDTISTADHRHLGIDSESYFYSQGSLSH
FT                   LLWNQRSLLARGLTAIQT"
FT   gap             14559665..14559684
FT                   /estimated_length=20
FT   gap             14560925..14560944
FT                   /estimated_length=20
FT   gap             14566549..14566595
FT                   /estimated_length=47
FT   gap             14577003..14577022
FT                   /estimated_length=20
FT   gap             14584347..14584366
FT                   /estimated_length=20
FT   gap             14585591..14585610
FT                   /estimated_length=20
FT   gap             14591044..14591063
FT                   /estimated_length=20
FT   gap             14598618..14598637
FT                   /estimated_length=20
FT   gap             14601131..14601216
FT                   /estimated_length=86
FT   gap             14613869..14614205
FT                   /estimated_length=337
FT   gap             14621646..14621674
FT                   /estimated_length=29
FT   gap             14625915..14625963
FT                   /estimated_length=49
FT   gap             14653683..14653713
FT                   /estimated_length=31
FT   gap             14669146..14669165
FT                   /estimated_length=20
FT   gap             14684594..14687821
FT                   /estimated_length=3228
FT   gap             14695548..14696202
FT                   /estimated_length=655
FT   gap             14714920..14718556
FT                   /estimated_length=3637
FT   gap             14720687..14720729
FT                   /estimated_length=43
FT   gap             14721900..14721919
FT                   /estimated_length=20
FT   gap             14723327..14723392
FT                   /estimated_length=66
FT   gap             14724641..14724660
FT                   /estimated_length=20
FT   gap             14726523..14726542
FT                   /estimated_length=20
FT   gap             14728628..14728647
FT                   /estimated_length=20
FT   gap             14770383..14770475
FT                   /estimated_length=93
FT   gap             14795324..14795444
FT                   /estimated_length=121
FT   gap             14809634..14810608
FT                   /estimated_length=975
FT   gap             14818207..14818226
FT                   /estimated_length=20
FT   gap             14822790..14822809
FT                   /estimated_length=20
FT   gap             14840115..14842750
FT                   /estimated_length=2636
FT   gap             14869809..14869993
FT                   /estimated_length=185
FT   gap             14907521..14907815
FT                   /estimated_length=295
FT   gap             14917823..14917907
FT                   /estimated_length=85
FT   gap             14922698..14922735
FT                   /estimated_length=38
FT   gene            complement(14936764..15164192)
FT                   /gene="Adcy8"
FT                   /locus_tag="mCG_112852"
FT                   /note="gene_id=mCG112852.1"
FT   mRNA            complement(join(14936764..14937350,14939721..14939835,
FT                   14944197..14944289,14944704..14944850,14956076..14956234,
FT                   14965505..14965583,14977394..14977566,14984842..14984931,
FT                   14986898..14987099,14994780..14994880,15007847..15008044,
FT                   15023768..15024038,15027353..15027511,15046358..15046485,
FT                   15055253..15055364,15062184..15062314,15113043..15113192,
FT                   15162184..15164192))
FT                   /gene="Adcy8"
FT                   /locus_tag="mCG_112852"
FT                   /product="adenylate cyclase 8, transcript variant
FT                   mCT115103"
FT                   /note="gene_id=mCG112852.1 transcript_id=mCT115103.1
FT                   created on 30-AUG-2002"
FT   mRNA            complement(join(14936764..14937350,14939721..14939835,
FT                   14944197..14944289,14944704..14944850,14956076..14956234,
FT                   14965505..14965583,14977394..14977566,14984842..14984931,
FT                   14986898..14987099,14994780..14994880,15007847..15008044,
FT                   15023768..15024038,15027353..15027511,15046358..15046485,
FT                   15055253..15055364,15062184..15062314,15113631..15113780,
FT                   15162184..15164192))
FT                   /gene="Adcy8"
FT                   /locus_tag="mCG_112852"
FT                   /product="adenylate cyclase 8, transcript variant
FT                   mCT113924"
FT                   /note="gene_id=mCG112852.1 transcript_id=mCT113924.1
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(14936863..14937350,14939721..14939835,
FT                   14944197..14944289,14944704..14944850,14956076..14956234,
FT                   14965505..14965583,14977394..14977566,14984842..14984931,
FT                   14986898..14987099,14994780..14994880,15007847..15008044,
FT                   15023768..15024038,15027353..15027511,15046358..15046485,
FT                   15055253..15055364,15062184..15062314,15113043..15113192,
FT                   15162184..15163137))
FT                   /codon_start=1
FT                   /gene="Adcy8"
FT                   /locus_tag="mCG_112852"
FT                   /product="adenylate cyclase 8, isoform CRA_b"
FT                   /note="gene_id=mCG112852.1 transcript_id=mCT115103.1
FT                   protein_id=mCP60430.1 isoform=CRA_b"
FT                   /db_xref="GOA:P97490"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR009398"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:1341110"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97490"
FT                   /protein_id="EDL29361.1"
FT                   /translation="MELSDVHCLSGSEELYTIQPTPPAGDDGSGSRPQRLLWQTAVRHI
FT                   TEQRFIHGHRGGGGGGVSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGPGERAHNTGGT
FT                   KVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRD
FT                   LERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEV
FT                   VICALVVVRKDNTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYS
FT                   MLPLPLTWAILAGLGTSLLQVTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLS
FT                   DRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQ
FT                   FHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKI
FT                   LGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGV
FT                   LGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLR
FT                   KHNIETYLIKQPEESLLCLPEDIVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQN
FT                   TLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFK
FT                   DSSLEHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSAL
FT                   VLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFLGAVLNILWCDFDKSIP
FT                   LKNLTFNSSAVFTDICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLT
FT                   ETIYAGLFLSYDNLNHSGEDFLGTKEASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQ
FT                   AKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGF
FT                   ADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK
FT                   QQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYD
FT                   IWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTY
FT                   FLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENSNSGIIKSHYNR
FT                   RTLLTPSGPEPGAQAEGTDKSDLP"
FT   CDS             complement(join(14936863..14937350,14939721..14939835,
FT                   14944197..14944289,14944704..14944850,14956076..14956234,
FT                   14965505..14965583,14977394..14977566,14984842..14984931,
FT                   14986898..14987099,14994780..14994880,15007847..15008044,
FT                   15023768..15024038,15027353..15027511,15046358..15046485,
FT                   15055253..15055364,15062184..15062314,15113631..15113780,
FT                   15162184..15163137))
FT                   /codon_start=1
FT                   /gene="Adcy8"
FT                   /locus_tag="mCG_112852"
FT                   /product="adenylate cyclase 8, isoform CRA_a"
FT                   /note="gene_id=mCG112852.1 transcript_id=mCT113924.1
FT                   protein_id=mCP60415.1 isoform=CRA_a"
FT                   /db_xref="GOA:P97490"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR009398"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:1341110"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97490"
FT                   /protein_id="EDL29360.1"
FT                   /translation="MELSDVHCLSGSEELYTIQPTPPAGDDGSGSRPQRLLWQTAVRHI
FT                   TEQRFIHGHRGGGGGGVSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGPGERAHNTGGT
FT                   KVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRD
FT                   LERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEV
FT                   VICALVVVRKDNTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYS
FT                   MLPLPLTWAILAGLGTSLLQVTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLS
FT                   DRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQ
FT                   FHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKI
FT                   LGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGV
FT                   LGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLR
FT                   KHNIETYLIKQPEESLLCLPEDIVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQN
FT                   TLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFK
FT                   DSSLEHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSAL
FT                   VLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFLGAVLNILWCDFDKSIP
FT                   LKNLTFNSSAVFTDICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLT
FT                   ETIYAGLFLSYDNLNHSGEDFLGTKEASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQ
FT                   AKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGF
FT                   ADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK
FT                   QQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYD
FT                   IWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTY
FT                   FLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENSNSGIIKSHYNR
FT                   RTLLTPSGPEPGAQAEGTDKSDLP"
FT   gap             14940843..14943816
FT                   /estimated_length=2974
FT   gap             14966975..14966994
FT                   /estimated_length=20
FT   gap             14995907..14995926
FT                   /estimated_length=20
FT   gap             14998856..14999400
FT                   /estimated_length=545
FT   gap             15037803..15037984
FT                   /estimated_length=182
FT   gap             15048547..15048869
FT                   /estimated_length=323
FT   gap             15057821..15057840
FT                   /estimated_length=20
FT   gap             15084142..15084177
FT                   /estimated_length=36
FT   gap             15085881..15086277
FT                   /estimated_length=397
FT   gap             15087585..15087604
FT                   /estimated_length=20
FT   gap             15088765..15088784
FT                   /estimated_length=20
FT   gap             15104950..15104969
FT                   /estimated_length=20
FT   gap             15113268..15113287
FT                   /estimated_length=20
FT   gap             15131462..15131710
FT                   /estimated_length=249
FT   gap             15134916..15134935
FT                   /estimated_length=20
FT   gap             15148063..15148223
FT                   /estimated_length=161
FT   gap             15157296..15157323
FT                   /estimated_length=28
FT   gap             15158717..15159785
FT                   /estimated_length=1069
FT   gap             15164719..15164784
FT                   /estimated_length=66
FT   gap             15181573..15182692
FT                   /estimated_length=1120
FT   gap             15195799..15195849
FT                   /estimated_length=51
FT   gap             15221594..15221658
FT                   /estimated_length=65
FT   gap             15229581..15229611
FT                   /estimated_length=31
FT   gap             15243391..15243416
FT                   /estimated_length=26
FT   gap             15280453..15280472
FT                   /estimated_length=20
FT   gap             15286324..15286575
FT                   /estimated_length=252
FT   gap             15312972..15313075
FT                   /estimated_length=104
FT   gap             15355168..15355187
FT                   /estimated_length=20
FT   gap             15364990..15365080
FT                   /estimated_length=91
FT   gap             15375520..15375755
FT                   /estimated_length=236
FT   gap             15387576..15387595
FT                   /estimated_length=20
FT   gap             15388939..15389550
FT                   /estimated_length=612
FT   gap             15390912..15392314
FT                   /estimated_length=1403
FT   gap             15395269..15395288
FT                   /estimated_length=20
FT   gap             15442865..15442908
FT                   /estimated_length=44
FT   gap             15454018..15454200
FT                   /estimated_length=183
FT   gap             15455673..15456226
FT                   /estimated_length=554
FT   gap             15457516..15457691
FT                   /estimated_length=176
FT   gap             15458985..15459532
FT                   /estimated_length=548
FT   gap             15460806..15460825
FT                   /estimated_length=20
FT   gap             15477789..15477808
FT                   /estimated_length=20
FT   gap             15490198..15490388
FT                   /estimated_length=191
FT   gap             15491595..15491930
FT                   /estimated_length=336
FT   gap             15498294..15498391
FT                   /estimated_length=98
FT   gap             15499706..15499725
FT                   /estimated_length=20
FT   gap             15501612..15501631
FT                   /estimated_length=20
FT   gap             15504831..15504850
FT                   /estimated_length=20
FT   gap             15582233..15582405
FT                   /estimated_length=173
FT   gap             15589213..15593488
FT                   /estimated_length=4276
FT   gap             15597213..15597232
FT                   /estimated_length=20
FT   gap             15599167..15599452
FT                   /estimated_length=286
FT   gap             15622504..15624362
FT                   /estimated_length=1859
FT   gap             15625517..15625653
FT                   /estimated_length=137
FT   gap             15626423..15629196
FT                   /estimated_length=2774
FT   gap             15649051..15649230
FT                   /estimated_length=180
FT   gap             15671324..15671343
FT                   /estimated_length=20
FT   gap             15684803..15684822
FT                   /estimated_length=20
FT   gap             15739150..15740867
FT                   /estimated_length=1718
FT   gap             15769669..15769747
FT                   /estimated_length=79
FT   gap             15795291..15797065
FT                   /estimated_length=1775
FT   gap             15814034..15814053
FT                   /estimated_length=20
FT   gap             15824434..15824767
FT                   /estimated_length=334
FT   gap             15825591..15827643
FT                   /estimated_length=2053
FT   gap             15829714..15829733
FT                   /estimated_length=20
FT   gap             15835172..15835191
FT                   /estimated_length=20
FT   gap             15849696..15849784
FT                   /estimated_length=89
FT   gap             15865520..15865677
FT                   /estimated_length=158
FT   gap             15929424..15929443
FT                   /estimated_length=20
FT   gap             15935503..15935522
FT                   /estimated_length=20
FT   gap             15944340..15944359
FT                   /estimated_length=20
FT   gap             15952667..15954398
FT                   /estimated_length=1732
FT   gap             15962575..15966940
FT                   /estimated_length=4366
FT   gap             15971431..15972404
FT                   /estimated_length=974
FT   gap             15976257..15976715
FT                   /estimated_length=459
FT   gene            <16010182..16096938
FT                   /gene="C920006C10Rik"
FT                   /locus_tag="mCG_5381"
FT                   /note="gene_id=mCG5381.2"
FT   mRNA            join(<16010182..16010389,16038478..16038554,
FT                   16041576..16041703,16042863..16043013,16047757..16047878,
FT                   16052870..16053019,16060566..16060703,16065773..16065851,
FT                   16069040..16069175,16071279..16071440,16072894..16073008,
FT                   16074255..16074306,16076092..16076264,16076662..16076737,
FT                   16077760..16077921,16078547..16078678,16079653..16079720,
FT                   16080595..16080722,16084783..16084874,16089009..16089057,
FT                   16089855..16089958,16090401..16090450,16092083..16092380)
FT                   /gene="C920006C10Rik"
FT                   /locus_tag="mCG_5381"
FT                   /product="RIKEN cDNA C920006C10, transcript variant
FT                   mCT192631"
FT                   /note="gene_id=mCG5381.2 transcript_id=mCT192631.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(16010199..16010389,16038478..16038554,
FT                   16041576..16041703,16042863..16043013,16047757..16047878,
FT                   16052870..16053019,16060566..16060703,16065773..16065851,
FT                   16069040..16069175,16071279..16071440,16072894..16073008,
FT                   16074255..16074306,16076092..16076264,16076662..16076737,
FT                   16077760..16077921,16078547..16078678,16079653..16079720,
FT                   16080595..16080722,16084783..16084874,16089009..16089057,
FT                   16089855..16089958,16090401..16090450,16094282..16096938)
FT                   /gene="C920006C10Rik"
FT                   /locus_tag="mCG_5381"
FT                   /product="RIKEN cDNA C920006C10, transcript variant
FT                   mCT4740"
FT                   /note="gene_id=mCG5381.2 transcript_id=mCT4740.2 created on
FT                   09-AUG-2002"
FT   CDS             join(<16010341..16010389,16038478..16038554,
FT                   16041576..16041703,16042863..16043013,16047757..16047878,
FT                   16052870..16053019,16060566..16060703,16065773..16065851,
FT                   16069040..16069175,16071279..16071440,16072894..16073008,
FT                   16074255..16074306,16076092..16076264,16076662..16076737,
FT                   16077760..16077921,16078547..16078678,16079653..16079720,
FT                   16080595..16080722,16084783..16084874,16089009..16089057,
FT                   16089855..16089958,16090401..16090450,16092083..16092194)
FT                   /codon_start=1
FT                   /gene="C920006C10Rik"
FT                   /locus_tag="mCG_5381"
FT                   /product="RIKEN cDNA C920006C10, isoform CRA_a"
FT                   /note="gene_id=mCG5381.2 transcript_id=mCT192631.0
FT                   protein_id=mCP113600.0 isoform=CRA_a"
FT                   /protein_id="EDL29362.1"
FT                   /translation="VPGRRRARRTRVAMPTRVCCCCSALRPRYKRLVDNIFPEDPKDGL
FT                   VKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQ
FT                   SIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAM
FT                   CHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIE
FT                   EVDSRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWD
FT                   PNEFAVHCFKIIMYSIQAQYSHHVIQEILGHLDARRKDSPRVRAGIIQVLLEAVAIAAK
FT                   GSIGPTVLEVFNTLLKHLRLSVELEANDSQKGSVGSVTVSSKDNDEKIVQNAVIQTIGF
FT                   FGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGY
FT                   KAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVA
FT                   DLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANE
FT                   EVVIDLIRLAIALQDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKV
FT                   IETRTMEAPYFLPEHIFRDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPY
FT                   VPQVTDEDRLSRRKSIVDTVSIQVDILSNSVPSDDVVSNTEEITFEALKKAIDTNGMEE
FT                   QEKEKRRLVIEKFQKAPFEEIAAQCESKANLLHDRLAQILELTIRQRRESMLYKTEAEP
FT                   CYTQPMAWGQRRIKEKYKAVVK"
FT   CDS             join(16010380..16010389,16038478..16038554,
FT                   16041576..16041703,16042863..16043013,16047757..16047878,
FT                   16052870..16053019,16060566..16060703,16065773..16065851,
FT                   16069040..16069175,16071279..16071440,16072894..16073008,
FT                   16074255..16074306,16076092..16076264,16076662..16076737,
FT                   16077760..16077921,16078547..16078678,16079653..16079720,
FT                   16080595..16080722,16084783..16084874,16089009..16089057,
FT                   16089855..16089958,16090401..16090450,16094282..16094387)
FT                   /codon_start=1
FT                   /gene="C920006C10Rik"
FT                   /locus_tag="mCG_5381"
FT                   /product="RIKEN cDNA C920006C10, isoform CRA_b"
FT                   /note="gene_id=mCG5381.2 transcript_id=mCT4740.2
FT                   protein_id=mCP3659.2 isoform=CRA_b"
FT                   /protein_id="EDL29363.1"
FT                   /translation="MPTRVCCCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAV
FT                   SAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMV
FT                   AKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTE
FT                   IRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEEVDSRLGPPSSPS
FT                   AADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIM
FT                   YSIQAQYSHHVIQEILGHLDARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNT
FT                   LLKHLRLSVELEANDSQKGSVGSVTVSSKDNDEKIVQNAVIQTIGFFGSNLPDYQRSEI
FT                   MMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSF
FT                   LDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQD
FT                   TSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIAL
FT                   QDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEAPYFLP
FT                   EHIFRDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRLSRR
FT                   KSIVDTVSIQVDILSNSVPSDDVVSNTEEITFEALKKAIDTNGMEEQEKEKRRLVIEKF
FT                   QKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTVTSGHTQYQSVPVYEMK
FT                   FPDLCVY"
FT   gap             16057561..16057580
FT                   /estimated_length=20
FT   gene            complement(16099181..16135494)
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /note="gene_id=mCG5379.1"
FT   mRNA            complement(join(16099181..16099716,16101856..16101962,
FT                   16104633..16104804,16105654..16105767,16106950..16107003,
FT                   16110709..16110756,16111223..16111273,16112535..16112573,
FT                   16112712..16112840,16115479..16115591,16120797..16120971,
FT                   16123722..16123778,16124634..16124696,16132057..16132149,
FT                   16135336..16135494))
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, transcript variant mCT4741"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT4741.2 created on
FT                   15-OCT-2002"
FT   mRNA            complement(join(16099184..16099716,16101856..16101962,
FT                   16104633..16104807,16105654..16105767,16106950..16107003,
FT                   16112535..16112573,16112712..16112840,16115479..16115591,
FT                   16120797..16120971,16123722..16123778,16124634..16124696,
FT                   16132057..>16132149))
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, transcript variant mCT192604"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT192604.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16099185..16099716,16101856..16101962,
FT                   16104633..16104804,16105654..16105767,16106950..16107003,
FT                   16111223..16111273,16112535..16112573,16112712..16112840,
FT                   16115479..16115591,16120797..16120971,16123722..16123778,
FT                   16124634..16124696,16132057..16132149,16135336..16135494))
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, transcript variant mCT174567"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT174567.0 created
FT                   on 15-OCT-2002"
FT   CDS             complement(join(16099427..16099716,16101856..16101962,
FT                   16104633..16104807,16105654..16105767,16106950..16107003,
FT                   16112535..16112573,16112712..16112840,16115479..16115591,
FT                   16120797..16120971,16123722..16123778,16124634..16124696,
FT                   16132057..>16132147))
FT                   /codon_start=1
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, isoform CRA_b"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT192604.0
FT                   protein_id=mCP113599.0 isoform=CRA_b"
FT                   /protein_id="EDL29365.1"
FT                   /translation="SCSSLCLHLVLCTATMIMLLMVGMLMAPCVGAHALDTPNPQELPP
FT                   GLSKNINITFFNGVFKNVESVAEIFDCLGSHFTWLQAVFTNFPLLLQFVNSMRCVTGLC
FT                   PRDFEDYGCACRFEMEGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVDCTNKQ
FT                   ITCESEDPCERLLCTCDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATLLPR
FT                   ESVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRLGVSSVDNGSQEAAGKAAC
FT                   DRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYCGREGRGEPRDTLDRCCL
FT                   SHHCCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKLLCACDQMAAECMASAFF
FT                   NQSLKSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEEAPPQMERLRRFLEKPPG
FT                   PLGARPLGGK"
FT   CDS             complement(join(16099427..16099716,16101856..16101962,
FT                   16104633..16104804,16105654..16105767,16106950..16107003,
FT                   16111223..16111273,16112535..16112573,16112712..16112840,
FT                   16115479..16115591,16120797..16120971,16123722..16123778,
FT                   16124634..16124696,16132057..16132102))
FT                   /codon_start=1
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, isoform CRA_a"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT174567.0
FT                   protein_id=mCP97486.0 isoform=CRA_a"
FT                   /protein_id="EDL29364.1"
FT                   /translation="MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVF
FT                   KNVESVAEIFDCLGSHFTWLQAVFTNFPLLLQFVNSMRCVTGLCPRDFEDYGCACRFEM
FT                   EGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVDCTNKQITCESEDPCERLLCT
FT                   CDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALS
FT                   GEESVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRLGVSSVDNGSQEAAGKA
FT                   CDRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYCGREGRGEPRDTLDRCC
FT                   LSHHCCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKLLCACDQMAAECMASAF
FT                   FNQSLKSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEEAPPQMERLRRFLEKPP
FT                   GPLGARPLGGK"
FT   CDS             complement(join(16099427..16099716,16101856..16101962,
FT                   16104633..16104804,16105654..16105767,16106950..16107003,
FT                   16110709..16110756,16111223..16111273,16112535..16112573,
FT                   16112712..16112840,16115479..16115591,16120797..16120971,
FT                   16123722..16123778,16124634..16124696,16132057..16132102))
FT                   /codon_start=1
FT                   /gene="Oc90"
FT                   /locus_tag="mCG_5379"
FT                   /product="otoconin 90, isoform CRA_c"
FT                   /note="gene_id=mCG5379.1 transcript_id=mCT4741.2
FT                   protein_id=mCP3652.2 isoform=CRA_c"
FT                   /protein_id="EDL29366.1"
FT                   /translation="MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVF
FT                   KNVESVAEIFDCLGSHFTWLQAVFTNFPLLLQFVNSMRCVTGLCPRDFEDYGCACRFEM
FT                   EGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVDCTNKQITCESEDPCERLLCT
FT                   CDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALS
FT                   GEVAGEVRADTLTTLSRTKSVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRL
FT                   GVSSVDNGSQEAAGKACDRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYC
FT                   GREGRGEPRDTLDRCCLSHHCCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKL
FT                   LCACDQMAAECMASAFFNQSLKSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEE
FT                   APPQMERLRRFLEKPPGPLGARPLGGK"
FT   gap             16125837..16125856
FT                   /estimated_length=20
FT   gene            complement(16151342..16152066)
FT                   /locus_tag="mCG_5378"
FT                   /note="gene_id=mCG5378.1"
FT   mRNA            complement(16151342..16152066)
FT                   /locus_tag="mCG_5378"
FT                   /product="mCG5378"
FT                   /note="gene_id=mCG5378.1 transcript_id=mCT4743.1 created on
FT                   12-NOV-2002"
FT   CDS             complement(16151545..16152024)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5378"
FT                   /product="mCG5378"
FT                   /note="gene_id=mCG5378.1 transcript_id=mCT4743.1
FT                   protein_id=mCP3651.1"
FT                   /protein_id="EDL29367.1"
FT                   /translation="MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQ
FT                   AQSLIDKTTAAFQQGKIPPAPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMP
FT                   MMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPKMVPTRPGMTRPDR"
FT   gap             16157646..16157665
FT                   /estimated_length=20
FT   gene            complement(16217836..16326052)
FT                   /gene="Kcnq3"
FT                   /locus_tag="mCG_5380"
FT                   /note="gene_id=mCG5380.2"
FT   mRNA            complement(join(16217836..16218949,16220739..16220823,
FT                   16223055..16223153,16225234..16225365,16227761..16227863,
FT                   16228811..16229015,16243332..16243430,16244790..16244885,
FT                   16246696..16246806,16248163..16248318,16251674..16251846,
FT                   16253569..16253695,16254430..16254520,16325931..16326052))
FT                   /gene="Kcnq3"
FT                   /locus_tag="mCG_5380"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 3"
FT                   /note="gene_id=mCG5380.2 transcript_id=mCT4739.2 created on
FT                   12-NOV-2002"
FT   CDS             complement(join(16218215..16218949,16220739..16220823,
FT                   16223055..16223153,16225234..16225365,16227761..16227863,
FT                   16228811..16229015,16243332..16243430,16244790..16244885,
FT                   16246696..16246806,16248163..16248318,16251674..16251846,
FT                   16253569..16253575))
FT                   /codon_start=1
FT                   /gene="Kcnq3"
FT                   /locus_tag="mCG_5380"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 3"
FT                   /note="gene_id=mCG5380.2 transcript_id=mCT4739.2
FT                   protein_id=mCP3656.1"
FT                   /protein_id="EDL29368.1"
FT                   /translation="MLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRG
FT                   GTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEMDAQGEEMKEEFETY
FT                   ADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQ
FT                   HRQKHFEKRRKPAAELIQAAWRYYATNPNRLDLVATWRFYESVVSFPFFRQSQKLGLLD
FT                   RVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSS
FT                   EDAGTGDPMAEDRGYGNDFLIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDV
FT                   IEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTYPSQQSPRNEPYV
FT                   ARAATSETEDQSMMGKFVKVERQVHDMGKKLDFLVDMHMQHMERLQVHVTEYYPTKGAS
FT                   SPAEGEKKEDNRYSDLKTIICNYSETGPPDPPYSFHQVPIDRVGPYGFFAHDPVKLTRG
FT                   GPSSTKAQANLPSSGSTYAERPTVLPILTLLDSCVSYHSQTELQGPYSDHISPRQRRSI
FT                   TRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPSGGSSWMREKRYLAEGETDTD
FT                   TDPFTPSGSMPMSSTGDGISDSIWTPSNKPT"
FT   gap             16280247..16286634
FT                   /estimated_length=6388
FT   gap             16299771..16299848
FT                   /estimated_length=78
FT   gap             16356805..16356824
FT                   /estimated_length=20
FT   gap             16370183..16370315
FT                   /estimated_length=133
FT   gap             16374944..16375009
FT                   /estimated_length=66
FT   gap             16389713..16389823
FT                   /estimated_length=111
FT   gap             16429200..16429219
FT                   /estimated_length=20
FT   gap             16435715..16435734
FT                   /estimated_length=20
FT   gene            <16444650..16446011
FT                   /locus_tag="mCG_114203"
FT                   /note="gene_id=mCG114203.1"
FT   mRNA            join(<16444650..16444818,16444849..16445250,
FT                   16445727..16446011)
FT                   /locus_tag="mCG_114203"
FT                   /product="mCG114203"
FT                   /note="gene_id=mCG114203.1 transcript_id=mCT115295.1
FT                   created on 12-NOV-2002"
FT   CDS             join(<16444930..16445250,16445727..16445729)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114203"
FT                   /product="mCG114203"
FT                   /note="gene_id=mCG114203.1 transcript_id=mCT115295.1
FT                   protein_id=mCP60491.1"
FT                   /protein_id="EDL29369.1"
FT                   /translation="STDPRCVVMLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVK
FT                   TGQKILTEQQESMSEEKKGLKRKRKKKGDTVLSGGQKGQNKKAEAEEEGELASVSFPYA
FT                   SSA"
FT   gap             16486435..16486454
FT                   /estimated_length=20
FT   gap             16506302..16506321
FT                   /estimated_length=20
FT   gap             16507469..16507513
FT                   /estimated_length=45
FT   gap             16509129..16515747
FT                   /estimated_length=6619
FT   gap             16525103..16525639
FT                   /estimated_length=537
FT   gene            16525862..16529189
FT                   /locus_tag="mCG_148004"
FT                   /note="gene_id=mCG148004.0"
FT   mRNA            join(16525862..16526082,16528259..16529189)
FT                   /locus_tag="mCG_148004"
FT                   /product="mCG148004"
FT                   /note="gene_id=mCG148004.0 transcript_id=mCT188267.0
FT                   created on 13-JAN-2004"
FT   CDS             16528858..16529007
FT                   /codon_start=1
FT                   /locus_tag="mCG_148004"
FT                   /product="mCG148004"
FT                   /note="gene_id=mCG148004.0 transcript_id=mCT188267.0
FT                   protein_id=mCP108969.0"
FT                   /protein_id="EDL29370.1"
FT                   /translation="MGLRAYIKRHRKTMSGLDCPFDSPGQSQPQKWIYCHQIGLGHIYK
FT                   HLGC"
FT   gap             16541752..16541771
FT                   /estimated_length=20
FT   gap             16584392..16584745
FT                   /estimated_length=354
FT   gap             16593429..16594183
FT                   /estimated_length=755
FT   gap             16597094..16597395
FT                   /estimated_length=302
FT   gap             16598677..16599694
FT                   /estimated_length=1018
FT   gene            complement(16619107..16748194)
FT                   /gene="Lrrc6"
FT                   /locus_tag="mCG_8978"
FT                   /note="gene_id=mCG8978.1"
FT   mRNA            complement(join(16619107..16619819,16638727..16638812,
FT                   16679340..16679435,16680101..16680170,16683903..16683968,
FT                   16694733..16694810,16696582..16696773,16701208..16701434,
FT                   16716962..16717134,16728589..16728666,16736819..16736986,
FT                   16748122..16748194))
FT                   /gene="Lrrc6"
FT                   /locus_tag="mCG_8978"
FT                   /product="leucine rich repeat containing 6 (testis)"
FT                   /note="gene_id=mCG8978.1 transcript_id=mCT8990.1 created on
FT                   09-AUG-2002"
FT   CDS             complement(join(16619642..16619819,16638727..16638812,
FT                   16679340..16679435,16680101..16680170,16683903..16683968,
FT                   16694733..16694810,16696582..16696773,16701208..16701434,
FT                   16716962..16717134,16728589..16728666,16736819..16736986,
FT                   16748122..16748131))
FT                   /codon_start=1
FT                   /gene="Lrrc6"
FT                   /locus_tag="mCG_8978"
FT                   /product="leucine rich repeat containing 6 (testis)"
FT                   /note="gene_id=mCG8978.1 transcript_id=mCT8990.1
FT                   protein_id=mCP3649.1"
FT                   /protein_id="EDL29371.1"
FT                   /translation="MGRITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRD
FT                   LKILYLQNNLIGKIENVSKLKKLEYLNLALNNIERIENLEGCEWLTKLDLTVNFIGELS
FT                   SVKTLTHNIHLKELFLMGNPCADFDGYRQFVVVTLQQLKWLDGKEIERSERIQALQNYT
FT                   SVEQQIREQEKAYCLRRAKEKEEAQRKLEEENESEDKKKSSTGFDGHWYTDIHTACPSA
FT                   TENQDYPQVPETQEEQHNTKESDDIEDDLAFWNKPSLFTPESRLETLRHMEKQRKAQDK
FT                   LSEKKKKAKPPRTLITEDGKVLNVNEAKLDFSLKDDEKHNQIILDLAVYRYMDTSLIEV
FT                   DVQPTYVRVMVKGKPFQLALSTEVQPDRSSAKRSQTTGHLLICMPKVGEMITGGQRTPT
FT                   SVKTTSTSSREQTNPRKKQIERLEVDPSKHSCPDVSTIVQEKRHRPKRMESQPRDEPSE
FT                   EDPDFEDNPEVPPLI"
FT   gap             16629627..16629763
FT                   /estimated_length=137
FT   gap             16631883..16631985
FT                   /estimated_length=103
FT   gap             16689084..16689103
FT                   /estimated_length=20
FT   gap             16690155..16690174
FT                   /estimated_length=20
FT   gap             16691363..16691382
FT                   /estimated_length=20
FT   gap             16692391..16692410
FT                   /estimated_length=20
FT   gap             16693740..16693759
FT                   /estimated_length=20
FT   gap             16718807..16719533
FT                   /estimated_length=727
FT   gap             16723498..16723517
FT                   /estimated_length=20
FT   gene            complement(16774357..16808462)
FT                   /gene="Tmem71"
FT                   /locus_tag="mCG_114204"
FT                   /note="gene_id=mCG114204.0"
FT   mRNA            complement(join(16774357..16775282,16779937..16779997,
FT                   16780099..16780160,16786155..16786230,16788931..16789116,
FT                   16799311..16799459,16802389..16802601,16805104..16805164,
FT                   16806639..16806721,16808089..16808462))
FT                   /gene="Tmem71"
FT                   /locus_tag="mCG_114204"
FT                   /product="transmembrane protein 71"
FT                   /note="gene_id=mCG114204.0 transcript_id=mCT115296.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(join(16775267..16775282,16779937..16779997,
FT                   16780099..16780160,16786155..16786230,16788931..16789116,
FT                   16799311..16799459,16802389..16802601,16805104..16805164,
FT                   16806639..16806678))
FT                   /codon_start=1
FT                   /gene="Tmem71"
FT                   /locus_tag="mCG_114204"
FT                   /product="transmembrane protein 71"
FT                   /note="gene_id=mCG114204.0 transcript_id=mCT115296.0
FT                   protein_id=mCP60492.1"
FT                   /protein_id="EDL29372.1"
FT                   /translation="MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSS
FT                   FECCSIDPLTGSHYICRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLV
FT                   RIFRKKKRTHRSLSSLLDPRASKSWLHGSIFGEVDSLPSEDLWLDGIRSLGSDLDCSLS
FT                   DGWESQKPVTDTSESSSSGYILPQSLRESSQSSSLQLQVKASGHFEKNSLDHSRAGLMH
FT                   KVSFQAILLAVCLVISAYTRWFVGGELASIFTCALLITIAYVVKSLFLNLARYFKATSC
FT                   ARFDST"
FT   gap             16814510..16814529
FT                   /estimated_length=20
FT   gene            16824915..16892602
FT                   /locus_tag="mCG_114202"
FT                   /note="gene_id=mCG114202.0"
FT   mRNA            join(16824915..16825198,16827421..16827540,
FT                   16842179..16842350,16842487..16842571,16844731..16844819,
FT                   16845049..16845126,16851399..16851612,16852152..16852277,
FT                   16856898..16856980,16860393..16860642,16862592..16862780,
FT                   16863010..16863219,16870137..16870193,16871368..16871475,
FT                   16876304..16876468,16877179..16877360,16878246..16878345,
FT                   16880085..16880280,16884063..16884411,16887293..16887455,
FT                   16889178..16892602)
FT                   /locus_tag="mCG_114202"
FT                   /product="mCG114202"
FT                   /note="gene_id=mCG114202.0 transcript_id=mCT115294.1
FT                   created on 13-NOV-2002"
FT   CDS             join(16827458..16827540,16842179..16842350,
FT                   16842487..16842571,16844731..16844819,16845049..16845126,
FT                   16851399..16851612,16852152..16852277,16856898..16856980,
FT                   16860393..16860642,16862592..16862780,16863010..16863219,
FT                   16870137..16870193,16871368..16871475,16876304..16876468,
FT                   16877179..16877360,16878246..16878345,16880085..16880280,
FT                   16884063..16884411,16887293..16887455,16889178..16889320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114202"
FT                   /product="mCG114202"
FT                   /note="gene_id=mCG114202.0 transcript_id=mCT115294.1
FT                   protein_id=mCP60482.1"
FT                   /protein_id="EDL29373.1"
FT                   /translation="MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLV
FT                   HFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEEELFDFKAGEEVLARWTDCRYYP
FT                   AKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQVKSQHPLSWCCPIDPAGSCN
FT                   QSMGSEDWIALVKAAAAAAAKNKTGTKPRASANSNKEKERDGGKWFKLPSKKAETSTCI
FT                   VTAEIEKKEELPTSSETFGLHIDTVPKIVFPQPESTLTNKRKNNQGNSFQAKRARLNKI
FT                   TGLLASKAVGVDGAERKEDCSATAPVLEQAISPKPQSQKKNEAVISSSANTQKPALLSS
FT                   TLSSGKARSKKCKHESGESSGCIKTPKSPLAPELIQAKDLTLVSQLSSVINKTSSPQPV
FT                   NPPRPCKHSERRRRSQRLATLPMPDDSLEKLSSSSSATDGKAFSISSQNQQQSSVPEVP
FT                   AIAYVPLQKLGPCLPLDLSCGSEVTGSRTPHPSYHGGECPREEKEETPLFANPTSKVVS
FT                   DVKGAAAATGISKTEKKVKLEEKTSTAFGKRKEKDKEKKEKRDKDHYKPKQKKKKKKKK
FT                   KSKQHDYSDYEDSSLDFLERCSSPLTRSSGSSLAPRSTFTEKTTTYQYPRAILSVDLSG
FT                   ENLSDVEFLDDSSTESLLLSGDEYNQDFDSTNFEESQDEDDALNEIVRCICELDEENGF
FT                   MIQCEECLCWQHSVCMGLLEDSIPEQYICYICRDPPGQRWSAKYRYDKEWLNNGRMYGL
FT                   SFLKENYSHLNAKKIVSTHHLLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWAYSGKR
FT                   KDQDQAVAEAERKITPQDRANSEGKECVQNHKEPALRMEETYITSEHSYQKPQSFSQDC
FT                   QSLTDPGSSDDDDASSFEEDGELRVPDKSHLLYKNRGVSEKNPASGNKVFVYNDKKGTE
FT                   GPGDSHLQWQLNLLTHIENVQNEVTSRMDLIEKEVDVLESWLDFTGELEPPDPLARLPQ
FT                   LKRHLKQLLLDVGKVQQIATLCSV"
FT   gap             16900093..16900540
FT                   /estimated_length=448
FT   gap             16910700..16911499
FT                   /estimated_length=800
FT   gene            <16918502..17098859
FT                   /gene="Tgn"
FT                   /locus_tag="mCG_140799"
FT                   /note="gene_id=mCG140799.1"
FT   mRNA            join(<16918502..16918611,16919059..16919167,
FT                   16920113..16920210,16921125..16921328,16921662..16921821,
FT                   16925705..16925811,16926444..16926587,16926785..16926970,
FT                   16929561..16930658,16931382..16931969,16933001..16933240,
FT                   16936540..16936677,16937018..16937095,16937634..16937746,
FT                   16940034..16940136,16940996..16941196,16942491..16942700,
FT                   16943845..16943999,16944217..16944373,16946189..16946404,
FT                   16952942..16953091,16955612..16955782,16962814..16962930,
FT                   16964871..16964986,16967393..16967501,16972833..16973024,
FT                   16977259..16977426,16982544..16982609,16983217..16983291,
FT                   16984244..16984381,16985407..16985583,16987093..16987204,
FT                   16988698..16988777,16989480..16989623,16996726..16996791,
FT                   17005867..17006001,17007414..17007578,17012264..17012486,
FT                   17014118..17014211,17016535..17016694,17021278..17021480,
FT                   17075418..17075582,17076554..17076721,17086089..17086270,
FT                   17087432..17087539,17095201..17095335,17097586..17097776,
FT                   17098634..17098762)
FT                   /gene="Tgn"
FT                   /locus_tag="mCG_140799"
FT                   /product="thyroglobulin, transcript variant mCT192627"
FT                   /note="gene_id=mCG140799.1 transcript_id=mCT192627.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<16918503..16918611,16919059..16919167,
FT                   16920113..16920210,16921125..16921328,16921662..16921821,
FT                   16925705..16925811,16926444..16926587,16926785..16926970,
FT                   16929561..16930658,16931382..16931969,16933001..16933240,
FT                   16936540..16936677,16937018..16937095,16937634..16937746,
FT                   16940034..16940136,16940996..16941196,16942491..16942700,
FT                   16943845..16943999,16944217..16944373,16946189..16946404,
FT                   16952942..16953091,16955612..16955782,16962814..16962930,
FT                   16964871..16964986,16967393..16967501,16972833..16973024,
FT                   16977259..16977426,16982544..16982609,16983217..16983291,
FT                   16984244..16984381,16985407..16985583,16987093..16987204,
FT                   16988698..16988777,16989480..16989623,16996726..16996791,
FT                   17005867..17006001,17007414..17007578,17012264..17012486,
FT                   17014118..17014211,17016535..17016694,17021278..17021480,
FT                   17075418..17075582,17076554..17076721,17086089..17086270,
FT                   17087432..17087539,17095201..17095335,17097586..17097776,
FT                   17098634..17098752)
FT                   /codon_start=1
FT                   /gene="Tgn"
FT                   /locus_tag="mCG_140799"
FT                   /product="thyroglobulin, isoform CRA_b"
FT                   /note="gene_id=mCG140799.1 transcript_id=mCT192627.0
FT                   protein_id=mCP113568.0 isoform=CRA_b"
FT                   /protein_id="EDL29375.1"
FT                   /translation="GHCSYPFIPVGDRMTALVLWVSTLLSSVCLVAANIFEYQVDAQPL
FT                   RPCELQREKAFLKQAEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGREVPGSRQLGRPT
FT                   VCLSFCQLHKQRILLGSYINSTDALYLPQCQDSGNYAPVQCDLQRVQCWCVDTEGMEVY
FT                   GTRQQGRPTRCPRSCEIRNRRLLHGVGDRSPPQCTADGEFMPVQCKFVNTTDMMIFDLI
FT                   HNYNRFPDAFVTFSSFRGRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQ
FT                   ASTFTQSTMYRILQRRFLAIQLVISGRFRCPTKCEVEQFAATRFGHSYIPRCHRDGHYQ
FT                   TVQCQTEGMCWCVDAQGREVPGTRQQGQPPSCAADQSCALERQQALSRFYFETPDYFSP
FT                   QDLLSSEDRLAPVSGVRSDTSCPPRIKELFVDSGLLRSIAVEHYQRLSESRSLLREAIR
FT                   AVFPSRELAGLALQFTTNPKRLQQNLFGGTFLANAAQFNLSGALGTRSTFNFSQFFQQF
FT                   GLPGFLNRDRVTTLAKLLPVRLDSSSTPETLRVSEKTVAMNKRVVGNFGFKVNLQENQD
FT                   ALKFLVSLLELPEFLVFLQRAVSVPEDIARDLGDVMEMVFSAQACKQMPGKFFVPSCTA
FT                   GGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSS
FT                   FFVPTCTREGYFLPVQCFNSECYCVDTEGQVIPGTQSTVGEAKQCPSVCQLQAEQAFLG
FT                   VVGVLLSNSSMVPSISNVYIPQCSASGQWRHVQCDGPHEQVFEWYERWKTQNGDGQELT
FT                   PAALLMKIVSYREVASRNFSLFLQSLYDAGQQRIFPVLAQYPSLQDVPQVVLEGATTPP
FT                   GENIFLDPYIFWQILNGQLSQYPGPYSDFNMPLEHFNLRSCWCVDEAGQKLDGTQTKPG
FT                   EIPACPGPCEEVKLRVLKFIKETEEIVSASNASSFPLGESFLVAKGIQLTSEELDLPPQ
FT                   FPSRDAFSEKFLRGGEYAIRLAAQSTLTFYQSLRASLGKSDGAASLLWSGPYMPQCNMI
FT                   GGWEPVQCHAGTGQCWCVDGRGEFIPGSLMSRSSQMPQCPTNCELSRASGLISAWKQAG
FT                   PQRNPGPGDLFIPVCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNTNGSAQCPGLCDVL
FT                   KSRALSRKVGLGYSPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVPGTRVVGTQPACE
FT                   SPQCPLPFSGSDVADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSPGPLICSLESQH
FT                   WVTLPPPRACQRPQLWQTMQTQAHFQLLLPPGKMCSVDYSGLLQAFQVFILDELIARGF
FT                   CQIQVKTFGTLVSSTVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSLPDLYSIERA
FT                   VTGQDLLGRFADLIQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLGCMEGFYRV
FT                   PTTRQDALGCVKCPEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTITTGAFSKT
FT                   HCVTDCQKNEAGLQCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLSESQCLM
FT                   IRKFDKAPESKVIFDANSPVIVKSSVPSADSPLVQCLTDCANDEACSFLTVSTMESEVS
FT                   CDFYSWTRDNFACVTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKGYEST
FT                   AAGQKSFEPTGFQNVLSGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQVKG
FT                   GPTICGLLSSPDILLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQGLA
FT                   LLEGTQDSFTSFQQVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQV
FT                   IVNTSHSLPSQQYWLFTHLFSAEQANLWCLSRCAQEPIFCQLADITKSSSLYFTCFLYP
FT                   EAQVCDNVMESNAKNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKV
FT                   PMSGKLISNGFFECERLCDRDPCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGA
FT                   TWRILDCGSEDTEVHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALS
FT                   SVIVDPSIKHFDVAHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYP
FT                   DIQNCIHSLRSHTCWLLLHEEATYIYRKSGIPLVQSDVTSTPSVRIDSFGQLQGGSQVI
FT                   KVGTAWKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPP
FT                   QINEDCLYLNVFVPENLVSNASVLVFFHNTMEMEGSGGQLTIDGSILAAVGNFIVVTAN
FT                   YRLGVFGFLSSGSDEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVAS
FT                   IHLLISRPTRLQLFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVS
FT                   CLRQKPANILNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGS
FT                   QDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHST
FT                   DDYASFSRALENATRDYFIICPMVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQ
FT                   YAFGLPFYSAYQGQFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDF
FT                   IPGAGGESYKELSAQLPNRQGLKQADCSFWSKYIQTLKDAGNGAKDAQLTKSEEEDLEV
FT                   GPGLEEDLSGSLEPVPKSYSK"
FT   mRNA            join(<16918542..16918611,16919059..16919167,
FT                   16920113..16920210,16921125..16921328,16921662..16921821,
FT                   16925705..16925811,16926444..16926587,16926785..16926970,
FT                   16929561..16930658,16931382..16931969,16933001..16933240,
FT                   16936540..16936677,16937018..16937095,16937634..16937746,
FT                   16940034..16940136,16940996..16941196,16942491..16942700,
FT                   16943845..16943999,16944217..16944373,16946189..16946404,
FT                   16952942..16953091,16955612..16955782,16962814..16962930,
FT                   16964871..16964986,16967393..16967501,16972833..16973024,
FT                   16977259..16977426,16982544..16982609,16983217..16983291,
FT                   16984244..16984381,16985407..16985583,16987093..16987204,
FT                   16988698..16988777,16989480..16989623,16996726..16996791,
FT                   17005867..17006001,17007414..17007578,17012264..17012486,
FT                   17014118..17014211,17016535..17016694,17021278..17021480,
FT                   17075418..17075582,17076554..17076721,17086089..17086270,
FT                   17087432..17087539,17095201..17095335,17097586..17097773,
FT                   17098634..17098859)
FT                   /gene="Tgn"
FT                   /locus_tag="mCG_140799"
FT                   /product="thyroglobulin, transcript variant mCT171581"
FT                   /note="gene_id=mCG140799.1 transcript_id=mCT171581.0
FT                   created on 09-AUG-2002"
FT   CDS             join(16918542..16918611,16919059..16919167,
FT                   16920113..16920210,16921125..16921328,16921662..16921821,
FT                   16925705..16925811,16926444..16926587,16926785..16926970,
FT                   16929561..16930658,16931382..16931969,16933001..16933240,
FT                   16936540..16936677,16937018..16937095,16937634..16937746,
FT                   16940034..16940136,16940996..16941196,16942491..16942700,
FT                   16943845..16943999,16944217..16944373,16946189..16946404,
FT                   16952942..16953091,16955612..16955782,16962814..16962930,
FT                   16964871..16964986,16967393..16967501,16972833..16973024,
FT                   16977259..16977426,16982544..16982609,16983217..16983291,
FT                   16984244..16984381,16985407..16985583,16987093..16987204,
FT                   16988698..16988777,16989480..16989623,16996726..16996791,
FT                   17005867..17006001,17007414..17007578,17012264..17012486,
FT                   17014118..17014211,17016535..17016694,17021278..17021480,
FT                   17075418..17075582,17076554..17076721,17086089..17086270,
FT                   17087432..17087539,17095201..17095335,17097586..17097773,
FT                   17098634..17098752)
FT                   /codon_start=1
FT                   /gene="Tgn"
FT                   /locus_tag="mCG_140799"
FT                   /product="thyroglobulin, isoform CRA_a"
FT                   /note="gene_id=mCG140799.1 transcript_id=mCT171581.0
FT                   protein_id=mCP94500.0 isoform=CRA_a"
FT                   /db_xref="GOA:O08710"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR016324"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="MGI:MGI:98733"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08710"
FT                   /protein_id="EDL29374.1"
FT                   /translation="MTALVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLK
FT                   QAEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGREVPGSRQLGRPTVCLSFCQLHKQRI
FT                   LLGSYINSTDALYLPQCQDSGNYAPVQCDLQRVQCWCVDTEGMEVYGTRQQGRPTRCPR
FT                   SCEIRNRRLLHGVGDRSPPQCTADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTF
FT                   SSFRGRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRIL
FT                   QRRFLAIQLVISGRFRCPTKCEVEQFAATRFGHSYIPRCHRDGHYQTVQCQTEGMCWCV
FT                   DAQGREVPGTRQQGQPPSCAADQSCALERQQALSRFYFETPDYFSPQDLLSSEDRLAPV
FT                   SGVRSDTSCPPRIKELFVDSGLLRSIAVEHYQRLSESRSLLREAIRAVFPSRELAGLAL
FT                   QFTTNPKRLQQNLFGGTFLANAAQFNLSGALGTRSTFNFSQFFQQFGLPGFLNRDRVTT
FT                   LAKLLPVRLDSSSTPETLRVSEKTVAMNKRVVGNFGFKVNLQENQDALKFLVSLLELPE
FT                   FLVFLQRAVSVPEDIARDLGDVMEMVFSAQACKQMPGKFFVPSCTAGGSYEDIQCYAGE
FT                   CWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFL
FT                   PVQCFNSECYCVDTEGQVIPGTQSTVGEAKQCPSVCQLQAEQAFLGVVGVLLSNSSMVP
FT                   SISNVYIPQCSASGQWRHVQCDGPHEQVFEWYERWKTQNGDGQELTPAALLMKIVSYRE
FT                   VASRNFSLFLQSLYDAGQQRIFPVLAQYPSLQDVPQVVLEGATTPPGENIFLDPYIFWQ
FT                   ILNGQLSQYPGPYSDFNMPLEHFNLRSCWCVDEAGQKLDGTQTKPGEIPACPGPCEEVK
FT                   LRVLKFIKETEEIVSASNASSFPLGESFLVAKGIQLTSEELDLPPQFPSRDAFSEKFLR
FT                   GGEYAIRLAAQSTLTFYQSLRASLGKSDGAASLLWSGPYMPQCNMIGGWEPVQCHAGTG
FT                   QCWCVDGRGEFIPGSLMSRSSQMPQCPTNCELSRASGLISAWKQAGPQRNPGPGDLFIP
FT                   VCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNTNGSAQCPGLCDVLKSRALSRKVGLGY
FT                   SPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVPGTRVVGTQPACESPQCPLPFSGSDV
FT                   ADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSPGPLICSLESQHWVTLPPPRACQRP
FT                   QLWQTMQTQAHFQLLLPPGKMCSVDYSGLLQAFQVFILDELIARGFCQIQVKTFGTLVS
FT                   STVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSLPDLYSIERAVTGQDLLGRFADL
FT                   IQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLGCMEGFYRVPTTRQDALGCVKC
FT                   PEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTITTGAFSKTHCVTDCQKNEAGL
FT                   QCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLSESQCLMIRKFDKAPESKVI
FT                   FDANSPVIVKSSVPSADSPLVQCLTDCANDEACSFLTVSTMESEVSCDFYSWTRDNFAC
FT                   VTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKGYESTAAGQKSFEPTGFQ
FT                   NVLSGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQVKGGPTICGLLSSPDI
FT                   LLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQGLALLEGTQDSFTSFQ
FT                   QVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQVIVNTSHSLPSQQY
FT                   WLFTHLFSAEQANLWCLSRCAQEPIFCQLADITKSSSLYFTCFLYPEAQVCDNVMESNA
FT                   KNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKVPMSGKLISNGFFE
FT                   CERLCDRDPCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGATWRILDCGSEDTE
FT                   VHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALSSVIVDPSIKHFDV
FT                   AHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYPDIQNCIHSLRSHT
FT                   CWLLLHEEATYIYRKSGIPLVQSDVTSTPSVRIDSFGQLQGGSQVIKVGTAWKQVYRFL
FT                   GVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPPQINEDCLYLNVFV
FT                   PENLVSNASVLVFFHNTMEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFGFLSSGS
FT                   DEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRPTRLQL
FT                   FRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLRQKPANILNDA
FT                   QTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINRAKAVK
FT                   QFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSRALENA
FT                   TRDYFIICPMVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQG
FT                   QFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELS
FT                   AQLPNRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLSGSLEP
FT                   VPKSYSK"
FT   gap             16928048..16928067
FT                   /estimated_length=20
FT   gap             16979711..16980421
FT                   /estimated_length=711
FT   gene            complement(17028818..17079985)
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /note="gene_id=mCG8971.2"
FT   mRNA            complement(join(17028818..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049633,17079725..17079985))
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, transcript variant mCT171965"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT171965.0 created
FT                   on 28-FEB-2003"
FT   mRNA            complement(join(17028818..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049614,17060675..17060841))
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, transcript variant mCT8985"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT8985.1 created on
FT                   28-FEB-2003"
FT   mRNA            complement(join(17030080..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049633,17060675..17060943,
FT                   17079725..17079755))
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, transcript variant mCT180769"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT180769.0 created
FT                   on 28-FEB-2003"
FT   CDS             complement(join(17030541..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049633,17079725..17079735))
FT                   /codon_start=1
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, isoform CRA_a"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT171965.0
FT                   protein_id=mCP94884.0 isoform=CRA_a"
FT                   /protein_id="EDL29376.1"
FT                   /translation="MLCRLRVPSTAQGEKEMGNSMKSTSPPSERPLSSSEGLESDFLAV
FT                   LTDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEG
FT                   LGRDKAEELLQLPDTKIGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPR
FT                   LTFQCLEDLVTHYSEVADGLCCVLTTPCLAQNIPAPTSHPSPCTSPGSPVTLRQKTFDW
FT                   KRVSRLQEGSEGAENPLRVDESLFSYGLRESIASYLSLTGDDSSSFDRKKKSLSLMYTG
FT                   SKRKSSFFSAPQYFED"
FT   CDS             complement(join(17030541..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049596))
FT                   /codon_start=1
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, isoform CRA_b"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT180769.0
FT                   protein_id=mCP103691.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="MGI:MGI:104295"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX0"
FT                   /protein_id="EDL29377.1"
FT                   /translation="MGNSMKSTSPPSERPLSSSEGLESDFLAVLTDYPSPDISPPIFRR
FT                   GEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTK
FT                   IGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVTHYSEV
FT                   ADGLCCVLTTPCLAQNIPAPTSHPSPCTSPGSPVTLRQKTFDWKRVSRLQEGSEGAENP
FT                   LRVDESLFSYGLRESIASYLSLTGDDSSSFDRKKKSLSLMYTGSKRKSSFFSAPQYFED
FT                   "
FT   CDS             complement(join(17030541..17030754,17031608..17031755,
FT                   17035036..17035167,17037681..17037784,17040224..17040310,
FT                   17041658..17041757,17049536..17049596))
FT                   /codon_start=1
FT                   /gene="Sla"
FT                   /locus_tag="mCG_8971"
FT                   /product="src-like adaptor, isoform CRA_b"
FT                   /note="gene_id=mCG8971.2 transcript_id=mCT8985.1
FT                   protein_id=mCP3661.1 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="MGI:MGI:104295"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX0"
FT                   /protein_id="EDL29378.1"
FT                   /translation="MGNSMKSTSPPSERPLSSSEGLESDFLAVLTDYPSPDISPPIFRR
FT                   GEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTK
FT                   IGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVTHYSEV
FT                   ADGLCCVLTTPCLAQNIPAPTSHPSPCTSPGSPVTLRQKTFDWKRVSRLQEGSEGAENP
FT                   LRVDESLFSYGLRESIASYLSLTGDDSSSFDRKKKSLSLMYTGSKRKSSFFSAPQYFED
FT                   "
FT   gap             17042520..17042703
FT                   /estimated_length=184
FT   gap             17056391..17056531
FT                   /estimated_length=141
FT   gene            <17139437..17171337
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /note="gene_id=mCG8972.2"
FT   mRNA            join(17139437..17139751,17154518..17154797,
FT                   17160953..17161213,17161557..17161652,17165415..17165608,
FT                   17167293..17171337)
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   transcript variant mCT171966"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT171966.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(<17139437..17139751,17154518..17154797,
FT                   17160953..17161213,17165415..17165608,17167293..17171337)
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   transcript variant mCT8986"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT8986.2 created on
FT                   28-FEB-2003"
FT   mRNA            join(17139437..17139751,17154518..17154797,
FT                   17165415..17165608,17167293..17171337)
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   transcript variant mCT171967"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT171967.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(<17139506..17139751,17154518..17154605,
FT                   17160953..17161213,17165415..17165608,17167293..17168189)
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   transcript variant mCT180770"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT180770.0 created
FT                   on 28-FEB-2003"
FT   CDS             join(<17139674..17139751,17154518..17154797,
FT                   17160953..17161213,17165415..17165608,17167293..17167592)
FT                   /codon_start=1
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT8986.2
FT                   protein_id=mCP3662.1 isoform=CRA_d"
FT                   /protein_id="EDL29382.1"
FT                   /translation="LPGMRWLLPWTLAAVAVLRVGNILATALSPTPTTMTFTPAPLEET
FT                   TTRPEFCKWPCECPQSPPRCPLGVSLITDGCECCKICAQQLGDNCTEAAICDPHRGLYC
FT                   DYSGDRPRYAIGVCAQVVGVGCVLDGVRYTNGESFQPNCRYNCTCIDGTVGCTPLCLSP
FT                   RPPRLWCRQPRHVRVPGQCCEQWVCDDDARRPRQTALLDTRAFAASGAVEQRYENCIAY
FT                   TSPWSPCSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDIQLHIKAGKKCLAVYQ
FT                   PEEATNFTLAGCVSTRTYRPKYCGVCTDNRCCIPYKSKTISVDFQCPEGPGFSRQVLWI
FT                   NACFCNLSCRNPNDIFADLESYPDFEEIAN"
FT   CDS             join(17139683..17139751,17154518..17154797,
FT                   17160953..17161213,17161557..17161652,17165415..17165608,
FT                   17167293..17167592)
FT                   /codon_start=1
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT171966.0
FT                   protein_id=mCP94886.0 isoform=CRA_a"
FT                   /protein_id="EDL29379.1"
FT                   /translation="MRWLLPWTLAAVAVLRVGNILATALSPTPTTMTFTPAPLEETTTR
FT                   PEFCKWPCECPQSPPRCPLGVSLITDGCECCKICAQQLGDNCTEAAICDPHRGLYCDYS
FT                   GDRPRYAIGVCAQVVGVGCVLDGVRYTNGESFQPNCRYNCTCIDGTVGCTPLCLSPRPP
FT                   RLWCRQPRHVRVPGQCCEQWVCDDDARRPRQTALLDTRAFDNSRVLLLWSCEQMKIYLG
FT                   ESKKKKPCEGRQGSASGAVEQRYENCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQ
FT                   ESRLCNLRPCDVDIQLHIKAGKKCLAVYQPEEATNFTLAGCVSTRTYRPKYCGVCTDNR
FT                   CCIPYKSKTISVDFQCPEGPGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFEEIAN
FT                   "
FT   CDS             join(17139683..17139751,17154518..17154797,
FT                   17165415..17165608,17167293..17167592)
FT                   /codon_start=1
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT171967.0
FT                   protein_id=mCP94885.0 isoform=CRA_b"
FT                   /protein_id="EDL29380.1"
FT                   /translation="MRWLLPWTLAAVAVLRVGNILATALSPTPTTMTFTPAPLEETTTR
FT                   PEFCKWPCECPQSPPRCPLGVSLITDGCECCKICAQQLGDNCTEAAICDPHRGLYCDYS
FT                   GDRPRYAIGVCAPASGAVEQRYENCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQE
FT                   SRLCNLRPCDVDIQLHIKAGKKCLAVYQPEEATNFTLAGCVSTRTYRPKYCGVCTDNRC
FT                   CIPYKSKTISVDFQCPEGPGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFEEIAN"
FT   CDS             join(<17160955..17161213,17165415..17165608,
FT                   17167293..17167592)
FT                   /codon_start=1
FT                   /gene="Wisp1"
FT                   /locus_tag="mCG_8972"
FT                   /product="WNT1 inducible signaling pathway protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG8972.2 transcript_id=mCT180770.0
FT                   protein_id=mCP103692.0 isoform=CRA_c"
FT                   /protein_id="EDL29381.1"
FT                   /translation="VVGVGCVLDGVRYTNGESFQPNCRYNCTCIDGTVGCTPLCLSPRP
FT                   PRLWCRQPRHVRVPGQCCEQWVCDDDARRPRQTALLDTRAFAASGAVEQRYENCIAYTS
FT                   PWSPCSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDIQLHIKAGKKCLAVYQPE
FT                   EATNFTLAGCVSTRTYRPKYCGVCTDNRCCIPYKSKTISVDFQCPEGPGFSRQVLWINA
FT                   CFCNLSCRNPNDIFADLESYPDFEEIAN"
FT   gene            complement(17177460..>17217772)
FT                   /locus_tag="mCG_8973"
FT                   /note="gene_id=mCG8973.2"
FT   mRNA            complement(join(17177460..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186831,17196608..17196616,17207493..17207532,
FT                   17208599..17208679,17217631..>17217772))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT174571"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174571.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(17177460..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188384,17190150..17190206,
FT                   17191203..17191289,17192142..17192202,17192914..17192976,
FT                   17194567..17194687,17196514..17196616,17207493..17207532,
FT                   17208599..17208679,17217631..17217766))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT8987"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT8987.1 created on
FT                   15-OCT-2002"
FT   mRNA            complement(join(17177460..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188313,17196527..17196616,
FT                   17207493..17207532,17208599..17208679,17217631..>17217765))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT174574"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174574.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(17177744..17177875,17196588..17196616,
FT                   17207493..17207532,17208599..17208679,17217631..17217765))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT174572"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174572.0 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(17178212..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188384,17190150..17190206,
FT                   17191203..17191289,17192142..17192202,17192914..17192976,
FT                   17194567..17194687,17196514..17196619,17207493..17207532,
FT                   17208599..17208679,17217631..17217748))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT114847"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT114847.1 created
FT                   on 15-OCT-2002"
FT   mRNA            complement(join(17178777..17178988,17196584..17196616,
FT                   17207493..17207532,17208599..17208679,17217631..17217766))
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, transcript variant mCT174573"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174573.0 created
FT                   on 15-OCT-2002"
FT   CDS             complement(join(17179005..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186831,17196608..17196616,17207493..17207532,
FT                   17208599..>17208626))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_a"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174571.0
FT                   protein_id=mCP97491.0 isoform=CRA_a"
FT                   /protein_id="EDL29383.1"
FT                   /translation="GEASGGKRGEHHWSPARVRCSGNRILDLEIERPMPGTHTVTLQCP
FT                   ALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMG
FT                   YMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARL
FT                   NITPNSGATGNNAGPKSMEVSC"
FT   CDS             complement(join(17179005..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188313,17196527..17196616,
FT                   17207493..17207532,17208599..>17208626))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_c"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174574.0
FT                   protein_id=mCP97493.0 isoform=CRA_c"
FT                   /protein_id="EDL29385.1"
FT                   /translation="GEASGGKRGEHHWSPARVRCSGNRILRPYMAPCMSPCVGPPRATV
FT                   LSSSRITTNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECN
FT                   SKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGS
FT                   SVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARLNITPNSGATGNNAGPKSME
FT                   VSC"
FT   CDS             complement(join(17179005..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188384,17190150..17190206,
FT                   17191203..17191289,17192142..17192202,17192914..17192976,
FT                   17194567..17194687,17196514..17196616,17207493..17207504))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_e"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT8987.1
FT                   protein_id=mCP3663.1 isoform=CRA_e"
FT                   /protein_id="EDL29387.1"
FT                   /translation="MFRQQDIETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNP
FT                   LFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSV
FT                   IGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDMVVS
FT                   HLFGKEEIHNNVEVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQ
FT                   CPALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQG
FT                   MGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDA
FT                   RLNITPNSGATGNNAGPKSMEVSC"
FT   CDS             complement(join(17179005..17179246,17182002..17182053,
FT                   17184391..17184426,17185336..17185383,17186005..17186056,
FT                   17186781..17186837,17188281..17188384,17190150..17190206,
FT                   17191203..17191289,17192142..17192202,17192914..17192976,
FT                   17194567..17194687,17196514..17196619,17207493..17207504))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_d"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT114847.1
FT                   protein_id=mCP60717.1 isoform=CRA_d"
FT                   /protein_id="EDL29386.1"
FT                   /translation="MFRQEQDIETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYN
FT                   PLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKS
FT                   VIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDMVV
FT                   SHLFGKEEIHNNVEVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTL
FT                   QCPALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQ
FT                   GMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSED
FT                   ARLNITPNSGATGNNAGPKSMEVSC"
FT   CDS             complement(join(17196606..17196616,17207493..17207532,
FT                   17208599..17208661))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_b"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174572.0
FT                   protein_id=mCP97490.0 isoform=CRA_b"
FT                   /protein_id="EDL29384.1"
FT                   /translation="MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQATGY"
FT   CDS             complement(join(17196606..17196616,17207493..17207532,
FT                   17208599..17208661))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8973"
FT                   /product="mCG8973, isoform CRA_b"
FT                   /note="gene_id=mCG8973.2 transcript_id=mCT174573.0
FT                   protein_id=mCP97492.0 isoform=CRA_b"
FT                   /protein_id="EDL29388.1"
FT                   /translation="MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQATGY"
FT   gene            17218255..17255989
FT                   /locus_tag="mCG_147997"
FT                   /note="gene_id=mCG147997.0"
FT   mRNA            join(17218255..17219233,17255295..17255989)
FT                   /locus_tag="mCG_147997"
FT                   /product="mCG147997"
FT                   /note="gene_id=mCG147997.0 transcript_id=mCT188260.0
FT                   created on 13-JAN-2004"
FT   gap             17248123..17248142
FT                   /estimated_length=20
FT   gap             17249243..17249262
FT                   /estimated_length=20
FT   CDS             17255300..17255446
FT                   /codon_start=1
FT                   /locus_tag="mCG_147997"
FT                   /product="mCG147997"
FT                   /note="gene_id=mCG147997.0 transcript_id=mCT188260.0
FT                   protein_id=mCP108961.0"
FT                   /protein_id="EDL29389.1"
FT                   /translation="MSGPVVASRTMASKKPTVNSPVFSLLDVTWSPQERLGLEPSEQAA
FT                   TGT"
FT   gene            complement(17349957..17357533)
FT                   /gene="St3gal1"
FT                   /locus_tag="mCG_8909"
FT                   /note="gene_id=mCG8909.1"
FT   mRNA            complement(join(17349957..17350496,17351875..17351994,
FT                   17353272..17353317,17354956..17355135,17356155..17356351,
FT                   17357231..17357533))
FT                   /gene="St3gal1"
FT                   /locus_tag="mCG_8909"
FT                   /product="ST3 beta-galactoside alpha-2,3-sialyltransferase
FT                   1"
FT                   /note="gene_id=mCG8909.1 transcript_id=mCT8746.1 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(17350323..17350496,17351875..17351994,
FT                   17353272..17353317,17354956..17355135,17356155..17356351,
FT                   17357231..17357527))
FT                   /codon_start=1
FT                   /gene="St3gal1"
FT                   /locus_tag="mCG_8909"
FT                   /product="ST3 beta-galactoside alpha-2,3-sialyltransferase
FT                   1"
FT                   /note="gene_id=mCG8909.1 transcript_id=mCT8746.1
FT                   protein_id=mCP3648.1"
FT                   /db_xref="GOA:Q544T4"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:98304"
FT                   /db_xref="UniProtKB/TrEMBL:Q544T4"
FT                   /protein_id="EDL29390.1"
FT                   /translation="MRRKTLKYLTFFLLFIFLTSFVLNYSNTGVPSAWFPKQMLLELSE
FT                   NFRRFIKSQPCTCRHCISQDKVSYWFDQRFNKTMQPLLTVHNALMEEDTYRWWLRLQRE
FT                   RKPNNLSDTVKELFRLVPGNVDPMLNKRLVGCRRCAVVGNSGNLKDSSYGPEIDSHDFV
FT                   LRMNKAPTVGFEADVGSRTTHHLVYPESFRELGENVNMVLVPFKTTDLQWVISATTTGT
FT                   ITHTYVPVPPKIKVKQEKILIYHPAFIKYVFDNWLQGHGRYPSTGILSIIFSIHICDEV
FT                   DLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDGDFEYNITTTLAAINKIRIFKGR"
FT   gap             17353812..17353889
FT                   /estimated_length=78
FT   gene            complement(17371143..>17420478)
FT                   /locus_tag="mCG_145463"
FT                   /note="gene_id=mCG145463.0"
FT   mRNA            complement(join(17371143..17372310,17396748..17396875,
FT                   17420339..>17420478))
FT                   /locus_tag="mCG_145463"
FT                   /product="mCG145463"
FT                   /note="gene_id=mCG145463.0 transcript_id=mCT184887.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(17371668..>17371955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145463"
FT                   /product="mCG145463"
FT                   /note="gene_id=mCG145463.0 transcript_id=mCT184887.0
FT                   protein_id=mCP105331.0"
FT                   /protein_id="EDL29391.1"
FT                   /translation="VHRGTRCLISLHPTSVHRGAHRHLTPRWLVWTVTLLGCFICLVFA
FT                   NWFLQSQRKALPGNNDLLTQGQPEKPNSRLKISSLLAPGGRCFVTSSSSR"
FT   gene            complement(17386433..17390373)
FT                   /locus_tag="mCG_148009"
FT                   /note="gene_id=mCG148009.0"
FT   mRNA            complement(join(17386433..17386743,17389892..17390373))
FT                   /locus_tag="mCG_148009"
FT                   /product="mCG148009"
FT                   /note="gene_id=mCG148009.0 transcript_id=mCT188272.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17389899..17390171)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148009"
FT                   /product="mCG148009"
FT                   /note="gene_id=mCG148009.0 transcript_id=mCT188272.0
FT                   protein_id=mCP108973.0"
FT                   /protein_id="EDL29392.1"
FT                   /translation="MHINTYDHAGYCYQPCDVVSIFLRLYYVPGMHSQDQWNCFQNFSH
FT                   LFAIVTLLGKEARKIGNRSWKMITRGWERDREEKPKKIPQHCEIV"
FT   gap             17406456..17406475
FT                   /estimated_length=20
FT   gap             17432370..17432473
FT                   /estimated_length=104
FT   gap             17449288..17449342
FT                   /estimated_length=55
FT   gap             17455397..17455748
FT                   /estimated_length=352
FT   gap             17456425..17456908
FT                   /estimated_length=484
FT   gene            <17470725..17618118
FT                   /locus_tag="mCG_8910"
FT                   /note="gene_id=mCG8910.1"
FT   mRNA            join(<17470725..17471038,17483499..17483578,
FT                   17495013..17495054,17495560..17495605,17528618..17528682,
FT                   17577787..17577883,17578640..17578749,17613886..17613992,
FT                   17617937..17618118)
FT                   /locus_tag="mCG_8910"
FT                   /product="mCG8910"
FT                   /note="gene_id=mCG8910.1 transcript_id=mCT8747.2 created on
FT                   15-OCT-2002"
FT   gap             17477891..17477910
FT                   /estimated_length=20
FT   CDS             join(<17483503..17483578,17495013..17495054,
FT                   17495560..17495605,17528618..17528669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8910"
FT                   /product="mCG8910"
FT                   /note="gene_id=mCG8910.1 transcript_id=mCT8747.2
FT                   protein_id=mCP3653.2"
FT                   /protein_id="EDL29393.1"
FT                   /translation="RFGKHTHRDGSFLGRGKYCCVMHFLESLCEAPGLGFTEAGLTIRQ
FT                   WTSSWCALPGHKSKLTFLDLCSNWGL"
FT   gap             17496786..17496805
FT                   /estimated_length=20
FT   gap             17498908..17499435
FT                   /estimated_length=528
FT   gap             17502846..17504388
FT                   /estimated_length=1543
FT   gap             17509658..17513702
FT                   /estimated_length=4045
FT   gap             17548557..17548630
FT                   /estimated_length=74
FT   gap             17550384..17553044
FT                   /estimated_length=2661
FT   gap             17561607..17570823
FT                   /estimated_length=9217
FT   gap             17578394..17578619
FT                   /estimated_length=226
FT   gap             17602188..17602207
FT                   /estimated_length=20
FT   gap             17609408..17609739
FT                   /estimated_length=332
FT   gap             17624799..17624818
FT                   /estimated_length=20
FT   gap             17651611..17651630
FT                   /estimated_length=20
FT   gap             17654011..17654030
FT                   /estimated_length=20
FT   gap             17655502..17655521
FT                   /estimated_length=20
FT   gap             17690668..17690770
FT                   /estimated_length=103
FT   gap             17702156..17702175
FT                   /estimated_length=20
FT   gap             17715699..17715718
FT                   /estimated_length=20
FT   gap             17764714..17764737
FT                   /estimated_length=24
FT   gap             17799043..17799585
FT                   /estimated_length=543
FT   gap             17887094..17890739
FT                   /estimated_length=3646
FT   gap             17915785..17917282
FT                   /estimated_length=1498
FT   gap             17927218..17927277
FT                   /estimated_length=60
FT   gap             17937596..17938420
FT                   /estimated_length=825
FT   gap             17977393..17977412
FT                   /estimated_length=20
FT   gap             17983380..17983591
FT                   /estimated_length=212
FT   gap             18038819..18038838
FT                   /estimated_length=20
FT   gap             18070641..18070660
FT                   /estimated_length=20
FT   gap             18084902..18085080
FT                   /estimated_length=179
FT   gap             18114486..18114976
FT                   /estimated_length=491
FT   gap             18177912..18178053
FT                   /estimated_length=142
FT   gap             18183360..18183379
FT                   /estimated_length=20
FT   gap             18185820..18185941
FT                   /estimated_length=122
FT   gap             18198531..18199042
FT                   /estimated_length=512
FT   gap             18263104..18263681
FT                   /estimated_length=578
FT   gap             18264695..18269087
FT                   /estimated_length=4393
FT   gap             18290416..18290748
FT                   /estimated_length=333
FT   gap             18294226..18294458
FT                   /estimated_length=233
FT   gap             18307291..18307460
FT                   /estimated_length=170
FT   gap             18310308..18310330
FT                   /estimated_length=23
FT   gap             18312976..18312995
FT                   /estimated_length=20
FT   gene            complement(18314962..18491661)
FT                   /gene="Zfp406"
FT                   /locus_tag="mCG_120647"
FT                   /note="gene_id=mCG120647.2"
FT   mRNA            complement(join(18314962..18315754,18332664..18332794,
FT                   18336138..18336261,18341659..18341744,18350125..18350263,
FT                   18379106..18379194,18398437..18398610,18401399..18401548,
FT                   18402820..18402907,18411398..18411630,18412404..18413845,
FT                   18417108..18417258,18419741..18419926,18445563..18445793,
FT                   18457718..18457894,18491475..>18491654))
FT                   /gene="Zfp406"
FT                   /locus_tag="mCG_120647"
FT                   /product="zinc finger protein 406, transcript variant
FT                   mCT192602"
FT                   /note="gene_id=mCG120647.2 transcript_id=mCT192602.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(<18315515..18315754,18332664..18332794,
FT                   18336138..18336261,18341626..18341744,18350125..18350263,
FT                   18379106..18379194,18398437..18398610,18401399..18401548,
FT                   18402820..18402907,18411398..18411630,18412404..18413845,
FT                   18417108..18417258,18419741..18419926,18445542..18445793,
FT                   18457718..18457894,18491475..18491661))
FT                   /gene="Zfp406"
FT                   /locus_tag="mCG_120647"
FT                   /product="zinc finger protein 406, transcript variant
FT                   mCT121838"
FT                   /note="gene_id=mCG120647.2 transcript_id=mCT121838.1
FT                   created on 13-NOV-2002"
FT   CDS             complement(join(18315515..18315754,18332664..18332794,
FT                   18336138..18336261,18341659..18341744,18350125..18350263,
FT                   18379106..18379194,18398437..18398610,18401399..18401548,
FT                   18402820..18402907,18411398..18411630,18412404..18413845,
FT                   18417108..18417258,18419741..18419926,18445563..18445793,
FT                   18457718..18457894,18491475..>18491652))
FT                   /codon_start=1
FT                   /gene="Zfp406"
FT                   /locus_tag="mCG_120647"
FT                   /product="zinc finger protein 406, isoform CRA_b"
FT                   /note="gene_id=mCG120647.2 transcript_id=mCT192602.0
FT                   protein_id=mCP113554.0 isoform=CRA_b"
FT                   /protein_id="EDL29395.1"
FT                   /translation="WMPQIRHNLSGSFPKKIKIKSEVSSGCPTFSLSPGGSREEPEAFF
FT                   FLRRGGVAMETRTAENTAIFMCKCCNLFSPNQSELVTHVSEKHGEEGVNVDDVIIPLRP
FT                   LNTPENPNPSKGGDEFLVMKRKRGRPKGSTKKPSTEEEVVENLVSPSEDGPLATEEGSR
FT                   LAPSSLECSKCCRKFSNTRQLRKHICIIVLNLGNESDLDLEKTYKEDDREKASKRPRAQ
FT                   KTEKVQKISGKEAGQLSGAKKPIISVVLTAHEAIPGATKIIPVEAGPPETGAPPPETTA
FT                   ADLVPRRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHT
FT                   NEKPYKCSQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIK
FT                   QHCRFCKKKYSDVKNLIKHIRDMHDPQDKKVKEALDELRLMTREGKRQLLYDCHICERK
FT                   FKNELDRDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCALCLKKFVSSI
FT                   RLRSHIREVHGAAQETLVFTSSINQSFCLLEPGGDIQQEALGDQLQLAAEEFVCPEIDV
FT                   RKEEACPGEAQPEVGLRELVVPGDAHAPPPGPLATPQSESSSLSPCKLETTVVSSDLNS
FT                   LGVVSDDFLLKSDTSSAEPPAAAEATSDTQHRDSAQTQGEEVTLLLAKAKSAGPDPESS
FT                   PGGRQKVGALPASESDSSTCLRANPTEASDLLPTVTDGGDLGVCQPDSCTPSSEHHPGS
FT                   TAFMKVLDSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYY
FT                   CSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSY
FT                   SCPVCEKSFSEDRLIKSHIKTNHPEVSMNTISEVLGRRVQLKGLIGKRAMKCPYCDFYF
FT                   MKNGSDLQRHIWAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKS
FT                   KGTLKSHKLLHTSDGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISG
FT                   SLKRHYNRKHPNEEYTNVGSGELAAEALIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGL
FT                   KPAAETPEEPSTQYLYITEAEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIE
FT                   LGSETHDAAAVASVVAMAPGTVTVVKQVTDEEPSSNHTVMIQETLQQASVELAEQHHLV
FT                   VSSDDVEGIETVTVYTQGGEASEFIVYVQEAVQPVEEQVGEQPAPEL"
FT   CDS             complement(join(18315515..18315754,18332664..18332794,
FT                   18336138..18336261,18341626..18341744,18350125..18350263,
FT                   18379106..18379194,18398437..18398610,18401399..18401548,
FT                   18402820..18402907,18411398..18411630,18412404..18413845,
FT                   18417108..18417258,18419741..18419926,18445542..18445793,
FT                   18457718..18457894,18491475..18491649))
FT                   /codon_start=1
FT                   /gene="Zfp406"
FT                   /locus_tag="mCG_120647"
FT                   /product="zinc finger protein 406, isoform CRA_a"
FT                   /note="gene_id=mCG120647.2 transcript_id=mCT121838.1
FT                   protein_id=mCP60684.1 isoform=CRA_a"
FT                   /protein_id="EDL29394.1"
FT                   /translation="MPQIRHNLSGSFPKKIKIKSEVSSGCPTFSLSPGGSREEPEAFFF
FT                   LRRGGVAMETRTAENTAIFMCKCCNLFSPNQSELVTHVSEKHGEEGVNVDDVIIPLRPL
FT                   NTPENPNPSKGGDEFLVMKRKRGRPKGSTKKPSTEEEVVENLVSPSEDGPLATEEGSRL
FT                   APSSLECSKCCRKFSNTRQLRKHICIIVLNLGEEDGDAGNESDLDLEKTYKEDDREKAS
FT                   KRPRAQKTEKVQKISGKEAGQLSGAKKPIISVVLTAHEAIPGATKIIPVEAGPPETGAP
FT                   PPETTAADLVPRRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQA
FT                   HLRIHTNEKPYKCSQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIER
FT                   VHKKIKQHCRFCKKKYSDVKNLIKHIRDMHDPQDKKVKEALDELRLMTREGKRQLLYDC
FT                   HICERKFKNELDRDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCALCLK
FT                   KFVSSIRLRSHIREVHGAAQETLVFTSSINQSFCLLEPGGDIQQEALGDQLQLAAEEFV
FT                   CPEIDVRKEEACPGEAQPEVGLRELVVPGDAHAPPPGPLATPQSESSSLSPCKLETTVV
FT                   SSDLNSLGVVSDDFLLKSDTSSAEPPAAAEATSDTQHRDSAQTQGEEVTLLLAKAKSAG
FT                   PDPESSPGGRQKVGALPASESDSSTCLRANPTEASDLLPTVTDGGDLGVCQPDSCTPSS
FT                   EHHPGSTAFMKVLDSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHT
FT                   REHLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTE
FT                   LDKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSMNTISEVLGRRVQLKGLIGKRAMKCP
FT                   YCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMC
FT                   GKKFKSKGTLKSHKLLHTSDGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHY
FT                   SCNISGSLKRHYNRKHPNEEYTNVGSGELAAEALIQQGGLKCPVCSFVYGTKWEFNRHL
FT                   KNKHGLKVVEIDGDPKWEPAAETPEEPSTQYLYITEAEDVQGTQAAVAALQDLRYTSES
FT                   GDRLDPTAVNILQQIIELGSETHDAAAVASVVAMAPGTVTVVKQVTDEEPSSNHTVMIQ
FT                   ETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQGGEASEFIVYVQEAVQPVEEQVGEQ
FT                   PAPEL"
FT   gap             18349103..18349232
FT                   /estimated_length=130
FT   gap             18359970..18359989
FT                   /estimated_length=20
FT   gap             18361527..18361546
FT                   /estimated_length=20
FT   gap             18376254..18376290
FT                   /estimated_length=37
FT   gap             18379657..18379914
FT                   /estimated_length=258
FT   gap             18387418..18387437
FT                   /estimated_length=20
FT   gap             18444966..18445514
FT                   /estimated_length=549
FT   gap             18459661..18459680
FT                   /estimated_length=20
FT   gap             18462800..18463026
FT                   /estimated_length=227
FT   gap             18468025..18468044
FT                   /estimated_length=20
FT   gap             18491441..18491460
FT                   /estimated_length=20
FT   gap             18516638..18517070
FT                   /estimated_length=433
FT   gene            18541318..18541877
FT                   /locus_tag="mCG_120646"
FT                   /note="gene_id=mCG120646.0"
FT   mRNA            18541318..18541877
FT                   /locus_tag="mCG_120646"
FT                   /product="mCG120646"
FT                   /note="gene_id=mCG120646.0 transcript_id=mCT121837.0
FT                   created on 13-NOV-2002"
FT   CDS             18541353..18541835
FT                   /codon_start=1
FT                   /locus_tag="mCG_120646"
FT                   /product="mCG120646"
FT                   /note="gene_id=mCG120646.0 transcript_id=mCT121837.0
FT                   protein_id=mCP60683.1"
FT                   /db_xref="GOA:Q9CQM8"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="MGI:MGI:1278340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQM8"
FT                   /protein_id="EDL29396.1"
FT                   /translation="MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGM
FT                   GTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDS
FT                   FLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   gene            18575295..18578494
FT                   /locus_tag="mCG_147996"
FT                   /note="gene_id=mCG147996.0"
FT   mRNA            join(18575295..18575396,18575409..18578494)
FT                   /locus_tag="mCG_147996"
FT                   /product="mCG147996"
FT                   /note="gene_id=mCG147996.0 transcript_id=mCT188259.0
FT                   created on 13-JAN-2004"
FT   CDS             18576853..18577053
FT                   /codon_start=1
FT                   /locus_tag="mCG_147996"
FT                   /product="mCG147996"
FT                   /note="gene_id=mCG147996.0 transcript_id=mCT188259.0
FT                   protein_id=mCP108960.0"
FT                   /protein_id="EDL29397.1"
FT                   /translation="MPYLQILVLWILKFRKSFVDKRYYFKKGRLWSTEMGSKKYKCEHS
FT                   LYGRQEVSFLLIKTLQNRLKS"
FT   gap             18579072..18579091
FT                   /estimated_length=20
FT   gap             18594073..18594629
FT                   /estimated_length=557
FT   gap             18602603..18603236
FT                   /estimated_length=634
FT   gap             18612291..18612348
FT                   /estimated_length=58
FT   gap             18624572..18624694
FT                   /estimated_length=123
FT   gap             18630428..18630541
FT                   /estimated_length=114
FT   gap             18653467..18653486
FT                   /estimated_length=20
FT   gap             18656055..18660789
FT                   /estimated_length=4735
FT   gap             18672814..18672833
FT                   /estimated_length=20
FT   gap             18727423..18727442
FT                   /estimated_length=20
FT   gap             18731046..18731391
FT                   /estimated_length=346
FT   gap             18772101..18776387
FT                   /estimated_length=4287
FT   gap             18777582..18777601
FT                   /estimated_length=20
FT   gap             18779430..18779449
FT                   /estimated_length=20
FT   gap             18781085..18781104
FT                   /estimated_length=20
FT   gap             18810479..18810872
FT                   /estimated_length=394
FT   gap             18852214..18852233
FT                   /estimated_length=20
FT   gap             18862872..18864682
FT                   /estimated_length=1811
FT   gap             18865574..18865920
FT                   /estimated_length=347
FT   gap             18867781..18868414
FT                   /estimated_length=634
FT   gap             18869608..18869820
FT                   /estimated_length=213
FT   gap             18876060..18877185
FT                   /estimated_length=1126
FT   gap             18880553..18880572
FT                   /estimated_length=20
FT   gap             18891857..18891891
FT                   /estimated_length=35
FT   gap             18892592..18892675
FT                   /estimated_length=84
FT   gap             18908538..18908557
FT                   /estimated_length=20
FT   gap             18914373..18914419
FT                   /estimated_length=47
FT   gene            complement(18950815..18951639)
FT                   /locus_tag="mCG_14627"
FT                   /note="gene_id=mCG14627.0"
FT   mRNA            complement(18950815..18951639)
FT                   /locus_tag="mCG_14627"
FT                   /product="mCG14627"
FT                   /note="gene_id=mCG14627.0 transcript_id=mCT19085.0 created
FT                   on 13-NOV-2002"
FT   CDS             complement(18950941..18951486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14627"
FT                   /product="mCG14627"
FT                   /note="gene_id=mCG14627.0 transcript_id=mCT19085.0
FT                   protein_id=mCP7184.1"
FT                   /protein_id="EDL29398.1"
FT                   /translation="MFIQTQDTPNPNSLKFIPGKRVLETRTMDFSTPAAAFRSPLARQL
FT                   FRIEGVKSVFFGPDFITVTKENGELDWNLLKPDIHATIMDFFASGLPLVTEETPPPPGE
FT                   AGSEEDDGVVAMIKELLDTRIRPTVQEDGGDVIYRAFEDGIVRLKLQGSCPSCPSSIIT
FT                   LKSGIRTCCSFIFQKWKV"
FT   gene            <18991378..18996690
FT                   /locus_tag="mCG_145470"
FT                   /note="gene_id=mCG145470.0"
FT   mRNA            join(<18991378..18991798,18992520..18992632,
FT                   18995932..18996690)
FT                   /locus_tag="mCG_145470"
FT                   /product="mCG145470"
FT                   /note="gene_id=mCG145470.0 transcript_id=mCT184894.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<18992567..18992632,18995932..18996186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145470"
FT                   /product="mCG145470"
FT                   /note="gene_id=mCG145470.0 transcript_id=mCT184894.0
FT                   protein_id=mCP105338.0"
FT                   /protein_id="EDL29399.1"
FT                   /translation="QSRTKRQLSSFQTILLLPNTAMAAVLTEVTNVSSTVEAKVDCEED
FT                   NVNQTDAALPEGRGIHVTLEPHLSGILLFFILLSSLLQLWFILGEKLWLVYKLSKWRDS
FT                   LL"
FT   gap             19011935..19011954
FT                   /estimated_length=20
FT   gap             19032094..19032113
FT                   /estimated_length=20
FT   gap             19036169..19036588
FT                   /estimated_length=420
FT   gap             19079470..19079521
FT                   /estimated_length=52
FT   gene            19112503..19113669
FT                   /locus_tag="mCG_14628"
FT                   /note="gene_id=mCG14628.2"
FT   mRNA            19112503..19113669
FT                   /locus_tag="mCG_14628"
FT                   /product="mCG14628"
FT                   /note="gene_id=mCG14628.2 transcript_id=mCT19086.2 created
FT                   on 16-DEC-2002"
FT   CDS             19112601..19112873
FT                   /codon_start=1
FT                   /locus_tag="mCG_14628"
FT                   /product="mCG14628"
FT                   /note="gene_id=mCG14628.2 transcript_id=mCT19086.2
FT                   protein_id=mCP7193.2"
FT                   /protein_id="EDL29400.1"
FT                   /translation="MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAP
FT                   AKKGEKVPKGKKGKANAGKDANNPAENGDAKTDQAQKAEGAGDAK"
FT   gap             19121588..19127808
FT                   /estimated_length=6221
FT   gap             19144036..19146187
FT                   /estimated_length=2152
FT   gap             19161953..19162078
FT                   /estimated_length=126
FT   gene            19163580..19337481
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /note="gene_id=mCG14624.2"
FT   mRNA            join(19163580..19163685,19230448..19230566,
FT                   19248790..19248906,19252849..19252907,19260267..19260406,
FT                   19264974..19265170,19329217..19329365,19330776..19330832,
FT                   19337257..19337481)
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, transcript variant mCT172043"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT172043.0 created
FT                   on 12-AUG-2002"
FT   mRNA            join(19163580..19163685,19230448..19230566,
FT                   19248790..19248906,19252761..19252907,19260267..19260406,
FT                   19264974..19265169,19284637..19284719,19327450..19327508,
FT                   19329217..19329365,19330776..19330832,19337257..19337359)
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, transcript variant mCT172042"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT172042.0 created
FT                   on 12-AUG-2002"
FT   mRNA            join(19163580..19163685,19230448..19230566,
FT                   19248790..19248906,19252761..19252907,19260267..19260406,
FT                   19264974..19265169,19284637..19284719,19327450..19327508,
FT                   19329217..19329832)
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, transcript variant mCT19082"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT19082.1 created
FT                   on 12-AUG-2002"
FT   gap             19163686..19164002
FT                   /estimated_length=317
FT   gap             19169356..19169375
FT                   /estimated_length=20
FT   gap             19215092..19218931
FT                   /estimated_length=3840
FT   CDS             join(19230519..19230566,19248790..19248906,
FT                   19252761..19252907,19260267..19260406,19264974..19265169,
FT                   19284637..19284719,19327450..19327508,19329217..19329308)
FT                   /codon_start=1
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, isoform CRA_a"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT172042.0
FT                   protein_id=mCP94961.0 isoform=CRA_a"
FT                   /protein_id="EDL29401.1"
FT                   /translation="MKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSIL
FT                   GKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIP
FT                   DYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRGVTTPAITRGRGGVTARPVAV
FT                   GVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGY
FT                   GTAYDEQSYDSYDNSYSTPAQSAADYYDYGHGLSEDAYDSYGQEEWTNSRHKAPSARTA
FT                   KGVYRDQPYGRY"
FT   CDS             join(19230519..19230566,19248790..19248906,
FT                   19252761..19252907,19260267..19260406,19264974..19265169,
FT                   19284637..19284719,19327450..19327508,19329217..19329308)
FT                   /codon_start=1
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, isoform CRA_a"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT19082.1
FT                   protein_id=mCP7195.2 isoform=CRA_a"
FT                   /protein_id="EDL29403.1"
FT                   /translation="MKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSIL
FT                   GKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIP
FT                   DYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRGVTTPAITRGRGGVTARPVAV
FT                   GVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGY
FT                   GTAYDEQSYDSYDNSYSTPAQSAADYYDYGHGLSEDAYDSYGQEEWTNSRHKAPSARTA
FT                   KGVYRDQPYGRY"
FT   gap             19238245..19238264
FT                   /estimated_length=20
FT   CDS             join(19252866..19252907,19260267..19260406,
FT                   19264974..19265170,19329217..19329308)
FT                   /codon_start=1
FT                   /gene="Khdrbs3"
FT                   /locus_tag="mCG_14624"
FT                   /product="KH domain containing, RNA binding, signal
FT                   transduction associated 3, isoform CRA_b"
FT                   /note="gene_id=mCG14624.2 transcript_id=mCT172043.0
FT                   protein_id=mCP94962.0 isoform=CRA_b"
FT                   /protein_id="EDL29402.1"
FT                   /translation="MGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRG
FT                   KSTLRTRGVTTPAITRGRGGVTARPVAVGVPRGTPTPRGVLSTRGPVSRGRGLLTPRAR
FT                   GVPPTGYRPPPPPPTQETYGEYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY"
FT   gap             19256503..19256675
FT                   /estimated_length=173
FT   gap             19305622..19305641
FT                   /estimated_length=20
FT   gap             19357190..19357209
FT                   /estimated_length=20
FT   gap             19358479..19358498
FT                   /estimated_length=20
FT   gap             19361071..19361090
FT                   /estimated_length=20
FT   gap             19363801..19364057
FT                   /estimated_length=257
FT   gap             19365202..19365221
FT                   /estimated_length=20
FT   gap             19366471..19368444
FT                   /estimated_length=1974
FT   gap             19370339..19370358
FT                   /estimated_length=20
FT   gap             19378620..19378639
FT                   /estimated_length=20
FT   gap             19385168..19385187
FT                   /estimated_length=20
FT   gap             19395271..19396441
FT                   /estimated_length=1171
FT   gap             19399051..19399070
FT                   /estimated_length=20
FT   gap             19400267..19400286
FT                   /estimated_length=20
FT   gap             19404738..19404814
FT                   /estimated_length=77
FT   gap             19448039..19449200
FT                   /estimated_length=1162
FT   gap             19450958..19453372
FT                   /estimated_length=2415
FT   gap             19501544..19501644
FT                   /estimated_length=101
FT   gap             19503148..19503167
FT                   /estimated_length=20
FT   gene            <19507758..>19511947
FT                   /locus_tag="mCG_146027"
FT                   /note="gene_id=mCG146027.0"
FT   mRNA            join(<19507758..19507869,19509387..19509710,
FT                   19511279..>19511947)
FT                   /locus_tag="mCG_146027"
FT                   /product="mCG146027"
FT                   /note="gene_id=mCG146027.0 transcript_id=mCT186135.0
FT                   created on 04-JUL-2003"
FT   CDS             <19511584..>19511947
FT                   /codon_start=1
FT                   /locus_tag="mCG_146027"
FT                   /product="mCG146027"
FT                   /note="gene_id=mCG146027.0 transcript_id=mCT186135.0
FT                   protein_id=mCP107365.0"
FT                   /protein_id="EDL29404.1"
FT                   /translation="SACGFPSTEGRVKSPGILVLSAFPYSEFAFALVSSDHTDCGLLLT
FT                   LSDRREQMSLLCFSQFALIRSNQGNGAAAGLCGEIKLPLAFVLPEPRSCCNPEGGLHPS
FT                   WPRCNFLRQAIKADTAG"
FT   gap             19566692..19566711
FT                   /estimated_length=20
FT   gap             19622416..19622535
FT                   /estimated_length=120
FT   gap             19624379..19624398
FT                   /estimated_length=20
FT   gap             19673189..19673289
FT                   /estimated_length=101
FT   gap             19710327..19710495
FT                   /estimated_length=169
FT   gap             19717334..19717360
FT                   /estimated_length=27
FT   gap             19744579..19744598
FT                   /estimated_length=20
FT   gap             19780573..19780592
FT                   /estimated_length=20
FT   gap             19817835..19817854
FT                   /estimated_length=20
FT   gap             19882550..19882569
FT                   /estimated_length=20
FT   gap             19901493..19901548
FT                   /estimated_length=56
FT   gap             19919125..19919144
FT                   /estimated_length=20
FT   gap             19980455..19980474
FT                   /estimated_length=20
FT   gap             20025623..20025728
FT                   /estimated_length=106
FT   gap             20058149..20058168
FT                   /estimated_length=20
FT   gap             20074593..20075221
FT                   /estimated_length=629
FT   gap             20107889..20108036
FT                   /estimated_length=148
FT   gap             20142731..20143108
FT                   /estimated_length=378
FT   gap             20157015..20157034
FT                   /estimated_length=20
FT   gap             20161259..20161325
FT                   /estimated_length=67
FT   gap             20164257..20164386
FT                   /estimated_length=130
FT   gap             20168718..20182037
FT                   /estimated_length=13320
FT   gap             20276689..20276708
FT                   /estimated_length=20
FT   gap             20313434..20318366
FT                   /estimated_length=4933
FT   gap             20323224..20323243
FT                   /estimated_length=20
FT   gap             20343780..20344608
FT                   /estimated_length=829
FT   gap             20355336..20355355
FT                   /estimated_length=20
FT   gap             20363284..20363303
FT                   /estimated_length=20
FT   gap             20364542..20364965
FT                   /estimated_length=424
FT   gap             20367435..20367454
FT                   /estimated_length=20
FT   gap             20368548..20368567
FT                   /estimated_length=20
FT   gap             20369825..20369844
FT                   /estimated_length=20
FT   gap             20374958..20374977
FT                   /estimated_length=20
FT   gap             20384171..20384190
FT                   /estimated_length=20
FT   gap             20394043..20394062
FT                   /estimated_length=20
FT   gap             20461265..20461284
FT                   /estimated_length=20
FT   gap             20464263..20464586
FT                   /estimated_length=324
FT   gap             20468074..20468493
FT                   /estimated_length=420
FT   gap             20472108..20474916
FT                   /estimated_length=2809
FT   gap             20476349..20476368
FT                   /estimated_length=20
FT   gap             20479771..20481235
FT                   /estimated_length=1465
FT   gap             20484997..20485016
FT                   /estimated_length=20
FT   gap             20486125..20486541
FT                   /estimated_length=417
FT   gap             20490030..20496515
FT                   /estimated_length=6486
FT   gap             20507715..20507918
FT                   /estimated_length=204
FT   gap             20546865..20549540
FT                   /estimated_length=2676
FT   gap             20550761..20550868
FT                   /estimated_length=108
FT   gap             20589424..20589443
FT                   /estimated_length=20
FT   gap             20601621..20602820
FT                   /estimated_length=1200
FT   gap             20604106..20605651
FT                   /estimated_length=1546
FT   gap             20606919..20607198
FT                   /estimated_length=280
FT   gap             20609983..20610002
FT                   /estimated_length=20
FT   gap             20611009..20615173
FT                   /estimated_length=4165
FT   gap             20625849..20626111
FT                   /estimated_length=263
FT   gap             20642501..20643139
FT                   /estimated_length=639
FT   gap             20645199..20645218
FT                   /estimated_length=20
FT   gap             20646420..20646439
FT                   /estimated_length=20
FT   gap             20647896..20647985
FT                   /estimated_length=90
FT   gap             20670013..20670445
FT                   /estimated_length=433
FT   gap             20680602..20681338
FT                   /estimated_length=737
FT   gap             20682473..20682673
FT                   /estimated_length=201
FT   gap             20683951..20683970
FT                   /estimated_length=20
FT   gap             20685036..20688098
FT                   /estimated_length=3063
FT   gap             20691895..20691914
FT                   /estimated_length=20
FT   gap             20693041..20693060
FT                   /estimated_length=20
FT   gap             20694757..20696459
FT                   /estimated_length=1703
FT   gap             20697529..20699497
FT                   /estimated_length=1969
FT   gap             20708410..20708748
FT                   /estimated_length=339
FT   gap             20712906..20712925
FT                   /estimated_length=20
FT   gap             20714382..20714401
FT                   /estimated_length=20
FT   gap             20716126..20716145
FT                   /estimated_length=20
FT   gap             20733963..20735125
FT                   /estimated_length=1163
FT   gap             20755233..20755280
FT                   /estimated_length=48
FT   gap             20766348..20766367
FT                   /estimated_length=20
FT   gap             20766918..20767861
FT                   /estimated_length=944
FT   gap             20782682..20782701
FT                   /estimated_length=20
FT   gap             20783970..20784801
FT                   /estimated_length=832
FT   gap             20804867..20804886
FT                   /estimated_length=20
FT   gap             20873312..20873331
FT                   /estimated_length=20
FT   gap             20899288..20906488
FT                   /estimated_length=7201
FT   gap             20942207..20944027
FT                   /estimated_length=1821
FT   gap             20967579..20968266
FT                   /estimated_length=688
FT   gap             21032921..21032940
FT                   /estimated_length=20
FT   gap             21070216..21070238
FT                   /estimated_length=23
FT   gap             21073948..21074156
FT                   /estimated_length=209
FT   gap             21087551..21087819
FT                   /estimated_length=269
FT   gap             21090049..21094987
FT                   /estimated_length=4939
FT   gap             21096165..21096184
FT                   /estimated_length=20
FT   gap             21108739..21108758
FT                   /estimated_length=20
FT   gap             21110071..21110090
FT                   /estimated_length=20
FT   gap             21112319..21112338
FT                   /estimated_length=20
FT   gap             21115510..21115529
FT                   /estimated_length=20
FT   gap             21124685..21124704
FT                   /estimated_length=20
FT   gap             21126221..21126836
FT                   /estimated_length=616
FT   gap             21128307..21128326
FT                   /estimated_length=20
FT   gap             21129636..21129655
FT                   /estimated_length=20
FT   gap             21131247..21131669
FT                   /estimated_length=423
FT   gap             21132872..21132976
FT                   /estimated_length=105
FT   gap             21134149..21134259
FT                   /estimated_length=111
FT   gap             21141676..21142039
FT                   /estimated_length=364
FT   gap             21146079..21146098
FT                   /estimated_length=20
FT   gap             21178285..21178481
FT                   /estimated_length=197
FT   gap             21221774..21221793
FT                   /estimated_length=20
FT   gap             21228030..21228049
FT                   /estimated_length=20
FT   gap             21232874..21233657
FT                   /estimated_length=784
FT   gap             21255000..21255168
FT                   /estimated_length=169
FT   gap             21264029..21264323
FT                   /estimated_length=295
FT   gap             21264681..21264802
FT                   /estimated_length=122
FT   gap             21337289..21337454
FT                   /estimated_length=166
FT   gap             21340369..21340388
FT                   /estimated_length=20
FT   gap             21351136..21351181
FT                   /estimated_length=46
FT   gap             21359434..21359799
FT                   /estimated_length=366
FT   gap             21362613..21363031
FT                   /estimated_length=419
FT   gap             21364595..21367645
FT                   /estimated_length=3051
FT   gap             21404610..21404629
FT                   /estimated_length=20
FT   gap             21455199..21455218
FT                   /estimated_length=20
FT   gap             21485756..21485775
FT                   /estimated_length=20
FT   gap             21493633..21497657
FT                   /estimated_length=4025
FT   gap             21499273..21499292
FT                   /estimated_length=20
FT   gap             21501301..21501320
FT                   /estimated_length=20
FT   gap             21502492..21505609
FT                   /estimated_length=3118
FT   gap             21528007..21529264
FT                   /estimated_length=1258
FT   gap             21536826..21539831
FT                   /estimated_length=3006
FT   gap             21547533..21547552
FT                   /estimated_length=20
FT   gap             21555226..21555245
FT                   /estimated_length=20
FT   gap             21593458..21593751
FT                   /estimated_length=294
FT   gap             21624762..21624781
FT                   /estimated_length=20
FT   gap             21627142..21627161
FT                   /estimated_length=20
FT   gene            complement(21669643..>21945445)
FT                   /locus_tag="mCG_120272"
FT                   /note="gene_id=mCG120272.2"
FT   mRNA            complement(join(21669643..21670658,21673223..21673336,
FT                   21674975..21675085,21676888..21677039,21678403..21678500,
FT                   21684395..21684562,21696243..21696397,21702932..21703005,
FT                   21703742..21703897,21712782..21712831,21715429..21715594,
FT                   21750135..21750308,21753632..21753702,21757356..21757495,
FT                   21785471..21785550,21846613..21846708,21945275..>21945442))
FT                   /locus_tag="mCG_120272"
FT                   /product="mCG120272, transcript variant mCT121459"
FT                   /note="gene_id=mCG120272.2 transcript_id=mCT121459.1
FT                   created on 15-OCT-2002"
FT   gap             21681503..21681769
FT                   /estimated_length=267
FT   CDS             complement(join(21684525..21684562,21696243..21696397,
FT                   21702932..21703005,21703742..21703897,21712782..21712831,
FT                   21715429..21715594,21750135..21750308,21753632..>21753637))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120272"
FT                   /product="mCG120272, isoform CRA_a"
FT                   /note="gene_id=mCG120272.2 transcript_id=mCT121459.1
FT                   protein_id=mCP60455.1 isoform=CRA_a"
FT                   /protein_id="EDL29405.1"
FT                   /translation="AAAERCDWDTDDQQPHTWSALPPEEGSAPPGPCHVRLLPPVSDLS
FT                   GHTCCAGGSAAAPDQLSLQGSFYVPSENCIQHAHKWHRDLCLLLLHAYQGLRLYFLVIM
FT                   RDIPELPTMELEALAVEETLSQLCSELQMLNNPEKIAEQISKDLAWLASHLMALWTQFL
FT                   DTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYMEHQKLAVLTFQENLIQTHSQLSLDIRN
FT                   SEYLTSMPPLPAECLDIDGDWNTLPVIFEDRYVDCPVSVFIRPKKSLKKN"
FT   mRNA            complement(join(21712156..21712831,21715429..21715582,
FT                   21744488..21744614,21750135..21750308,21753632..21753702,
FT                   21757356..21757495,21785471..21785550,21846613..21846708,
FT                   21945275..>21945445))
FT                   /locus_tag="mCG_120272"
FT                   /product="mCG120272, transcript variant mCT192626"
FT                   /note="gene_id=mCG120272.2 transcript_id=mCT192626.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(21712686..21712831,21715429..21715582,
FT                   21744488..21744614,21750135..21750308,21753632..21753702,
FT                   21757356..21757495,21785471..21785550,21846613..>21846701))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120272"
FT                   /product="mCG120272, isoform CRA_b"
FT                   /note="gene_id=mCG120272.2 transcript_id=mCT192626.0
FT                   protein_id=mCP113553.0 isoform=CRA_b"
FT                   /protein_id="EDL29406.1"
FT                   /translation="TKKIMSEVQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIP
FT                   HRLSASIVGQSESSSLHSACVHESAVHSRVFQILYRNEEVSINDAMLFRVHLLLDGERV
FT                   EDALSEVEFQLKVDLHFTDSEQQLRDVTGTPMISSRTLGLHFHPRRGLHHQVPVMFDYF
FT                   HLSVISVAIHAALVALQQPLISFTRPGRGSWLGKGGPDTGPEQPTISLENLVFGAGYCK
FT                   PTSSEGSFYVPSENCIQHAHKWHRDLCLLLLHAYQGLRLYFLVIMRDIPELPTMELEAL
FT                   AVEETLSQLCSELQVIIVQTPSLNRWKYLQCGIKLVLLATQHVSH"
FT   gap             21713209..21713228
FT                   /estimated_length=20
FT   gap             21720634..21720653
FT                   /estimated_length=20
FT   gap             21732915..21732934
FT                   /estimated_length=20
FT   gap             21748516..21748551
FT                   /estimated_length=36
FT   gap             21808491..21808652
FT                   /estimated_length=162
FT   gap             21810643..21814224
FT                   /estimated_length=3582
FT   gap             21824827..21826061
FT                   /estimated_length=1235
FT   gap             21828828..21828847
FT                   /estimated_length=20
FT   gap             21847016..21847035
FT                   /estimated_length=20
FT   gap             21875085..21877367
FT                   /estimated_length=2283
FT   gap             21905455..21905474
FT                   /estimated_length=20
FT   gap             21932526..21932545
FT                   /estimated_length=20
FT   gap             21936169..21936234
FT                   /estimated_length=66
FT   gap             21954402..21954421
FT                   /estimated_length=20
FT   gap             21962490..21962509
FT                   /estimated_length=20
FT   gap             21966962..21966981
FT                   /estimated_length=20
FT   gap             22004520..22004675
FT                   /estimated_length=156
FT   gene            <22010633..22011813
FT                   /locus_tag="mCG_50480"
FT                   /note="gene_id=mCG50480.1"
FT   mRNA            join(<22010633..22010944,22011061..22011813)
FT                   /locus_tag="mCG_50480"
FT                   /product="mCG50480"
FT                   /note="gene_id=mCG50480.1 transcript_id=mCT50663.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(<22010635..22010944,22011061..22011086)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50480"
FT                   /product="mCG50480"
FT                   /note="gene_id=mCG50480.1 transcript_id=mCT50663.2
FT                   protein_id=mCP29745.2"
FT                   /protein_id="EDL29407.1"
FT                   /translation="EWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSA
FT                   LHGDMDQKERDVIMREFRSGSSRVLITTDLLAHGIDVQQVSLVINYDLPTNRENYIHRR
FT                   CGYKLCY"
FT   gap             22014428..22014477
FT                   /estimated_length=50
FT   gene            complement(22014596..>22252127)
FT                   /locus_tag="mCG_120205"
FT                   /note="gene_id=mCG120205.1"
FT   mRNA            complement(join(22014596..22015646,22018003..22018080,
FT                   22020244..22020426,22022344..22022410,22023998..22024177,
FT                   22078424..22078537,22086353..22086469,22087575..22087628,
FT                   22089269..22089304,22099062..22099139,22106969..22107013,
FT                   22107932..22108036,22109630..22109683,22112251..22112304,
FT                   22114171..22114224,22115000..22115053,22115309..22115362,
FT                   22116543..22116575,22120254..22120295,22123959..22124012,
FT                   22124449..22124511,22125031..22125075,22128473..22128526,
FT                   22130151..22130204,22132538..22132591,22133216..22133269,
FT                   22140368..22140421,22150870..22150923,22154751..22154804,
FT                   22155048..22155077,22155460..22155504,22160543..22160587,
FT                   22161882..22161935,22168108..22168152,22168586..22168639,
FT                   22169778..22169831,22169982..22170035,22171707..22171822,
FT                   22191521..22191796,22195123..22195229,22224499..22225073,
FT                   22227272..22227423,22251751..>22252127))
FT                   /locus_tag="mCG_120205"
FT                   /product="mCG120205"
FT                   /note="gene_id=mCG120205.1 transcript_id=mCT121385.1
FT                   created on 15-OCT-2002"
FT   gap             22039530..22039549
FT                   /estimated_length=20
FT   CDS             complement(join(22086392..22086469,22087575..22087628,
FT                   22089269..22089304,22099062..22099139,22106969..22107013,
FT                   22107932..22108036,22109630..22109683,22112251..22112304,
FT                   22114171..22114224,22115000..22115053,22115309..22115362,
FT                   22116543..22116575,22120254..22120295,22123959..22124012,
FT                   22124449..22124511,22125031..22125075,22128473..22128526,
FT                   22130151..22130204,22132538..22132591,22133216..22133269,
FT                   22140368..22140421,22150870..22150923,22154751..22154804,
FT                   22155048..22155077,22155460..22155504,22160543..22160587,
FT                   22161882..22161935,22168108..22168152,22168586..22168639,
FT                   22169778..22169831,22169982..22170035,22171707..>22171793))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120205"
FT                   /product="mCG120205"
FT                   /note="gene_id=mCG120205.1 transcript_id=mCT121385.1
FT                   protein_id=mCP60745.1"
FT                   /protein_id="EDL29408.1"
FT                   /translation="HLFPAFSCRISKPVGARRQTGLSKNVLFQGSLGPPGPPGRDGSKG
FT                   MRGEPGELGEPGLPGEVGMRGPQGPPGLPGPAGPVGAPGLRGERGERGPPGEKGERGLD
FT                   GFPGKPGETGEQGRPGPPGVAGLQGEKGDVGPAGPPGVPGSVVQREGLKGEQGAPGPRG
FT                   HQGLPGPPGAPGLIGPEGRDGPPGPPGLRGKKGEMGPPGTPGALGPQGPPGPPGVPGPP
FT                   GPGGPPGLPGELGFPGKPGPAGHAGTPGKDGLNGPPGLPGSKGEPGDSGESGVPGMPGP
FT                   RGEVGERGLAGHPGEKGEVGLPGAPGFPGVHGEKGDQGEKGELGLPGLKGARGEKGEVG
FT                   PAGPPGLPGSPSVFTPHPRMPGEQGPKGEKGDPGEPGALGPQGHPGELGPRGPIGPPGA
FT                   KGHDGAQGPPGAAGNPGAPGPAGPPGLSGPPGSLGSPGVRGAPGKDGERGEKGTAGEEG
FT                   SPGPAGPRGDPGAPGLPGPPGKGKDGEPGLRGPPGLPGPLGIKGDRGTPGIPGSPGSRG
FT                   DPGIGVAGPPGPSGRPGDKGPPGSRGLPGFPGPQGPAGQDGAPGNPGERGPPGKPVCHL
FT                   PGLDEC"
FT   gap             22110905..22110983
FT                   /estimated_length=79
FT   gap             22164795..22164823
FT                   /estimated_length=29
FT   gap             22174784..22174915
FT                   /estimated_length=132
FT   gap             22189747..22190235
FT                   /estimated_length=489
FT   gap             22234535..22234640
FT                   /estimated_length=106
FT   gap             22239867..22239886
FT                   /estimated_length=20
FT   gap             22249227..22249246
FT                   /estimated_length=20
FT   gap             22306986..22307005
FT                   /estimated_length=20
FT   gap             22311768..22313321
FT                   /estimated_length=1554
FT   gap             22319697..22319716
FT                   /estimated_length=20
FT   gap             22327988..22328007
FT                   /estimated_length=20
FT   gap             22336585..22336920
FT                   /estimated_length=336
FT   gap             22376178..22376197
FT                   /estimated_length=20
FT   gap             22398257..22398276
FT                   /estimated_length=20
FT   gap             22426947..22426966
FT                   /estimated_length=20
FT   gap             22463973..22468651
FT                   /estimated_length=4679
FT   gap             22473593..22473655
FT                   /estimated_length=63
FT   gap             22536401..22536429
FT                   /estimated_length=29
FT   gap             22546902..22546921
FT                   /estimated_length=20
FT   gap             22553679..22553698
FT                   /estimated_length=20
FT   gap             22583707..22587690
FT                   /estimated_length=3984
FT   gap             22590965..22590984
FT                   /estimated_length=20
FT   gap             22600697..22600716
FT                   /estimated_length=20
FT   gap             22610880..22610957
FT                   /estimated_length=78
FT   gap             22613133..22613419
FT                   /estimated_length=287
FT   gap             22624481..22624500
FT                   /estimated_length=20
FT   gap             22626114..22630462
FT                   /estimated_length=4349
FT   gap             22653407..22653476
FT                   /estimated_length=70
FT   gap             22691073..22691105
FT                   /estimated_length=33
FT   gap             22718501..22718856
FT                   /estimated_length=356
FT   gene            complement(<22728135..22760598)
FT                   /locus_tag="mCG_9178"
FT                   /note="gene_id=mCG9178.2"
FT   mRNA            complement(join(<22728135..22729060,22760317..22760598))
FT                   /locus_tag="mCG_9178"
FT                   /product="mCG9178"
FT                   /note="gene_id=mCG9178.2 transcript_id=mCT9367.2 created on
FT                   13-NOV-2002"
FT   CDS             complement(22728135..22729013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9178"
FT                   /product="mCG9178"
FT                   /note="gene_id=mCG9178.2 transcript_id=mCT9367.2
FT                   protein_id=mCP7206.2"
FT                   /protein_id="EDL29409.1"
FT                   /translation="MFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVS
FT                   MENMVTVGFFSCMGTLCLGAAAFSQCEDWSFFHAYYYCFITLTTIGFGDFVALQAKGAL
FT                   QRKPFYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNTDEELLEGEVAEILAGNPRRVSV
FT                   RAPQRRKRHHAMYFLRKYGRTLCYLCFPGTNWGKDDDDDDDDDVVDNVVVTAPISAPAP
FT                   APAPAPAPAAVAAGATIRSVRATVHTVSCRVEEIPPDVLRNTYFRSVFGAIPPGMHTCG
FT                   DHRLHLRRKSI"
FT   gap             22751615..22752133
FT                   /estimated_length=519
FT   gap             22756527..22756590
FT                   /estimated_length=64
FT   gap             22762142..22762626
FT                   /estimated_length=485
FT   gap             22765193..22765944
FT                   /estimated_length=752
FT   gap             22788885..22789332
FT                   /estimated_length=448
FT   gap             22796216..22796235
FT                   /estimated_length=20
FT   gene            complement(22804177..>23277474)
FT                   /gene="1810044A24Rik"
FT                   /locus_tag="mCG_141532"
FT                   /note="gene_id=mCG141532.0"
FT   mRNA            complement(join(22804177..22804719,22805173..22805396,
FT                   22899850..22899946,22908077..22908228,22951436..22951546,
FT                   22971831..22971973,23118752..23118876,23140583..23140735,
FT                   23146748..23146789,23153545..23153708,23158453..23158586,
FT                   23165489..23165575,23169518..23169663,23180186..23180314,
FT                   23216644..23216787,23229362..23229578,23242533..23242660,
FT                   23258553..23258581,23266975..23267103,23268543..23268688,
FT                   23274302..23274894,23277341..>23277474))
FT                   /gene="1810044A24Rik"
FT                   /locus_tag="mCG_141532"
FT                   /product="RIKEN cDNA 1810044A24"
FT                   /note="gene_id=mCG141532.0 transcript_id=mCT175823.0
FT                   created on 13-NOV-2002"
FT   gap             22844792..22845192
FT                   /estimated_length=401
FT   CDS             complement(join(22899918..22899946,22908077..22908228,
FT                   22951436..22951546,22971831..22971973,23118752..23118876,
FT                   23140583..23140735,23146748..23146789,23153545..23153708,
FT                   23158453..23158586,23165489..>23165533))
FT                   /codon_start=1
FT                   /gene="1810044A24Rik"
FT                   /locus_tag="mCG_141532"
FT                   /product="RIKEN cDNA 1810044A24"
FT                   /note="gene_id=mCG141532.0 transcript_id=mCT175823.0
FT                   protein_id=mCP98745.0"
FT                   /protein_id="EDL29410.1"
FT                   /translation="WCTTQCRLSSAWKTWGYHTTVFGVFSDCLLDNLPGLKTGGSTVEV
FT                   IPALPRLQISTSLPRSARSLQPSAGDEIATNVSVQLYNGETQQLAVTLENIGLEPLEQL
FT                   EVTSKLLTTKELNTEVSSAVRHLSEKLYGDFLSWKLEETLAQFPLQPGKVATFTINIKA
FT                   KLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVRPRVESRPTNPSEGSKTGDLGHVKT
FT                   LEAVLNFKYSGGPGHVEGYYRNLSLGLHVEVEPSVFFTRVSTLPATSTRQCHLLLDVFN
FT                   STEHELTVCARNNSELVLHASECQRMAIQVDKFNFESVPESPGEKGHFANLKQLEEERQ
FT                   EARGLEISSKLDIRWRSLPFSEAQW"
FT   gap             22909700..22909894
FT                   /estimated_length=195
FT   gap             22931159..22931178
FT                   /estimated_length=20
FT   gap             22934649..22934668
FT                   /estimated_length=20
FT   gap             22957114..22957133
FT                   /estimated_length=20
FT   gap             22985162..22985800
FT                   /estimated_length=639
FT   gap             22994729..22995063
FT                   /estimated_length=335
FT   gap             23006718..23006737
FT                   /estimated_length=20
FT   gap             23012081..23012100
FT                   /estimated_length=20
FT   gap             23131289..23131599
FT                   /estimated_length=311
FT   gap             23143566..23143585
FT                   /estimated_length=20
FT   gap             23145289..23145308
FT                   /estimated_length=20
FT   gap             23160209..23164332
FT                   /estimated_length=4124
FT   gap             23167842..23167861
FT                   /estimated_length=20
FT   gap             23184358..23184377
FT                   /estimated_length=20
FT   gap             23212195..23212374
FT                   /estimated_length=180
FT   gap             23221000..23221143
FT                   /estimated_length=144
FT   gap             23223483..23223502
FT                   /estimated_length=20
FT   gap             23236035..23236054
FT                   /estimated_length=20
FT   gap             23247462..23250934
FT                   /estimated_length=3473
FT   gap             23298392..23302759
FT                   /estimated_length=4368
FT   gene            23306207..23313249
FT                   /gene="Chrac1"
FT                   /locus_tag="mCG_9175"
FT                   /note="gene_id=mCG9175.2"
FT   mRNA            join(23306207..23306365,23308528..23308654,
FT                   23313031..23313249)
FT                   /gene="Chrac1"
FT                   /locus_tag="mCG_9175"
FT                   /product="chromatin accessibility complex 1, transcript
FT                   variant mCT171968"
FT                   /note="gene_id=mCG9175.2 transcript_id=mCT171968.0 created
FT                   on 12-AUG-2002"
FT   CDS             join(23306219..23306365,23308528..23308654,
FT                   23313031..23313041)
FT                   /codon_start=1
FT                   /gene="Chrac1"
FT                   /locus_tag="mCG_9175"
FT                   /product="chromatin accessibility complex 1, isoform CRA_a"
FT                   /note="gene_id=mCG9175.2 transcript_id=mCT171968.0
FT                   protein_id=mCP94887.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z0U4"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:2135796"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z0U4"
FT                   /protein_id="EDL29411.1"
FT                   /translation="MADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLT
FT                   AKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLAECS"
FT   mRNA            join(<23306219..23306365,23308528..23308654,
FT                   23309219..>23309334)
FT                   /gene="Chrac1"
FT                   /locus_tag="mCG_9175"
FT                   /product="chromatin accessibility complex 1, transcript
FT                   variant mCT9366"
FT                   /note="gene_id=mCG9175.2 transcript_id=mCT9366.0 created on
FT                   12-AUG-2002"
FT   CDS             join(23306219..23306365,23308528..23308654,
FT                   23309219..23309334)
FT                   /codon_start=1
FT                   /gene="Chrac1"
FT                   /locus_tag="mCG_9175"
FT                   /product="chromatin accessibility complex 1, isoform CRA_b"
FT                   /note="gene_id=mCG9175.2 transcript_id=mCT9366.0
FT                   protein_id=mCP7197.0 isoform=CRA_b"
FT                   /protein_id="EDL29412.1"
FT                   /translation="MADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLT
FT                   AKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLADILPKKILASKYL
FT                   KMLKEKREEEEDNEDDGSDLGEALA"
FT   gap             23307489..23307554
FT                   /estimated_length=66
FT   gene            complement(23321398..>23362114)
FT                   /gene="Eif2c2"
FT                   /locus_tag="mCG_9176"
FT                   /note="gene_id=mCG9176.2"
FT   mRNA            complement(join(23321398..23322708,23322857..23323056,
FT                   23323960..23324061,23327275..23327409,23329296..23329490,
FT                   23331849..23331939,23334883..23335042,23336610..23336794,
FT                   23338869..23339002,23339423..23339545,23339676..23339795,
FT                   23340782..23340857,23341993..23342080,23342500..23342679,
FT                   23343870..23344006,23346407..23346588,23353537..23353657,
FT                   23361915..23362113))
FT                   /gene="Eif2c2"
FT                   /locus_tag="mCG_9176"
FT                   /product="eukaryotic translation initiation factor 2C, 2,
FT                   transcript variant mCT9368"
FT                   /note="gene_id=mCG9176.2 transcript_id=mCT9368.1 created on
FT                   13-NOV-2002"
FT   mRNA            complement(join(23322553..23322708,23322857..23323056,
FT                   23323960..23324061,23327275..23327409,23329296..23329490,
FT                   23331849..23331939,23334883..23335042,23336610..23336794,
FT                   23338869..23339002,23339423..23339545,23339676..23339795,
FT                   23340710..23340857,23341993..23342080,23342500..23342634,
FT                   23343870..23344006,23346407..23346588,23353537..23353657,
FT                   23361915..>23362114))
FT                   /gene="Eif2c2"
FT                   /locus_tag="mCG_9176"
FT                   /product="eukaryotic translation initiation factor 2C, 2,
FT                   transcript variant mCT192616"
FT                   /note="gene_id=mCG9176.2 transcript_id=mCT192616.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(23322600..23322708,23322857..23323056,
FT                   23323960..23324061,23327275..23327409,23329296..23329490,
FT                   23331849..23331939,23334883..23335042,23336610..23336794,
FT                   23338869..23339002,23339423..23339545,23339676..23339795,
FT                   23340710..23340857,23341993..23342080,23342500..23342634,
FT                   23343870..23344006,23346407..23346588,23353537..23353657,
FT                   23361915..>23362114))
FT                   /codon_start=1
FT                   /gene="Eif2c2"
FT                   /locus_tag="mCG_9176"
FT                   /product="eukaryotic translation initiation factor 2C, 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9176.2 transcript_id=mCT192616.0
FT                   protein_id=mCP113603.0 isoform=CRA_a"
FT                   /protein_id="EDL29413.1"
FT                   /translation="PVLASPAPTTSPIPGYAFKPPPRPDFGTTGRTIKLQANFFEMDIP
FT                   KIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIG
FT                   RDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH
FT                   LPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKA
FT                   QPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTR
FT                   RPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCN
FT                   IVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDE
FT                   MTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCT
FT                   EVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVIL
FT                   PGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQ
FT                   GRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQ
FT                   DLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQ
FT                   PGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQG
FT                   TSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHL
FT                   VDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA"
FT   CDS             complement(join(23322600..23322708,23322857..23323056,
FT                   23323960..23324061,23327275..23327409,23329296..23329490,
FT                   23331849..23331939,23334883..23335042,23336610..23336794,
FT                   23338869..23339002,23339423..23339545,23339676..23339795,
FT                   23340782..23340857,23341993..23342080,23342500..23342679,
FT                   23343870..23344006,23346407..23346588,23353537..23353657,
FT                   23361915..23361991))
FT                   /codon_start=1
FT                   /gene="Eif2c2"
FT                   /locus_tag="mCG_9176"
FT                   /product="eukaryotic translation initiation factor 2C, 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9176.2 transcript_id=mCT9368.1
FT                   protein_id=mCP7198.2 isoform=CRA_b"
FT                   /protein_id="EDL29414.1"
FT                   /translation="MDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRK
FT                   PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGR
FT                   LPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPS
FT                   LWKMMLNIDDTSVKPVRLFLFLRIVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDS
FT                   QRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYF
FT                   KDRHKLVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVR
FT                   EFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIA
FT                   CFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYA
FT                   GLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLG
FT                   GVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRV
FT                   QQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREA
FT                   CIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFY
FT                   LCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHL
FT                   VAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA"
FT   gap             23323069..23323088
FT                   /estimated_length=20
FT   gap             23398258..23398277
FT                   /estimated_length=20
FT   gap             23400221..23400924
FT                   /estimated_length=704
FT   gap             23410849..23410893
FT                   /estimated_length=45
FT   gap             23413379..23413398
FT                   /estimated_length=20
FT   gap             23420256..23420275
FT                   /estimated_length=20
FT   gene            complement(23420831..>23639306)
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /note="gene_id=mCG18061.3"
FT   mRNA            complement(join(23420831..23421985,23425053..23425133,
FT                   23426467..23426622,23431704..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559384,23581074..23581228,23610809..23610905,
FT                   23639186..23639287))
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, transcript
FT                   variant mCT171944"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT171944.0 created
FT                   on 12-AUG-2002"
FT   mRNA            complement(join(23420831..23421985,23425053..23425133,
FT                   23426467..23426622,23431704..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559384,23610809..>23610885))
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, transcript
FT                   variant mCT18184"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT18184.1 created
FT                   on 12-AUG-2002"
FT   mRNA            complement(join(23421058..23421985,23425053..23425133,
FT                   23426467..23426622,23431694..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559384,23576059..23576370,23610809..23610905,
FT                   23639186..>23639306))
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, transcript
FT                   variant mCT192644"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT192644.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(23421773..23421985,23425053..23425133,
FT                   23426467..23426622,23431704..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..>23559382))
FT                   /codon_start=1
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, isoform CRA_d"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT18184.1
FT                   protein_id=mCP7189.1 isoform=CRA_d"
FT                   /protein_id="EDL29418.1"
FT                   /translation="YDRYLASSKRMAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMER
FT                   VLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEE
FT                   VHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKS
FT                   DYMQEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLL
FT                   DSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVE
FT                   LAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVT
FT                   APSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAV
FT                   SVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPA
FT                   LAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGEL
FT                   RSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFG
FT                   LSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQG
FT                   VKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
FT                   VQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQ
FT                   VSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQV
FT                   LPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIY
FT                   QPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRS
FT                   NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPAST
FT                   HREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVI
FT                   DQARLKMLGQTRPH"
FT   CDS             complement(join(23421773..23421985,23425053..23425133,
FT                   23426467..23426622,23431704..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559352))
FT                   /codon_start=1
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT171944.0
FT                   protein_id=mCP94863.0 isoform=CRA_a"
FT                   /protein_id="EDL29415.1"
FT                   /translation="MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFES
FT                   SSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGV
FT                   SSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQV
FT                   DQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRK
FT                   LIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGIS
FT                   YLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENM
FT                   ADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAE
FT                   IIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKN
FT                   CTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYS
FT                   LDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTY
FT                   YKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
FT                   ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRME
FT                   SRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGI
FT                   PAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEERL
FT                   IRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDPAA
FT                   PPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTG
FT                   LVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKL
FT                   LNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQ
FT                   TRPH"
FT   CDS             complement(join(23426579..23426622,23431694..23431810,
FT                   23432069..23432108,23437777..23437839,23445874..23446005,
FT                   23447865..23448002,23452162..23452248,23458376..23458487,
FT                   23473044..23473248,23475558..23475647,23478524..23478624,
FT                   23480224..23480339,23482112..23482212,23484819..23484903,
FT                   23490497..23490594,23492867..23492923,23508043..23508095,
FT                   23511361..23511391,23512599..23512716,23514146..23514253,
FT                   23519828..23519905,23520415..23520555,23525823..23525877,
FT                   23536783..23536845,23537049..23537128,23541756..23541843,
FT                   23546856..23547022,23559158..23559384,23576059..>23576209))
FT                   /codon_start=1
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, isoform CRA_c"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT192644.0
FT                   protein_id=mCP113574.0 isoform=CRA_c"
FT                   /protein_id="EDL29417.1"
FT                   /translation="TGTLCADSWLDLDRIGCMLLERAGQEALRPTGAVCMEKSGCSPFP
FT                   VCWAKEYDRYLASSKRMAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYF
FT                   ESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDM
FT                   GVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIAD
FT                   QVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTL
FT                   RKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEG
FT                   ISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAE
FT                   NMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDY
FT                   AEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTC
FT                   KNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRK
FT                   YSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDS
FT                   TYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIG
FT                   RIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMR
FT                   MESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH
FT                   GIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEE
FT                   RLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDP
FT                   AAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKVGISSAPGNQPPSHCQP"
FT   mRNA            complement(join(23430142..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559384,23581074..23581228,23610809..23610905,
FT                   23639186..>23639295))
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, transcript
FT                   variant mCT192643"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT192643.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(23431662..23431810,23432069..23432108,
FT                   23437777..23437839,23445874..23446005,23447865..23448002,
FT                   23452162..23452248,23458376..23458487,23473044..23473248,
FT                   23475558..23475647,23478524..23478624,23480224..23480339,
FT                   23482112..23482212,23484819..23484903,23490497..23490594,
FT                   23492867..23492923,23508043..23508095,23511361..23511391,
FT                   23512599..23512716,23514146..23514253,23519828..23519905,
FT                   23520415..23520555,23525823..23525877,23536783..23536845,
FT                   23537049..23537128,23541756..23541843,23546856..23547022,
FT                   23559158..23559384,23581074..>23581107))
FT                   /codon_start=1
FT                   /gene="Ptk2"
FT                   /locus_tag="mCG_18061"
FT                   /product="PTK2 protein tyrosine kinase 2, isoform CRA_b"
FT                   /note="gene_id=mCG18061.3 transcript_id=mCT192643.0
FT                   protein_id=mCP113573.0 isoform=CRA_b"
FT                   /protein_id="EDL29416.1"
FT                   /translation="EAACLLSLLSEEYDRYLASSKRMAAAYLDPNLNHTPSSSTKTHLG
FT                   TGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVAC
FT                   YGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDK
FT                   PTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKD
FT                   VGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFK
FT                   CALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQL
FT                   KIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLA
FT                   NSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDV
FT                   HQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPV
FT                   WIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLV
FT                   SSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMW
FT                   EILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTEL
FT                   KAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYP
FT                   SPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVED
FT                   SAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDG
FT                   SFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKVGICA
FT                   CAMWSVPC"
FT   gap             23436293..23436312
FT                   /estimated_length=20
FT   gap             23445476..23445559
FT                   /estimated_length=84
FT   gene            23465552..23480130
FT                   /locus_tag="mCG_148001"
FT                   /note="gene_id=mCG148001.0"
FT   mRNA            join(23465552..23465611,23479869..23480130)
FT                   /locus_tag="mCG_148001"
FT                   /product="mCG148001"
FT                   /note="gene_id=mCG148001.0 transcript_id=mCT188264.0
FT                   created on 13-JAN-2004"
FT   CDS             23479929..23480036
FT                   /codon_start=1
FT                   /locus_tag="mCG_148001"
FT                   /product="mCG148001"
FT                   /note="gene_id=mCG148001.0 transcript_id=mCT188264.0
FT                   protein_id=mCP108964.0"
FT                   /protein_id="EDL29419.1"
FT                   /translation="MLACFGSLQNCLEMGPKWKRRSLGQVVVDWFQSTS"
FT   gap             23554639..23554748
FT                   /estimated_length=110
FT   gap             23598098..23598532
FT                   /estimated_length=435
FT   gene            complement(23623472..23624456)
FT                   /pseudo
FT                   /locus_tag="mCG_18063"
FT                   /note="gene_id=mCG18063.1"
FT   mRNA            complement(23623472..23624456)
FT                   /pseudo
FT                   /locus_tag="mCG_18063"
FT                   /note="gene_id=mCG18063.1 transcript_id=mCT18185.1 created
FT                   on 13-NOV-2002"
FT   gene            complement(<23644533..>23645087)
FT                   /locus_tag="mCG_50146"
FT                   /note="gene_id=mCG50146.0"
FT   mRNA            complement(<23644533..>23645087)
FT                   /locus_tag="mCG_50146"
FT                   /product="mCG50146"
FT                   /note="gene_id=mCG50146.0 transcript_id=mCT50329.1 created
FT                   on 09-DEC-2002"
FT   CDS             complement(23644533..23645087)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50146"
FT                   /product="mCG50146"
FT                   /note="gene_id=mCG50146.0 transcript_id=mCT50329.1
FT                   protein_id=mCP29778.1"
FT                   /protein_id="EDL29420.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKAT
FT                   KYLKDVTLKKQCVPFWRYNGGVGKCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAEL
FT                   KGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINLYMSSPCHIEMILTEKEQIVPKPEEE
FT                   VAQKKKISQKKLKKQKLMAQE"
FT   gap             23658323..23658486
FT                   /estimated_length=164
FT   gap             23662215..23662383
FT                   /estimated_length=169
FT   gap             23665856..23665875
FT                   /estimated_length=20
FT   gap             23674032..23674229
FT                   /estimated_length=198
FT   gap             23696615..23696658
FT                   /estimated_length=44
FT   gap             23698291..23698310
FT                   /estimated_length=20
FT   gap             23702026..23702045
FT                   /estimated_length=20
FT   gap             23703124..23703143
FT                   /estimated_length=20
FT   gap             23707821..23707840
FT                   /estimated_length=20
FT   gap             23712737..23713402
FT                   /estimated_length=666
FT   gap             23729637..23729656
FT                   /estimated_length=20
FT   gene            23729873..23792056
FT                   /locus_tag="mCG_123968"
FT                   /note="gene_id=mCG123968.0"
FT   mRNA            join(23729873..23729974,23735708..23735748,
FT                   23739325..23739601,23740534..23740649,23745015..23745207,
FT                   23750253..23750372,23750695..23750913,23754729..23754850,
FT                   23758211..23758366,23760186..23760336,23761879..23761982,
FT                   23762467..23762666,23764642..23765163,23772670..23772929,
FT                   23773961..23774131,23775195..23775324,23782168..23782275,
FT                   23784331..23784470,23784849..23785006,23786866..23786999,
FT                   23788255..23788358,23788441..23788578,23790587..23792056)
FT                   /locus_tag="mCG_123968"
FT                   /product="mCG123968"
FT                   /note="gene_id=mCG123968.0 transcript_id=mCT125205.1
FT                   created on 14-NOV-2002"
FT   CDS             join(23739413..23739601,23740534..23740649,
FT                   23745015..23745207,23750253..23750372,23750695..23750913,
FT                   23754729..23754850,23758211..23758366,23760186..23760336,
FT                   23761879..23761982,23762467..23762666,23764642..23765163,
FT                   23772670..23772929,23773961..23774131,23775195..23775324,
FT                   23782168..23782275,23784331..23784470,23784849..23785006,
FT                   23786866..23786999,23788255..23788358,23788441..23788578,
FT                   23790587..23790787)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123968"
FT                   /product="mCG123968"
FT                   /note="gene_id=mCG123968.0 transcript_id=mCT125205.1
FT                   protein_id=mCP60433.1"
FT                   /protein_id="EDL29421.1"
FT                   /translation="MARYRGPAVLLAKAGGVPSGRSERSPGWSPGRATLETPRGPILKM
FT                   SPSQEVWTSLPCLSSASQGVCVWLRNPKRTTSISWCSRMSVEIEPMVWSPSTIDPCILL
FT                   THLKLCKDFEVDNHIKDFAARLSLIPSPPPGPLHLVNETWNWAGLFRSVLKAAESKCVK
FT                   LFQIFNMKPLQVVFPSRADPESPIVDLDLHLPLLCFRPEKVLQILTCILTEQRIVFFSS
FT                   DWALLTLMAECFVAYLHPLQWQHTFVPILSGQMLDFVMAPTSFLMGCHLDHFEEVRKEA
FT                   DGLVLIDIDHGSVTCSKSSDDNIDIPDVPLLLAQTFIQRVQSLQLHPDLHLAHLSASTD
FT                   LNEGRARRRAWQQTLNCKIQHITLQLLVGIFSMTLGIVVVECVAHLLFAREVKNHLNYE
FT                   HRVFNSEEFLKTRAAGDQQFYKQVLDTYMFHSFLKARLNGRMDAFARMDLDTQSEEDRI
FT                   DRMLISPRRPTVEKMASRKASPLHITHRRMVVSMPNLQDISLPELPPRNSSLRIMDTSN
FT                   CRSSSPVLKVTPKSTYMFKIPDIHFPLESQCVQAYYTDFVTLLSKAMALLGPGDSLLLA
FT                   RYFYLRGLLHLMQGQLLSALLDFQNLYKTDIGIFPADLVKRTVESMSASERAQAERTPE
FT                   LRRLITEVFDKHGEAPKADDAVKNFELPKKHMQLNDFVKRVQESGIVKDAVIIHRLFDA
FT                   LTFGHEKQIDPETFRDFYTCWKETEAEAQEVSLPALLMEHLDKNECVYKLSSSVKTNRG
FT                   VGKIAMTQKRLFLLTEGRPGYVEIATFRNIEEVKNSTVAFLLLRIPTLKIKTVAKKEVF
FT                   EANLKSECDLWHLMVKEMWAGKQLADDHKDPQYVQQALTNVLLMDAVVGTLQSPSAIHA
FT                   ASKLAYFDNMKKKSPMAVPKTTSETLKHKINPSAGETAPQAIEVLLYTPGRLDPAEKVE
FT                   DAHPKLWCALNEGKVVVFDASSWTVHQHCFKVGSSKVNCMVMAEHNQVWVGSEDSVIYI
FT                   INVHSMSCNKQLTDHRSPVTGLAVHNGKKPSEIYSCSLDGTVIAWNVSTLRVISRFQLS
FT                   YGDLLSISLHNDRIWCCTVHKILVVTPQGFVRQELKHPKDASFLAFQLLPEEQQLWAAS
FT                   TGVSELYMWSLKDLDQPPQKTYLQDCSEVTCMIRVKRQIWVGGRGLSQGKTRGKIYVMD
FT                   VEKVTVEKELVAHLDTVRTLCSAEDRYVLSGAGQEEGKIAIWKVE"
FT   gap             23748141..23748160
FT                   /estimated_length=20
FT   gap             23755008..23755085
FT                   /estimated_length=78
FT   gap             23765741..23765908
FT                   /estimated_length=168
FT   gap             23776182..23776423
FT                   /estimated_length=242
FT   gap             23778968..23778987
FT                   /estimated_length=20
FT   gap             23779997..23780016
FT                   /estimated_length=20
FT   gene            complement(23798819..23801286)
FT                   /locus_tag="mCG_147988"
FT                   /note="gene_id=mCG147988.0"
FT   mRNA            complement(23798819..23801286)
FT                   /locus_tag="mCG_147988"
FT                   /product="mCG147988"
FT                   /note="gene_id=mCG147988.0 transcript_id=mCT188251.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(23800222..23800530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147988"
FT                   /product="mCG147988"
FT                   /note="gene_id=mCG147988.0 transcript_id=mCT188251.0
FT                   protein_id=mCP108954.0"
FT                   /protein_id="EDL29422.1"
FT                   /translation="MKAKNSKHPPEQAADPRSCLSRRAADPRSVQCPLSAHEQNLGFRE
FT                   AGSASAAVGKDFPTTSLFNNSSLSVCTQERENLPGWYPDEVRAVLLLPRLVFLHKVL"
FT   gene            complement(23801301..23867746)
FT                   /locus_tag="mCG_18066"
FT                   /note="gene_id=mCG18066.2"
FT   mRNA            complement(join(23801301..23801944,23804155..23804366,
FT                   23805105..23805204,23805836..23806902,23807338..23807541,
FT                   23809203..23809391,23826848..23827482,23867295..23867746))
FT                   /locus_tag="mCG_18066"
FT                   /product="mCG18066"
FT                   /note="gene_id=mCG18066.2 transcript_id=mCT18189.1 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(23801579..23801944,23804155..23804366,
FT                   23805105..23805204,23805836..23806902,23807338..23807541,
FT                   23809203..23809391,23826848..23827091))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18066"
FT                   /product="mCG18066"
FT                   /note="gene_id=mCG18066.2 transcript_id=mCT18189.1
FT                   protein_id=mCP7194.1"
FT                   /protein_id="EDL29423.1"
FT                   /translation="MKMAPQNADSESMQVQELPVPLPDPQKPRDPEAETQEETTSEGSI
FT                   DRIPTRLWVMHGAVMFGREFCYAMETALVTPILLQIGLPEKYYSLTWFLSPVLGLIFTP
FT                   LIGSASDRCTLSWGRRRPFILALCVGVLIGVALFLNGSAIGLALGDVPSRQPIGIVLTV
FT                   LGVVVLDFSADATEGPIRAYLLDVVDSEEQDMALNIHAFSAGKAPLQAPGLGGAIGYVL
FT                   GGLDWTQTFLGDWFQTQNQVLFFFAAVIFSVSVALHLFSIEEEQYSPQQDRGPEDPTLP
FT                   GTSVQPGAPAPASRLSSLGGGMQDGSPPFPDEVQSEHELSLDYLDVDIVRSKSDSVLHM
FT                   ADATLDMEPQLLFLHDIEPSIFQDASYPSTPQSTSQELLRAKLPRLSTFLRESTKEDDT
FT                   LLDNHLNEAKVPNGRGSPPINSLSRSKVDLKPSVTSGSMRRRRHMFHRQASSTFSYYGK
FT                   IGSHCYRYRRANAVVLIKPSRSMSDLYDLQQRQRSRHRNQSGATASSGDTESEEGETET
FT                   TVRLLWLSMLKMPKELMWLCLCHLLTWFSVIAEAVFYTDFMGQVIFKGNPQAPSNSTKW
FT                   HAYNAGVKMGCWGLVIYAATGAICSALLQKYLDNYDLSIRIIYMLGTLGFSVGTAVMAM
FT                   FPNVYVAMVTISTMGVVSMSISYCPYALLGHYHDIKEYVHHSPGNSKRGFGIDCAILSC
FT                   QVYISQILVASALGGVVDAVNSIVVIPIVASVGSFLGFLTATFLVIYPEVSEEPKEEQK
FT                   GLSSGPAGEGEGGAGSEKPTVLKLSRKGGLRGLVETESMV"
FT   gap             23818841..23818860
FT                   /estimated_length=20
FT   gap             23862190..23862209
FT                   /estimated_length=20
FT   gap             23867760..23867779
FT                   /estimated_length=20
FT   gap             23878338..23878375
FT                   /estimated_length=38
FT   gap             23883975..23884042
FT                   /estimated_length=68
FT   gap             23889960..23890494
FT                   /estimated_length=535
FT   gene            complement(23916332..23929113)
FT                   /gene="Gpr20"
FT                   /locus_tag="mCG_51596"
FT                   /note="gene_id=mCG51596.3"
FT   mRNA            complement(join(23916332..23918287,23928926..23929113))
FT                   /gene="Gpr20"
FT                   /locus_tag="mCG_51596"
FT                   /product="G protein-coupled receptor 20"
FT                   /note="gene_id=mCG51596.3 transcript_id=mCT51779.3 created
FT                   on 18-APR-2003"
FT   CDS             complement(23917187..23918263)
FT                   /codon_start=1
FT                   /gene="Gpr20"
FT                   /locus_tag="mCG_51596"
FT                   /product="G protein-coupled receptor 20"
FT                   /note="gene_id=mCG51596.3 transcript_id=mCT51779.3
FT                   protein_id=mCP29731.2"
FT                   /protein_id="EDL29424.1"
FT                   /translation="MPSALSMRPWDAALPNTTAAAWTNGSVPEMPLFHHFARLDEELQA
FT                   TFPSLWQALMVVHGTIFLAGLVLNGLALYVFCCRTRAKTPSVTYTINLVVTDLLVGLSL
FT                   PTRFAVFYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSRRWRQPA
FT                   CAKAVCIFVWLAAGVVTLSVLGVKSGGRSCCRVFALTVLEFLLPLLVISVFTGRIMCAL
FT                   SRPGLLRQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPNVPKHTSLVAYHVA
FT                   VTLSSLNSCMDPIVYCFITSGFQATVRGLFYQRGEEFKPSSMDVVSMHKSTKASAPIHI
FT                   LSIGSHTLTQPLTNGPEP"
FT   gap             23919557..23919728
FT                   /estimated_length=172
FT   gap             23923377..23923551
FT                   /estimated_length=175
FT   gap             23931924..23931943
FT                   /estimated_length=20
FT   gap             23938875..23940115
FT                   /estimated_length=1241
FT   gene            23943584..23977783
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /note="gene_id=mCG18064.2"
FT   mRNA            join(23943584..23943928,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977774)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT180743"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180743.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(23945204..23945259,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977782)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT171945"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT171945.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(23945208..23945260,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977783)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT180742"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180742.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(23945342..23945981,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977720)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT180744"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180744.0 created
FT                   on 24-FEB-2003"
FT   gap             23950133..23950258
FT                   /estimated_length=126
FT   gap             23960064..23960539
FT                   /estimated_length=476
FT   gap             23968786..23968805
FT                   /estimated_length=20
FT   mRNA            join(23968987..23969022,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977782)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT171946"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT171946.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(23969805..23969944,23971685..23972583,
FT                   23974313..23974405,23975851..23975981,23976585..23976659,
FT                   23977353..23977774)
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, transcript
FT                   variant mCT18187"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT18187.2 created
FT                   on 24-FEB-2003"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT171945.0
FT                   protein_id=mCP94865.0 isoform=CRA_a"
FT                   /protein_id="EDL29425.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT171946.0
FT                   protein_id=mCP94864.0 isoform=CRA_a"
FT                   /protein_id="EDL29426.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180742.0
FT                   protein_id=mCP103664.0 isoform=CRA_a"
FT                   /protein_id="EDL29427.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180743.0
FT                   protein_id=mCP103666.0 isoform=CRA_a"
FT                   /protein_id="EDL29428.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT18187.2
FT                   protein_id=mCP7209.1 isoform=CRA_a"
FT                   /protein_id="EDL29429.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   CDS             join(23972479..23972583,23974313..23974405,
FT                   23975851..23975981,23976585..23976659,23977353..23977470)
FT                   /codon_start=1
FT                   /gene="Ptp4a3"
FT                   /locus_tag="mCG_18064"
FT                   /product="protein tyrosine phosphatase 4a3, isoform CRA_a"
FT                   /note="gene_id=mCG18064.2 transcript_id=mCT180744.0
FT                   protein_id=mCP103665.0 isoform=CRA_a"
FT                   /protein_id="EDL29430.1"
FT                   /translation="MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTV
FT                   VRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHC
FT                   VAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDP
FT                   HTHKTRCCVM"
FT   gene            complement(23981972..>23985339)
FT                   /locus_tag="mCG_123969"
FT                   /note="gene_id=mCG123969.1"
FT   mRNA            complement(join(23981972..23982338,23982789..23982965,
FT                   23984330..23984405,23985292..>23985339))
FT                   /locus_tag="mCG_123969"
FT                   /product="mCG123969"
FT                   /note="gene_id=mCG123969.1 transcript_id=mCT125206.1
FT                   created on 14-NOV-2002"
FT   CDS             complement(join(23982156..23982338,23982789..23982965,
FT                   23984330..23984405,23985292..>23985338))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123969"
FT                   /product="mCG123969"
FT                   /note="gene_id=mCG123969.1 transcript_id=mCT125206.1
FT                   protein_id=mCP60454.1"
FT                   /protein_id="EDL29431.1"
FT                   /translation="ASRNEKGRRPSCSSLSLQDPSSEIRVASLQGLGNILFHPEKESLL
FT                   QGQLPAFLNGLFQKNEAVVVGIMGMVSDVLHRLGTQGAGAQSLSIAVNTRYFFDDEQDK
FT                   VRAAAMSLFGDLVATVADRELSGMRTQVCQSMVPLLLHLKDQCPAVVMVSANLQSL"
FT   gap             23996525..23996544
FT                   /estimated_length=20
FT   gap             24001947..24002158
FT                   /estimated_length=212
FT   gap             24004876..24005437
FT                   /estimated_length=562
FT   gap             24023530..24024388
FT                   /estimated_length=859
FT   gene            <24054804..24065934
FT                   /locus_tag="mCG_18067"
FT                   /note="gene_id=mCG18067.1"
FT   mRNA            join(<24054804..24054932,24055748..24055826,
FT                   24056365..24056488,24065456..24065934)
FT                   /locus_tag="mCG_18067"
FT                   /product="mCG18067"
FT                   /note="gene_id=mCG18067.1 transcript_id=mCT18191.2 created
FT                   on 14-NOV-2002"
FT   CDS             join(<24054919..24054932,24055748..24055826,
FT                   24056365..24056488,24065456..24065916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18067"
FT                   /product="mCG18067"
FT                   /note="gene_id=mCG18067.1 transcript_id=mCT18191.2
FT                   protein_id=mCP7211.2"
FT                   /protein_id="EDL29432.1"
FT                   /translation="PNGWRPQIQLQARTSTSSEVVLVPGPSYSLQKDPPSLLGSQVNRS
FT                   GTASDMASPCSGDLSPTGLAPPPVTTPGPAAPPAPRFPDIYGGDAQLWEAHFRGIGRAY
FT                   RALGKEDNFAIRVLTEDFTLPFPFAWPPGPDPATGPLFYDPRDRAGFDFLLRGPGAPPP
FT                   ALLRPLHATAQAAERKRRLERLALSYAGAGRPPGLVLLAPAAAAFPPEAGRPAWRALPR
FT                   DSE"
FT   gap             24057865..24062448
FT                   /estimated_length=4584
FT   gap             24063787..24063806
FT                   /estimated_length=20
FT   gap             24067110..24067129
FT                   /estimated_length=20
FT   gap             24071910..24071929
FT                   /estimated_length=20
FT   gap             24088234..24088339
FT                   /estimated_length=106
FT   gap             24090055..24090074
FT                   /estimated_length=20
FT   gap             24091667..24091686
FT                   /estimated_length=20
FT   gap             24098111..24098130
FT                   /estimated_length=20
FT   gap             24100613..24100632
FT                   /estimated_length=20
FT   gap             24111476..24111815
FT                   /estimated_length=340
FT   gap             24115473..24115492
FT                   /estimated_length=20
FT   gap             24126328..24126406
FT                   /estimated_length=79
FT   gap             24165467..24165571
FT                   /estimated_length=105
FT   gap             24195077..24195190
FT                   /estimated_length=114
FT   gap             24196836..24196995
FT                   /estimated_length=160
FT   gap             24205971..24206074
FT                   /estimated_length=104
FT   gap             24206670..24207692
FT                   /estimated_length=1023
FT   gap             24226580..24226599
FT                   /estimated_length=20
FT   gap             24238921..24238940
FT                   /estimated_length=20
FT   gap             24264247..24264266
FT                   /estimated_length=20
FT   gap             24288442..24288562
FT                   /estimated_length=121
FT   gap             24313592..24313611
FT                   /estimated_length=20
FT   gap             24314809..24314828
FT                   /estimated_length=20
FT   gap             24363557..24363611
FT                   /estimated_length=55
FT   gap             24416960..24416979
FT                   /estimated_length=20
FT   gap             24476228..24476254
FT                   /estimated_length=27
FT   gap             24485609..24485881
FT                   /estimated_length=273
FT   gap             24499801..24499820
FT                   /estimated_length=20
FT   gap             24509762..24509972
FT                   /estimated_length=211
FT   gap             24512147..24512212
FT                   /estimated_length=66
FT   gap             24525012..24525507
FT                   /estimated_length=496
FT   gap             24526687..24527333
FT                   /estimated_length=647
FT   gap             24536131..24536225
FT                   /estimated_length=95
FT   gap             24541567..24541586
FT                   /estimated_length=20
FT   gap             24554957..24554976
FT                   /estimated_length=20
FT   gap             24561319..24561545
FT                   /estimated_length=227
FT   gap             24580628..24580647
FT                   /estimated_length=20
FT   gap             24583583..24583602
FT                   /estimated_length=20
FT   gap             24585870..24585889
FT                   /estimated_length=20
FT   gap             24591312..24591331
FT                   /estimated_length=20
FT   gap             24604076..24604463
FT                   /estimated_length=388
FT   gap             24613083..24613102
FT                   /estimated_length=20
FT   gap             24632636..24632764
FT                   /estimated_length=129
FT   gap             24664297..24665171
FT                   /estimated_length=875
FT   gap             24666894..24666918
FT                   /estimated_length=25
FT   gap             24667140..24667883
FT                   /estimated_length=744
FT   gap             24721732..24721751
FT                   /estimated_length=20
FT   gap             24732471..24732971
FT                   /estimated_length=501
FT   gene            24732972..24809464
FT                   /gene="Bai1"
FT                   /locus_tag="mCG_120662"
FT                   /note="gene_id=mCG120662.1"
FT   mRNA            join(24732972..24733070,24745143..24746153,
FT                   24754511..24754672,24755416..24755526,24755911..24756075,
FT                   24756594..24756758,24757025..24757189,24757728..24757892,
FT                   24757987..24758088,24759454..24759560,24759706..24759900,
FT                   24760475..24760543,24761143..24761251,24763818..24763961,
FT                   24764470..24764545,24764731..24764833,24766183..24766226,
FT                   24783689..24783827,24789595..24789698,24791168..24791270,
FT                   24791830..24791980,24792562..24792631,24793857..24793923,
FT                   24795594..24795679,24800320..24800491,24802647..24802742,
FT                   24804133..24804187,24806512..24807045,24807291..24807457,
FT                   24808107..24808142,24808304..24808411,24808687..24809464)
FT                   /gene="Bai1"
FT                   /locus_tag="mCG_120662"
FT                   /product="brain-specific angiogenesis inhibitor 1"
FT                   /note="gene_id=mCG120662.1 transcript_id=mCT121853.2
FT                   created on 18-APR-2003"
FT   gap             24735831..24735989
FT                   /estimated_length=159
FT   CDS             join(24745370..24746153,24754511..24754672,
FT                   24755416..24755526,24755911..24756075,24756594..24756758,
FT                   24757025..24757189,24757728..24757892,24757987..24758088,
FT                   24759454..24759560,24759706..24759900,24760475..24760543,
FT                   24761143..24761251,24763818..24763961,24764470..24764545,
FT                   24764731..24764833,24766183..24766226,24783689..24783827,
FT                   24789595..24789698,24791168..24791270,24791830..24791980,
FT                   24792562..24792631,24793857..24793923,24795594..24795679,
FT                   24800320..24800491,24802647..24802742,24804133..24804187,
FT                   24806512..24807045,24807291..24807457,24808107..24808142,
FT                   24808304..24808411,24808687..24808884)
FT                   /codon_start=1
FT                   /gene="Bai1"
FT                   /locus_tag="mCG_120662"
FT                   /product="brain-specific angiogenesis inhibitor 1"
FT                   /note="gene_id=mCG120662.1 transcript_id=mCT121853.2
FT                   protein_id=mCP60329.2"
FT                   /protein_id="EDL29433.1"
FT                   /translation="MRGQAAAPGPIWILAPLLLLLLLLGRWARAASGADIGPGTEQCTT
FT                   LVQGKFFGYFSAAAVFPANASRCSWTLRNPDPRRYTLYMKVAKAPAPCSGPGRVRTYQF
FT                   DSFLESTRTYLGVESFDEVLRLCDSSAPLAFLQASKQFLQMQRQQPPQDGDLGPQGEFP
FT                   SSSDDFSVEYLVVGNRNPSHAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGDVGD
FT                   PASSPLVPRGDVCLRDGVAGGPENCLTSLTQDRGGHGSAGGWKLWSLWGECTRDCGGGL
FT                   QTRTRTCLPTLGVEGGGCEGVLEEGRLCNRKACGPTGRSSSRSQSLRSTDARRREEFGD
FT                   ELQQFGFPSPQTGDPAAEEWSPWSVCSSTCGEGWQTRTHFCVSSSYSTQCSGPLREQRL
FT                   CNNSAVCPVHGAWDEWSPWSLCSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNI
FT                   ALCPVDGNWNEWSSWSTCSASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCP
FT                   VDGKWQAWASWGSCSVTCGGGSQRRERVCSGPFFGGAACQGPQDEYRQCGAQRCPEPHE
FT                   ICDEDNFGAVVWKETPAGEVAAVRCPRNATGLILRRCELDEEGIAFWEPPTYIRCVSID
FT                   YRNIQMMTREHLAKAQRGLPGEGVSEVIQTLLEISQDGTSYSGDLLSTIDVLRNMTEIF
FT                   RRAYYSPTPGDVQNFVQIISNLLAEENRDKWEEAQLMGPNAKELFRLVEDFVDVIGFRM
FT                   KDLRDAYQVTDNLVLSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTG
FT                   LAEADDSSVFVVGTVLYRNLGSFLALQRNTTVLNSKVISVTVKPPPRSLLTPLEIEFAH
FT                   MYNGTTNQTCILWDETDGSSSAPPQLGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQ
FT                   LSADATMDKVTVPSVTLIVGCGVSSLTLLMLVIIYVSVWRYIRSERSVILINFCLSIIS
FT                   SNALILIGQTQTRNKVVCTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRSRLVRKR
FT                   FLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGI
FT                   LVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTWMSAVLAVTDRRSALFQILFA
FT                   VFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDV
FT                   DLACRSGERLTVLNKDIAACRTATITGTFKRPSLPEEEKMKLAKGPPPTFNSLPANVSK
FT                   LHLHGSPRYPGGPLPDFPNHSLTLKKDKAPKSSFIGDGDIFKKLDSELSRAQEKALDTS
FT                   YVILPTATATLRPKPKEEPKYSINIDQMPQTRLIHLSMAPDASFPTRSPPAREPPGGAP
FT                   PEVPPVQPPPPPHGKPPPPQQPIPPPPTLEPAPPSLGDTGEPAAHPGPSSGAGAKNENV
FT                   ATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKEKEVPGADSKPE
FT                   KQQTPNKRAWESLRKPHGTPAWVKKELEPLPPSPLELRSVEWEKAGATIPLVGQDIIDL
FT                   QTEV"
FT   gap             24769719..24770323
FT                   /estimated_length=605
FT   gap             24771617..24771636
FT                   /estimated_length=20
FT   gap             24773178..24773197
FT                   /estimated_length=20
FT   gap             24774763..24775231
FT                   /estimated_length=469
FT   gap             24783116..24783688
FT                   /estimated_length=573
FT   gap             24789719..24789845
FT                   /estimated_length=127
FT   gap             24807049..24807068
FT                   /estimated_length=20
FT   gene            complement(24826030..24856622)
FT                   /locus_tag="mCG_2797"
FT                   /note="gene_id=mCG2797.1"
FT   mRNA            complement(join(24826030..24826213,24826403..24826477,
FT                   24826671..24826773,24828113..24828235,24829644..24829799,
FT                   24830215..24830391,24830899..24831042,24831246..24831357,
FT                   24831528..24831665,24831873..24832057,24833226..24833370,
FT                   24834305..24834459,24834912..24835061,24836093..24836187,
FT                   24836265..24836400,24841107..24841211,24844967..24845062,
FT                   24845704..24845839,24846392..24846468,24846560..24846682,
FT                   24847893..24848012,24848235..24848351,24848557..24848649,
FT                   24849636..24849784,24854911..24855172,24855787..24855876,
FT                   24856485..24856622))
FT                   /locus_tag="mCG_2797"
FT                   /product="mCG2797"
FT                   /note="gene_id=mCG2797.1 transcript_id=mCT2154.2 created on
FT                   16-OCT-2002"
FT   CDS             complement(join(24826113..24826213,24826403..24826477,
FT                   24826671..24826773,24828113..24828235,24829644..24829799,
FT                   24830215..24830391,24830899..24831042,24831246..24831357,
FT                   24831528..24831665,24831873..24832057,24833226..24833370,
FT                   24834305..24834459,24834912..24835061,24836093..24836187,
FT                   24836265..24836400,24841107..24841211,24844967..24845062,
FT                   24845704..24845839,24846392..24846468,24846560..24846682,
FT                   24847893..24848012,24848235..24848351,24848557..24848649,
FT                   24849636..24849725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2797"
FT                   /product="mCG2797"
FT                   /note="gene_id=mCG2797.1 transcript_id=mCT2154.2
FT                   protein_id=mCP9210.2"
FT                   /db_xref="GOA:G3X8W1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1916689"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8W1"
FT                   /protein_id="EDL29434.1"
FT                   /translation="MVVNKIKNMMVMEQGQVLDTICHFLEKENQLWEKPEVSFWNPSVE
FT                   KLLEFLNLDPRKATDKAFFFHLYGMILRECPSVEKVQCHLASLLDLSHQHSRQREGIAL
FT                   AVGLASTKHLEEVWALLEHLGRTKFLQSVAATEDSQDEILKSSFLSATILLTRSLQAEY
FT                   SSQRYKFTQTPELIQCLLGILQKEPNSLTNFLRQKIILVIIGLSNLRPRFKPLLKSQIL
FT                   KTCLQTVYMLPPAKDSRNDLFSVEQASDTTVLYKKTVRALDLLLQNFISENPSMDEVCF
FT                   LLQHIEYWLMSDKIHERSRAVQSIYLLLQYVVDSLKLAKEAVPSLLGHQIGILILLWRD
FT                   KDKITQQHSHFCVYLLMELVFQQKGKLVESAQWSKMKHFESNVFREWEMKLYHLVKVFK
FT                   EDLTVAQHTQLILTLVHSLGSYNHLHSDLAAKLLLLICVEPGFRKEQIAELLQGLFQEL
FT                   PNIQSKSVQQAISQATLALGTQHIQEVVEVILSLCQPSERWILPLWKALAANYQVARDV
FT                   ITLLYIKLKLRPPRRLLQSTYRARLVSLMALGTIYELLYTKEYRNTVCWAFSGILLGLL
FT                   TELYYLLEVGLVQGLFDYQEDDLGSKPLGPCRICLEALKGLFWTTEYWEVFADVKLIQG
FT                   WELFGQLETFPKGVTLLARAMAHYNCEIKAVLGQALISLKSSEERDNIVGICIITEFLN
FT                   SPDVSQHMSWKTMYNSLNLGLSSRNQMVRAMSLKGLGSTLMHPKKATLLRSKLMELLDN
FT                   FLQPEFKDPAGLMKIMGHLLHCLSAQGIGIVSLKIAQHLLSLFTDERAAVREGAIFLFG
FT                   DVIHYGGKKLRQSLKDVASQATVPLLFNMADPCQEVAMKARFTFLRCAILLKWEFRKEL
FT                   FGKLAWGQGLGAANDIFIYMLESNVGNYQQFLSQALTYLDSSHMTVKLAAMKFIGALLQ
FT                   DYFNDLCIYLRKKDVIFLKNCLEALRHDTDSRTRRFYLNYWNDAVELSYYVQD"
FT   gap             24844827..24844846
FT                   /estimated_length=20
FT   gap             24852337..24852362
FT                   /estimated_length=26
FT   gene            complement(24889285..24892749)
FT                   /gene="Arc"
FT                   /locus_tag="mCG_2783"
FT                   /note="gene_id=mCG2783.3"
FT   mRNA            complement(join(24889285..24890190,24890377..24890513,
FT                   24890762..24892749))
FT                   /gene="Arc"
FT                   /locus_tag="mCG_2783"
FT                   /product="activity regulated cytoskeletal-associated
FT                   protein, transcript variant mCT192634"
FT                   /note="gene_id=mCG2783.3 transcript_id=mCT192634.1 created
FT                   on 29-NOV-2004"
FT   mRNA            complement(join(24889285..24890190,24890377..24890516,
FT                   24890762..24892749))
FT                   /gene="Arc"
FT                   /locus_tag="mCG_2783"
FT                   /product="activity regulated cytoskeletal-associated
FT                   protein, transcript variant mCT2173"
FT                   /note="gene_id=mCG2783.3 transcript_id=mCT2173.1 created on
FT                   29-NOV-2004"
FT   CDS             complement(24891379..24892569)
FT                   /codon_start=1
FT                   /gene="Arc"
FT                   /locus_tag="mCG_2783"
FT                   /product="activity regulated cytoskeletal-associated
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG2783.3 transcript_id=mCT2173.1
FT                   protein_id=mCP9203.1 isoform=CRA_a"
FT                   /protein_id="EDL29435.1"
FT                   /translation="MELDHMTTGGLHAYPAPRGGPAAKPNVILQIGKCRAEMLEHVRRT
FT                   HRHLLTEVSKQVERELKGLHRSVGKLENNLDGYVPTGDSQRWKKSIKACLCRCQETIAN
FT                   LERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSVGVGGPEPYCQEAD
FT                   GYDYTVSPYAITPPPAAGELPEQESVEAQQYQSWGPGEDGQPSPGVDTQIFEDPREFLS
FT                   HLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSR
FT                   EAIQRELELPQKQGEPLDQFLWRKRDLYQTLYVDAEEEEIIQYVVGTLQPKLKRFLRHP
FT                   LPKTLEQLIQRGMEVQDGLEQAAEPSGTPLPTEDETEALTPALTSESVASDRTQPE"
FT   CDS             complement(24891379..24892569)
FT                   /codon_start=1
FT                   /gene="Arc"
FT                   /locus_tag="mCG_2783"
FT                   /product="activity regulated cytoskeletal-associated
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG2783.3 transcript_id=mCT192634.1
FT                   protein_id=mCP113595.1 isoform=CRA_a"
FT                   /protein_id="EDL29436.1"
FT                   /translation="MELDHMTTGGLHAYPAPRGGPAAKPNVILQIGKCRAEMLEHVRRT
FT                   HRHLLTEVSKQVERELKGLHRSVGKLENNLDGYVPTGDSQRWKKSIKACLCRCQETIAN
FT                   LERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSVGVGGPEPYCQEAD
FT                   GYDYTVSPYAITPPPAAGELPEQESVEAQQYQSWGPGEDGQPSPGVDTQIFEDPREFLS
FT                   HLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSR
FT                   EAIQRELELPQKQGEPLDQFLWRKRDLYQTLYVDAEEEEIIQYVVGTLQPKLKRFLRHP
FT                   LPKTLEQLIQRGMEVQDGLEQAAEPSGTPLPTEDETEALTPALTSESVASDRTQPE"
FT   gap             24892899..24892992
FT                   /estimated_length=94
FT   gap             24898400..24898746
FT                   /estimated_length=347
FT   gap             24901217..24902067
FT                   /estimated_length=851
FT   gap             24905798..24908461
FT                   /estimated_length=2664
FT   gap             24916407..24917900
FT                   /estimated_length=1494
FT   gene            complement(24922816..24929702)
FT                   /gene="Jrk"
FT                   /locus_tag="mCG_2781"
FT                   /note="gene_id=mCG2781.2"
FT   mRNA            complement(join(24922816..24928268,24929651..24929702))
FT                   /gene="Jrk"
FT                   /locus_tag="mCG_2781"
FT                   /product="jerky"
FT                   /note="gene_id=mCG2781.2 transcript_id=mCT2171.2 created on
FT                   29-NOV-2004"
FT   CDS             complement(24926165..24927838)
FT                   /codon_start=1
FT                   /gene="Jrk"
FT                   /locus_tag="mCG_2781"
FT                   /product="jerky"
FT                   /note="gene_id=mCG2781.2 transcript_id=mCT2171.2
FT                   protein_id=mCP9202.2"
FT                   /db_xref="GOA:Q543Z9"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:106214"
FT                   /db_xref="UniProtKB/TrEMBL:Q543Z9"
FT                   /protein_id="EDL29437.1"
FT                   /translation="MASKQAAAKGKGEKRKRVVLTLKEKIDICTRLERGESRKALMQEY
FT                   NVGMSTLYDIKAHKAQLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEG
FT                   IPVSGPMLIEKAKDFYKQMRLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAE
FT                   QFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSAPDDGTVPHFKQGKDRLTVLMCA
FT                   NATGSHRIKPLAIGKGGGPRAFRGIQHLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVRE
FT                   HFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSLLQPTEQGIRRAFM
FT                   RLFINPPVAFQGFPTRHNINDAIVNVARAWNAVPSQVFQRAWRKLWPTVTFTEGSSSEE
FT                   EAECCAIKPHKTFAHILGLVKEGPTCSGSRLQDSRVEERVVAGRDIDEAPAIVAPSQAT
FT                   RCTKKSEKDTGETEEAAWEQAATSFEALVRFAERQPCFSVQEMGQLQALHTVFRRQQQL
FT                   RQPRVALRAVIKLEALQEHPGVCVATTHPTLPCSSTAGDN"
FT   gene            24929564..24930778
FT                   /gene="4933427E11Rik"
FT                   /locus_tag="mCG_1050592"
FT                   /note="gene_id=mCG1050592.0"
FT   mRNA            24929564..24930778
FT                   /gene="4933427E11Rik"
FT                   /locus_tag="mCG_1050592"
FT                   /product="RIKEN cDNA 4933427E11"
FT                   /note="gene_id=mCG1050592.0 transcript_id=mCT194622.0
FT                   created on 29-NOV-2004"
FT   CDS             24929588..24930091
FT                   /codon_start=1
FT                   /gene="4933427E11Rik"
FT                   /locus_tag="mCG_1050592"
FT                   /product="RIKEN cDNA 4933427E11"
FT                   /note="gene_id=mCG1050592.0 transcript_id=mCT194622.0
FT                   protein_id=mCP115651.0"
FT                   /db_xref="GOA:G3X9E1"
FT                   /db_xref="MGI:MGI:1914019"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9E1"
FT                   /protein_id="EDL29438.1"
FT                   /translation="MSLQVSRRRRRPSPARPSPTHLRTPCRRYRPETPATQLSTGPLFS
FT                   AFPDPLPGDALDHRETSVSVVSRSLRGDQARKRSGPSGSASGRTTKATGRFAFPEERNL
FT                   RAERPILGAMARRARTEGWVQRHLAVGGTQGPPVARTPFPSLWTLLLARIQNVSNLDDA
FT                   DDEI"
FT   gene            24935242..24937202
FT                   /gene="Psca"
FT                   /locus_tag="mCG_2793"
FT                   /note="gene_id=mCG2793.3"
FT   mRNA            join(24935242..24935310,24936425..24936532,
FT                   24936790..24937043,24937180..24937202)
FT                   /gene="Psca"
FT                   /locus_tag="mCG_2793"
FT                   /product="prostate stem cell antigen"
FT                   /note="gene_id=mCG2793.3 transcript_id=mCT2160.2 created on
FT                   11-NOV-2002"
FT   CDS             join(24935259..24935310,24936425..24936532,
FT                   24936790..24937001)
FT                   /codon_start=1
FT                   /gene="Psca"
FT                   /locus_tag="mCG_2793"
FT                   /product="prostate stem cell antigen"
FT                   /note="gene_id=mCG2793.3 transcript_id=mCT2160.2
FT                   protein_id=mCP9208.1"
FT                   /db_xref="GOA:Q9D7U0"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="InterPro:IPR018363"
FT                   /db_xref="MGI:MGI:1919623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D7U0"
FT                   /protein_id="EDL29439.1"
FT                   /translation="MKTVFFLLLATYLALHPGAALQCYSCTAQMNNRDCLNVQNCSLDQ
FT                   HSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVNGAHTLKPPT
FT                   TLGLLTVLCSLLLWGSSRL"
FT   gene            24941622..24944648
FT                   /gene="4930572J05Rik"
FT                   /locus_tag="mCG_2788"
FT                   /note="gene_id=mCG2788.1"
FT   mRNA            join(24941622..24942215,24943868..24944648)
FT                   /gene="4930572J05Rik"
FT                   /locus_tag="mCG_2788"
FT                   /product="RIKEN cDNA 4930572J05"
FT                   /note="gene_id=mCG2788.1 transcript_id=mCT2168.1 created on
FT                   16-OCT-2002"
FT   CDS             join(24941703..24942215,24943868..24943978)
FT                   /codon_start=1
FT                   /gene="4930572J05Rik"
FT                   /locus_tag="mCG_2788"
FT                   /product="RIKEN cDNA 4930572J05"
FT                   /note="gene_id=mCG2788.1 transcript_id=mCT2168.1
FT                   protein_id=mCP9205.2"
FT                   /protein_id="EDL29440.1"
FT                   /translation="MLELLVASLSLALAFFALLDGWYLVRVPCAVLRARLLQPRVRDLL
FT                   AEQRYAGRVLPSDLDLLLHMNNARYLREADVARAAHLTRCGVLGALRDLNAHTVLAASC
FT                   ARYRRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRV
FT                   VQHLCKRRVEPPELPEDLKHWISYNETSSQLLRAESGLSDRKDQ"
FT   gap             24944655..24945160
FT                   /estimated_length=506
FT   gene            complement(24946961..24948419)
FT                   /gene="Slurp1"
FT                   /locus_tag="mCG_2780"
FT                   /note="gene_id=mCG2780.2"
FT   mRNA            complement(join(24946961..24947355,24947875..24947994,
FT                   24948334..24948419))
FT                   /gene="Slurp1"
FT                   /locus_tag="mCG_2780"
FT                   /product="secreted Ly6/Plaur domain containing 1"
FT                   /note="gene_id=mCG2780.2 transcript_id=mCT2177.1 created on
FT                   14-AUG-2002"
FT   CDS             complement(join(24947201..24947355,24947875..24947994,
FT                   24948334..24948391))
FT                   /codon_start=1
FT                   /gene="Slurp1"
FT                   /locus_tag="mCG_2780"
FT                   /product="secreted Ly6/Plaur domain containing 1"
FT                   /note="gene_id=mCG2780.2 transcript_id=mCT2177.1
FT                   protein_id=mCP9200.1"
FT                   /protein_id="EDL29441.1"
FT                   /translation="MTLRWAMWLLLLAAWSMGYGEAFRCYTCEQPTAINSCKNIAQCKM
FT                   EDTACKTVLETVEAAFPFNHSPMVTRSCSSSCLATDPDGIGVAHPVFCCFRDLCNSGFP
FT                   GFVAGL"
FT   gap             24949301..24949439
FT                   /estimated_length=139
FT   gene            complement(24952716..24954784)
FT                   /locus_tag="mCG_2799"
FT                   /note="gene_id=mCG2799.1"
FT   mRNA            complement(join(24952716..24953008,24953436..24953555,
FT                   24954699..24954784))
FT                   /locus_tag="mCG_2799"
FT                   /product="mCG2799"
FT                   /note="gene_id=mCG2799.1 transcript_id=mCT2163.1 created on
FT                   16-OCT-2002"
FT   CDS             complement(join(24952803..24953008,24953436..24953555,
FT                   24954699..24954756))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2799"
FT                   /product="mCG2799"
FT                   /note="gene_id=mCG2799.1 transcript_id=mCT2163.1
FT                   protein_id=mCP9199.1"
FT                   /protein_id="EDL29442.1"
FT                   /translation="MQGTWMVLLALILGTFGELAMALQCYTCANPVSASNCVTTTHCHI
FT                   NETMCKTTLYSLEIVFPFLGDSTVTKSCASKCEPSDVDGIGQTRPVSCCNSDLCNVDGA
FT                   PSLGSPGGLLLALALFLLLGVLL"
FT   gap             24957258..24957277
FT                   /estimated_length=20
FT   gap             24962264..24962299
FT                   /estimated_length=36
FT   gene            complement(24963183..24967112)
FT                   /locus_tag="mCG_2795"
FT                   /note="gene_id=mCG2795.2"
FT   mRNA            complement(join(24963183..24963552,24963804..24963908,
FT                   24967043..24967112))
FT                   /locus_tag="mCG_2795"
FT                   /product="mCG2795"
FT                   /note="gene_id=mCG2795.2 transcript_id=mCT2162.2 created on
FT                   16-OCT-2002"
FT   CDS             complement(join(24963416..24963552,24963804..24963908,
FT                   24967043..24967094))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2795"
FT                   /product="mCG2795"
FT                   /note="gene_id=mCG2795.2 transcript_id=mCT2162.2
FT                   protein_id=mCP9209.2"
FT                   /protein_id="EDL29443.1"
FT                   /translation="MRLPFWFLLAVVLSMELAVTQGLQCHLCKGFGGCSRPSSCPWSST
FT                   HCVIIATRSPISFTDLPLVTKMCYSGCPDVSSLGLGPHVSIACCQSNLCNRD"
FT   gene            complement(24968276..24973372)
FT                   /gene="Lynx1"
FT                   /locus_tag="mCG_2778"
FT                   /note="gene_id=mCG2778.0"
FT   mRNA            complement(join(24968276..24971846,24971962..24972063,
FT                   24972274..24972456,24973304..24973372))
FT                   /gene="Lynx1"
FT                   /locus_tag="mCG_2778"
FT                   /product="Ly6/neurotoxin 1"
FT                   /note="gene_id=mCG2778.0 transcript_id=mCT2176.0 created on
FT                   14-AUG-2002"
FT   CDS             complement(join(24971650..24971846,24971962..24972063,
FT                   24972274..24972325))
FT                   /codon_start=1
FT                   /gene="Lynx1"
FT                   /locus_tag="mCG_2778"
FT                   /product="Ly6/neurotoxin 1"
FT                   /note="gene_id=mCG2778.0 transcript_id=mCT2176.0
FT                   protein_id=mCP9197.1"
FT                   /protein_id="EDL29444.1"
FT                   /translation="MTHLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATY
FT                   CMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYYLCNGAGFATPVTLAL
FT                   VPALLATFWSLL"
FT   gene            complement(24982475..24984030)
FT                   /gene="Ly6d"
FT                   /locus_tag="mCG_2777"
FT                   /note="gene_id=mCG2777.1"
FT   mRNA            complement(join(24982475..24983007,24983170..24983268,
FT                   24983928..24984030))
FT                   /gene="Ly6d"
FT                   /locus_tag="mCG_2777"
FT                   /product="lymphocyte antigen 6 complex, locus D"
FT                   /note="gene_id=mCG2777.1 transcript_id=mCT2175.1 created on
FT                   14-AUG-2002"
FT   CDS             complement(join(24982775..24983007,24983170..24983268,
FT                   24983928..24983991))
FT                   /codon_start=1
FT                   /gene="Ly6d"
FT                   /locus_tag="mCG_2777"
FT                   /product="lymphocyte antigen 6 complex, locus D"
FT                   /note="gene_id=mCG2777.1 transcript_id=mCT2175.1
FT                   protein_id=mCP9196.1"
FT                   /protein_id="EDL29445.1"
FT                   /translation="MMFRMKTALLVLLVLAVATSPAWALRCHVCTNSANCKNPQVCPSN
FT                   FYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVSAA
FT                   PGHALLSSVTLGLATSLSLLTVMALCL"
FT   gene            complement(24991332..>24999244)
FT                   /gene="D730001G18Rik"
FT                   /locus_tag="mCG_2798"
FT                   /note="gene_id=mCG2798.2"
FT   mRNA            complement(join(24991332..24992745,24995775..24995873,
FT                   24999171..24999243))
FT                   /gene="D730001G18Rik"
FT                   /locus_tag="mCG_2798"
FT                   /product="RIKEN cDNA D730001G18, transcript variant
FT                   mCT2155"
FT                   /note="gene_id=mCG2798.2 transcript_id=mCT2155.1 created on
FT                   16-OCT-2002"
FT   mRNA            complement(join(24991668..24992745,24999171..>24999244))
FT                   /gene="D730001G18Rik"
FT                   /locus_tag="mCG_2798"
FT                   /product="RIKEN cDNA D730001G18, transcript variant
FT                   mCT174566"
FT                   /note="gene_id=mCG2798.2 transcript_id=mCT174566.0 created
FT                   on 16-OCT-2002"
FT   CDS             complement(join(24992433..24992745,24999171..>24999244))
FT                   /codon_start=1
FT                   /gene="D730001G18Rik"
FT                   /locus_tag="mCG_2798"
FT                   /product="RIKEN cDNA D730001G18, isoform CRA_a"
FT                   /note="gene_id=mCG2798.2 transcript_id=mCT174566.0
FT                   protein_id=mCP97485.0 isoform=CRA_a"
FT                   /protein_id="EDL29446.1"
FT                   /translation="QLLVDIHDEAPPGAVAVGCCVCFSGQSWWHPGHEVLRPNLPQQHR
FT                   VFRWPCPLCLLLSGEPVQPQCCLRPDRQPWGYMGQRLYQPTVGTASSCLVRAWVAFPYH
FT                   RGSVCNLSSILPRPSPGCYSLSHH"
FT   CDS             complement(join(24992537..24992745,24995775..24995873,
FT                   24999171..24999225))
FT                   /codon_start=1
FT                   /gene="D730001G18Rik"
FT                   /locus_tag="mCG_2798"
FT                   /product="RIKEN cDNA D730001G18, isoform CRA_b"
FT                   /note="gene_id=mCG2798.2 transcript_id=mCT2155.1
FT                   protein_id=mCP9194.2 isoform=CRA_b"
FT                   /protein_id="EDL29447.1"
FT                   /translation="MMRPLLVLLLLAVVCASLARALHCHVCCGHENCESLVECALTDKY
FT                   CVITRATNPGGILVMKSCAPTCPNSTVSSDGRALSVSCCQGSQCNRSAASGLTGSLGAI
FT                   WASASISLLWALLRAA"
FT   gene            <25004449..25023007
FT                   /locus_tag="mCG_146026"
FT                   /note="gene_id=mCG146026.0"
FT   mRNA            join(<25004449..25004664,25020938..25021108,
FT                   25021764..25023007)
FT                   /locus_tag="mCG_146026"
FT                   /product="mCG146026"
FT                   /note="gene_id=mCG146026.0 transcript_id=mCT186134.0
FT                   created on 04-JUL-2003"
FT   gap             25006131..25006150
FT                   /estimated_length=20
FT   gap             25007408..25007427
FT                   /estimated_length=20
FT   gap             25008493..25008512
FT                   /estimated_length=20
FT   gene            complement(25019346..25022340)
FT                   /gene="Ly6k"
FT                   /locus_tag="mCG_2790"
FT                   /note="gene_id=mCG2790.1"
FT   mRNA            complement(join(25019346..25019745,25020902..25021000,
FT                   25021786..25021862,25022137..25022340))
FT                   /gene="Ly6k"
FT                   /locus_tag="mCG_2790"
FT                   /product="lymphocyte antigen 6 complex, locus K, transcript
FT                   variant mCT2164"
FT                   /note="gene_id=mCG2790.1 transcript_id=mCT2164.1 created on
FT                   16-OCT-2002"
FT   mRNA            complement(join(25019348..25019745,25020902..25021000,
FT                   25021786..>25021900))
FT                   /gene="Ly6k"
FT                   /locus_tag="mCG_2790"
FT                   /product="lymphocyte antigen 6 complex, locus K, transcript
FT                   variant mCT192598"
FT                   /note="gene_id=mCG2790.1 transcript_id=mCT192598.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(25019438..25019745,25020902..25021000,
FT                   25021786..>25021885))
FT                   /codon_start=1
FT                   /gene="Ly6k"
FT                   /locus_tag="mCG_2790"
FT                   /product="lymphocyte antigen 6 complex, locus K, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2790.1 transcript_id=mCT192598.0
FT                   protein_id=mCP113597.0 isoform=CRA_a"
FT                   /protein_id="EDL29449.1"
FT                   /translation="PLAPFLNRTRHPLEMAFLVALLVVLGLQLVQSNALTCHVCEAQNS
FT                   YACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLI
FT                   EKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPGKASGRRHRYIELLLTGFMVLTANGLS
FT                   ALCLL"
FT   CDS             complement(join(25019438..25019745,25020902..25021000,
FT                   25021786..25021843))
FT                   /codon_start=1
FT                   /gene="Ly6k"
FT                   /locus_tag="mCG_2790"
FT                   /product="lymphocyte antigen 6 complex, locus K, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2790.1 transcript_id=mCT2164.1
FT                   protein_id=mCP9207.1 isoform=CRA_b"
FT                   /protein_id="EDL29450.1"
FT                   /translation="MAFLVALLVVLGLQLVQSNALTCHVCEAQNSYACSNPSQCPGEKK
FT                   FCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQW
FT                   DSCNGEGPPTDQLLKEQPGKASGRRHRYIELLLTGFMVLTANGLSALCLL"
FT   gap             25020307..25020375
FT                   /estimated_length=69
FT   CDS             <25022370..25022729
FT                   /codon_start=1
FT                   /locus_tag="mCG_146026"
FT                   /product="mCG146026"
FT                   /note="gene_id=mCG146026.0 transcript_id=mCT186134.0
FT                   protein_id=mCP107364.0"
FT                   /protein_id="EDL29448.1"
FT                   /translation="PHDSYSHLSKNLLPGSQTPDSPTLTRCGARACVQISSVNEHNMRK
FT                   LLDRRVYGNTAPSDWHRKRVCRFFSLSCPLENSSQTRSHFSCLLLTLLSPHGPVIMFLF
FT                   LFFIFHSCMNSLARI"
FT   gene            complement(25035878..>25039618)
FT                   /locus_tag="mCG_2792"
FT                   /note="gene_id=mCG2792.1"
FT   mRNA            complement(join(25035878..25036321,25038804..25038911,
FT                   25039495..>25039618))
FT                   /locus_tag="mCG_2792"
FT                   /product="mCG2792"
FT                   /note="gene_id=mCG2792.1 transcript_id=mCT2159.1 created on
FT                   14-NOV-2002"
FT   CDS             complement(join(25036026..25036321,25038804..25038911,
FT                   25039495..25039618))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2792"
FT                   /product="mCG2792"
FT                   /note="gene_id=mCG2792.1 transcript_id=mCT2159.1
FT                   protein_id=mCP9193.1"
FT                   /protein_id="EDL29451.1"
FT                   /translation="MLPFFLSILMGLPWVDTSINNTSGLVFDNTTGGLDNAIEPRWTPQ
FT                   MRCHSCQEHNTFYCPHIHYCDMDIRRCLTVAIRVNLRLLYVYKHCTKDCTFIYRRHVPP
FT                   ELPRVLKDVKSFYFVLCCGSVVCNEGGPRNMERDLLGETSIEEEVIARAVSLGWVNLLL
FT                   CLALILSSIILT"
FT   gap             25039630..25040815
FT                   /estimated_length=1186
FT   gene            25041021..25056588
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /note="gene_id=mCG2789.1"
FT   mRNA            join(25041021..25041096,25041106..25041146,
FT                   25042512..25042657,25043241..25043348,25045674..25046116)
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, transcript
FT                   variant mCT171959"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT171959.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(25041038..25041096,25041106..25041146,
FT                   25042496..25042657,25043241..25043348,25056304..25056588)
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, transcript
FT                   variant mCT171960"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT171960.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(25042531..25042657,25043241..25043348,
FT                   25056304..25056353)
FT                   /codon_start=1
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, isoform CRA_b"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT171960.0
FT                   protein_id=mCP94878.0 isoform=CRA_b"
FT                   /protein_id="EDL29453.1"
FT                   /translation="MMLPFFLSILMGLPWVDTSINNTSGLVFDNTTGGLDNAIEPRWSP
FT                   VLTCHKCYISNTFSCPKLSECPSNLRRCMTVSFHVCDGCPRSLEGVSYP"
FT   CDS             join(25042531..25042657,25043241..25043348,
FT                   25045674..25045969)
FT                   /codon_start=1
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, isoform CRA_a"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT171959.0
FT                   protein_id=mCP94879.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8L7"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:1341831"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8L7"
FT                   /protein_id="EDL29452.1"
FT                   /translation="MMLPFFLSILMGLPWVDTSINNTSGLVFDNTTGGLDNAIEPRWSP
FT                   VLTCHKCYISNTFSCPKLSECPSNLRRCMTVSFRVNIRLLYVLKDCTKDCTFIYREHVP
FT                   PELPRVLKDVKNFYFVMCCSSITCNVGGPTNLERDLLDETSIEEEVVARAECLGWVNLL
FT                   LCFALILSSIILT"
FT   gap             25044663..25044682
FT                   /estimated_length=20
FT   mRNA            join(<25044745..25045027,25045674..25046116)
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, transcript
FT                   variant mCT2170"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT2170.0 created on
FT                   06-DEC-2002"
FT   CDS             join(<25045027..25045027,25045674..25045969)
FT                   /codon_start=1
FT                   /gene="Hemt1"
FT                   /locus_tag="mCG_2789"
FT                   /product="hematopoietic cell transcript 1, isoform CRA_c"
FT                   /note="gene_id=mCG2789.1 transcript_id=mCT2170.0
FT                   protein_id=mCP9192.0 isoform=CRA_c"
FT                   /protein_id="EDL29454.1"
FT                   /translation="SVNIRLLYVLKDCTKDCTFIYREHVPPELPRVLKDVKNFYFVMCC
FT                   SSITCNVGGPTNLERDLLDETSIEEEVVARAECLGWVNLLLCFALILSSIILT"
FT   gap             25049225..25049546
FT                   /estimated_length=322
FT   gap             25050278..25050597
FT                   /estimated_length=320
FT   gene            complement(25056609..>25063591)
FT                   /locus_tag="mCG_2782"
FT                   /note="gene_id=mCG2782.1"
FT   mRNA            complement(join(25056609..25057583,25057950..25058138,
FT                   25058226..25058304,25058537..25058703,25060479..25060630,
FT                   25060890..25061093,25061212..25061411,25062795..25062950,
FT                   25063353..>25063591))
FT                   /locus_tag="mCG_2782"
FT                   /product="mCG2782"
FT                   /note="gene_id=mCG2782.1 transcript_id=mCT2172.1 created on
FT                   14-NOV-2002"
FT   CDS             complement(join(25057470..25057583,25057950..25058138,
FT                   25058226..25058304,25058537..25058703,25060479..25060630,
FT                   25060890..25061093,25061212..25061411,25062795..25062950,
FT                   25063353..25063591))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2782"
FT                   /product="mCG2782"
FT                   /note="gene_id=mCG2782.1 transcript_id=mCT2172.1
FT                   protein_id=mCP9198.1"
FT                   /protein_id="EDL29455.1"
FT                   /translation="MALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYS
FT                   RNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVFVTLPEDVEKLYQVE
FT                   STHPCRMPLESWIVHRELRGLGRGVFLLNGPEWYFNRLQLNPNVLSPKAVQKFVPLVDG
FT                   IARDFVDNLKKKMLESVHGSFSMDFQSSVFNYTIEASHFVLFGERLGLIGRDLSPDSLK
FT                   FLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLESWDFISEYVTKCIKNVYRELAEG
FT                   RPQSWSVTAELVAERTLSMDAIQANSMELIAGSTDTTSTPLVMTFFELARNPDVQQALR
FT                   QESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGTFLERILSSDLVLQNYHVPAG
FT                   TVLNVNLYSMGRNPAVFPRPERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEMML
FT                   LLHHVLKSFHVETQEKEDVRMAYRFVLMPSSSPLLTFRPVN"
FT   gap             25059147..25059502
FT                   /estimated_length=356
FT   gene            complement(<25073021..>25078219)
FT                   /locus_tag="mCG_2779"
FT                   /note="gene_id=mCG2779.1"
FT   mRNA            complement(join(<25073021..25073134,25073401..25073589,
FT                   25073677..25073755,25073988..25074154,25075025..25075179,
FT                   25075450..25075653,25075782..25075981,25077418..25077573,
FT                   25077975..>25078219))
FT                   /locus_tag="mCG_2779"
FT                   /product="mCG2779, transcript variant mCT2174"
FT                   /note="gene_id=mCG2779.1 transcript_id=mCT2174.2 created on
FT                   14-AUG-2002"
FT   CDS             complement(join(25073021..25073134,25073401..25073589,
FT                   25073677..25073755,25073988..25074154,25075025..25075179,
FT                   25075450..25075653,25075782..25075981,25077418..25077573,
FT                   25077975..25078219))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2779"
FT                   /product="mCG2779, isoform CRA_b"
FT                   /note="gene_id=mCG2779.1 transcript_id=mCT2174.2
FT                   protein_id=mCP9195.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWE4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002399"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88584"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWE4"
FT                   /protein_id="EDL29457.1"
FT                   /translation="MAMALRVTADVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQ
FT                   YSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVMLPEDAEKLHQ
FT                   VESMLPRRMHLEPWVAHRELRGLRRGVFLLNGPEWRLNRLRLNRNVLSPKAVQKFVPMV
FT                   DMVARDFLETLKEKVLQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLSPGS
FT                   LKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQELR
FT                   LGSSQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQK
FT                   ALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNYHV
FT                   PAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVE
FT                   MMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS"
FT   mRNA            complement(join(<25073021..25073134,25073401..25073589,
FT                   25073677..25073755,25073988..25074294,25075405..25075653,
FT                   25075782..25075981,25077418..25077573,25077975..>25078213))
FT                   /locus_tag="mCG_2779"
FT                   /product="mCG2779, transcript variant mCT171954"
FT                   /note="gene_id=mCG2779.1 transcript_id=mCT171954.0 created
FT                   on 14-AUG-2002"
FT   CDS             complement(join(25073021..25073134,25073401..25073589,
FT                   25073677..25073755,25073988..25074294,25075405..25075653,
FT                   25075782..25075981,25077418..25077573,25077975..25078213))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2779"
FT                   /product="mCG2779, isoform CRA_a"
FT                   /note="gene_id=mCG2779.1 transcript_id=mCT171954.0
FT                   protein_id=mCP94873.0 isoform=CRA_a"
FT                   /protein_id="EDL29456.1"
FT                   /translation="MALRVTADVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYS
FT                   RNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVMLPEDAEKLHQVE
FT                   SMLPRRMHLEPWVAHRELRGLRRGVFLLNGPEWRLNRLRLNRNVLSPKAVQKFVPMVDM
FT                   VARDFLETLKEKVLQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLSPGSLK
FT                   FIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVISEYGEGHYLGRALGQETL
FT                   GPRARIQKSQLPRSLFCYAHVLPPGKGIFVVAMPFGRVSEIAFWLLQTAIPLVMTLFEL
FT                   ARNPDVQKALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSD
FT                   LVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCL
FT                   GRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS"
FT   gap             25086684..25087109
FT                   /estimated_length=426
FT   gap             25091816..25091835
FT                   /estimated_length=20
FT   gap             25093307..25093504
FT                   /estimated_length=198
FT   gap             25094562..25094581
FT                   /estimated_length=20
FT   gap             25096173..25096192
FT                   /estimated_length=20
FT   gap             25097824..25097843
FT                   /estimated_length=20
FT   gap             25099274..25099293
FT                   /estimated_length=20
FT   gene            complement(25102898..25106336)
FT                   /gene="2010109I03Rik"
FT                   /locus_tag="mCG_2787"
FT                   /note="gene_id=mCG2787.1"
FT   mRNA            complement(join(25102898..25104597,25105240..25105338,
FT                   25106246..25106336))
FT                   /gene="2010109I03Rik"
FT                   /locus_tag="mCG_2787"
FT                   /product="RIKEN cDNA 2010109I03"
FT                   /note="gene_id=mCG2787.1 transcript_id=mCT2167.1 created on
FT                   15-AUG-2002"
FT   CDS             complement(join(25104413..25104597,25105240..25105338,
FT                   25106246..25106297))
FT                   /codon_start=1
FT                   /gene="2010109I03Rik"
FT                   /locus_tag="mCG_2787"
FT                   /product="RIKEN cDNA 2010109I03"
FT                   /note="gene_id=mCG2787.1 transcript_id=mCT2167.1
FT                   protein_id=mCP9191.1"
FT                   /db_xref="GOA:Q9CQ11"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:1914288"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQ11"
FT                   /protein_id="EDL29458.1"
FT                   /translation="MRTHLLWLLPLILLGSSAQALKCHECSGIEDCYKPKTCSSQSLYC
FT                   LTNWYTPPGQQTTVTKTCAYTCPDINHVTANSKSSCCNTDLCNSARNLHVSWGLLALGL
FT                   CYIYLSQ"
FT   gap             25105943..25105962
FT                   /estimated_length=20
FT   gap             25108101..25108259
FT                   /estimated_length=159
FT   gap             25129465..25129509
FT                   /estimated_length=45
FT   gap             25138418..25138704
FT                   /estimated_length=287
FT   gap             25153552..25153571
FT                   /estimated_length=20
FT   gap             25160467..25160486
FT                   /estimated_length=20
FT   gap             25161742..25161761
FT                   /estimated_length=20
FT   gap             25162811..25162830
FT                   /estimated_length=20
FT   gap             25164817..25164836
FT                   /estimated_length=20
FT   gap             25173920..25175004
FT                   /estimated_length=1085
FT   gene            25176226..25180382
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /note="gene_id=mCG2785.1"
FT   mRNA            join(25176226..25176386,25176534..25176768,
FT                   25178828..25178928,25179320..25179439,25179544..25180382)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT2165"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT2165.1 created on
FT                   28-FEB-2003"
FT   mRNA            join(25176237..25176386,25176534..25176768,
FT                   25178831..25178928,25179320..25179439,25179544..25180382)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT171955"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171955.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25176243..25176386,25178828..25178928,
FT                   25179320..25179439,25179544..25180173)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT171958"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171958.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25176254..25176386,25176618..25176768,
FT                   25178828..25178928,25179320..25179439,25179544..25180382)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT171957"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171957.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25176292..25176386,25176618..25176768,
FT                   25178466..25178514,25178828..25178928,25179320..25179440,
FT                   25179544..25180382)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT171956"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171956.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25176306..25176386,25176659..25176768,
FT                   25178828..25178928,25179320..25179439,25179544..25180208)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT180755"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT180755.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(<25176719..25176768,25178831..25178928,
FT                   25179320..25180382)
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, transcript
FT                   variant mCT192636"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT192636.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(25178498..25178514,25178828..25178928,
FT                   25179320..25179440,25179544..25179601)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171956.0
FT                   protein_id=mCP94875.0 isoform=CRA_b"
FT                   /protein_id="EDL29460.1"
FT                   /translation="MAWTVSRLLWLANLQQMSATSNMRVFLPVLLAALLGMEQVHSLMC
FT                   FSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGECQPWLHPEQGLLPDLPQ"
FT   CDS             join(25178859..25178928,25179320..25179439,
FT                   25179544..25179764)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171955.0
FT                   protein_id=mCP94874.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99JA5"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:106651"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JA5"
FT                   /protein_id="EDL29459.1"
FT                   /translation="MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPV
FT                   SCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFC
FT                   NFSAAGLGLRASIPLLGLGLLLSLLALLQLSP"
FT   CDS             join(25178859..25178928,25179320..25179439,
FT                   25179544..25179764)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171957.0
FT                   protein_id=mCP94877.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99JA5"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:106651"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JA5"
FT                   /protein_id="EDL29461.1"
FT                   /translation="MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPV
FT                   SCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFC
FT                   NFSAAGLGLRASIPLLGLGLLLSLLALLQLSP"
FT   CDS             join(25178859..25178928,25179320..25179439,
FT                   25179544..25179764)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT171958.0
FT                   protein_id=mCP94876.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99JA5"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:106651"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JA5"
FT                   /protein_id="EDL29462.1"
FT                   /translation="MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPV
FT                   SCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFC
FT                   NFSAAGLGLRASIPLLGLGLLLSLLALLQLSP"
FT   CDS             join(25178859..25178928,25179320..25179439,
FT                   25179544..25179764)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT180755.0
FT                   protein_id=mCP103677.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99JA5"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:106651"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JA5"
FT                   /protein_id="EDL29463.1"
FT                   /translation="MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPV
FT                   SCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFC
FT                   NFSAAGLGLRASIPLLGLGLLLSLLALLQLSP"
FT   CDS             join(25178859..25178928,25179320..25179439,
FT                   25179544..25179764)
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT2165.1
FT                   protein_id=mCP9190.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99JA5"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:106651"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JA5"
FT                   /protein_id="EDL29465.1"
FT                   /translation="MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPV
FT                   SCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFC
FT                   NFSAAGLGLRASIPLLGLGLLLSLLALLQLSP"
FT   CDS             <25179444..25179764
FT                   /codon_start=1
FT                   /gene="Ly6e"
FT                   /locus_tag="mCG_2785"
FT                   /product="lymphocyte antigen 6 complex, locus E, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2785.1 transcript_id=mCT192636.0
FT                   protein_id=mCP113596.0 isoform=CRA_c"
FT                   /protein_id="EDL29464.1"
FT                   /translation="VAACFPSQGQGPAGLSPFPATLSVCPLILTFHAGNVNLGYTLNKG
FT                   CSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQL
FT                   SP"
FT   gene            complement(25200576..25204396)
FT                   /gene="Ly6i"
FT                   /locus_tag="mCG_123006"
FT                   /note="gene_id=mCG123006.0"
FT   mRNA            complement(join(25200576..25201174,25202929..25203045,
FT                   25204034..25204396))
FT                   /gene="Ly6i"
FT                   /locus_tag="mCG_123006"
FT                   /product="lymphocyte antigen 6 complex, locus I"
FT                   /note="gene_id=mCG123006.0 transcript_id=mCT124233.0
FT                   created on 06-DEC-2002"
FT   gene            complement(25200845..25219039)
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /note="gene_id=mCG68209.2"
FT   mRNA            complement(join(25200845..25200876,25216177..25216487,
FT                   25217460..25217576,25218543..25218640,25218856..25218916))
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, transcript
FT                   variant mCT171962"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171962.0 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(25200957..25201174,25202929..25203045,
FT                   25204034..25204103))
FT                   /codon_start=1
FT                   /gene="Ly6i"
FT                   /locus_tag="mCG_123006"
FT                   /product="lymphocyte antigen 6 complex, locus I"
FT                   /note="gene_id=mCG123006.0 transcript_id=mCT124233.0
FT                   protein_id=mCP60371.1"
FT                   /protein_id="EDL29466.1"
FT                   /translation="MDTSHAIKSCVLILLVTLLCAERAQGLECYQCYGVPFETSCPSFT
FT                   CPYPDGFCVAQEEEFIANSQRKKVKSRSCHPFCPDEIEKKFILDPNTKMNISCCQEDLC
FT                   NAAVPTGGSSWTTAGVLLFSLGSVLLQTLM"
FT   gap             25211035..25211054
FT                   /estimated_length=20
FT   mRNA            complement(join(25215973..25216487,25217460..25217576,
FT                   25218543..25218625,25218887..25219039))
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, transcript
FT                   variant mCT171961"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171961.0 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(25215995..25216487,25217460..25217576,
FT                   25218543..25218625,25218871..>25218908))
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, transcript
FT                   variant mCT68396"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT68396.1 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(25216190..25216487,25217460..25217576,
FT                   25218543..25218625,25218861..25218909))
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, transcript
FT                   variant mCT171963"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171963.0 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(25216191..25216487,25217460..25217576,
FT                   25218543..25218625,25218877..25218909))
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, transcript
FT                   variant mCT171964"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171964.0 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(25216270..25216487,25217460..25217576,
FT                   25218543..25218625,25218871..>25218908))
FT                   /codon_start=1
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT68396.1
FT                   protein_id=mCP43387.1 isoform=CRA_b"
FT                   /protein_id="EDL29471.1"
FT                   /translation="LQPCLRGSKDWCDPSLRMDTSHTTKSCLLILLVALLCAERAQGLE
FT                   CYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEI
FT                   LGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAGVLLFSLSSVLLQTLL"
FT   CDS             complement(join(25216270..25216487,25217460..25217576,
FT                   25218543..25218612))
FT                   /codon_start=1
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171961.0
FT                   protein_id=mCP94880.0 isoform=CRA_a"
FT                   /protein_id="EDL29467.1"
FT                   /translation="MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSIT
FT                   CPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLC
FT                   NVAVPNGGSTWTMAGVLLFSLSSVLLQTLL"
FT   CDS             complement(join(25216270..25216487,25217460..25217576,
FT                   25218543..25218612))
FT                   /codon_start=1
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171962.0
FT                   protein_id=mCP94882.0 isoform=CRA_a"
FT                   /protein_id="EDL29468.1"
FT                   /translation="MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSIT
FT                   CPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLC
FT                   NVAVPNGGSTWTMAGVLLFSLSSVLLQTLL"
FT   CDS             complement(join(25216270..25216487,25217460..25217576,
FT                   25218543..25218612))
FT                   /codon_start=1
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171963.0
FT                   protein_id=mCP94883.0 isoform=CRA_a"
FT                   /protein_id="EDL29469.1"
FT                   /translation="MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSIT
FT                   CPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLC
FT                   NVAVPNGGSTWTMAGVLLFSLSSVLLQTLL"
FT   CDS             complement(join(25216270..25216487,25217460..25217576,
FT                   25218543..25218612))
FT                   /codon_start=1
FT                   /gene="Ly6a"
FT                   /locus_tag="mCG_68209"
FT                   /product="lymphocyte antigen 6 complex, locus A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68209.2 transcript_id=mCT171964.0
FT                   protein_id=mCP94881.0 isoform=CRA_a"
FT                   /protein_id="EDL29470.1"
FT                   /translation="MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSIT
FT                   CPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLC
FT                   NVAVPNGGSTWTMAGVLLFSLSSVLLQTLL"
FT   gap             25221523..25221634
FT                   /estimated_length=112
FT   gap             25226914..25227013
FT                   /estimated_length=100
FT   gene            25228066..25246758
FT                   /locus_tag="mCG_1051064"
FT                   /note="gene_id=mCG1051064.0"
FT   mRNA            join(25228066..25228198,25233679..25233782,
FT                   25245094..25246758)
FT                   /locus_tag="mCG_1051064"
FT                   /product="mCG1051064"
FT                   /note="gene_id=mCG1051064.0 transcript_id=mCT194853.0
FT                   created on 27-JAN-2005"
FT   gap             25236493..25237074
FT                   /estimated_length=582
FT   gap             25239940..25240558
FT                   /estimated_length=619
FT   gap             25244233..25244534
FT                   /estimated_length=302
FT   CDS             25245451..25245660
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051064"
FT                   /product="mCG1051064"
FT                   /note="gene_id=mCG1051064.0 transcript_id=mCT194853.0
FT                   protein_id=mCP115882.0"
FT                   /protein_id="EDL29472.1"
FT                   /translation="MENEKKKKKKRKMIFETLISSFPGIYEQFLWGKTTAFSYKTTVVT
FT                   KQENSMSYTRIQAITETPDLGKKP"
FT   gap             25246764..25246783
FT                   /estimated_length=20
FT   gap             25247961..25247980
FT                   /estimated_length=20
FT   gap             25249337..25253240
FT                   /estimated_length=3904
FT   gap             25254610..25254629
FT                   /estimated_length=20
FT   gap             25258105..25258124
FT                   /estimated_length=20
FT   gap             25259297..25259316
FT                   /estimated_length=20
FT   gap             25260435..25260454
FT                   /estimated_length=20
FT   gap             25261491..25261540
FT                   /estimated_length=50
FT   gap             25262908..25263822
FT                   /estimated_length=915
FT   gap             25265944..25271296
FT                   /estimated_length=5353
FT   gap             25272007..25272682
FT                   /estimated_length=676
FT   gap             25275075..25275114
FT                   /estimated_length=40
FT   gap             25278143..25278162
FT                   /estimated_length=20
FT   gap             25281373..25281392
FT                   /estimated_length=20
FT   gap             25282808..25282904
FT                   /estimated_length=97
FT   gap             25284640..25290072
FT                   /estimated_length=5433
FT   gap             25293608..25293627
FT                   /estimated_length=20
FT   gap             25315906..25316257
FT                   /estimated_length=352
FT   gap             25318506..25320988
FT                   /estimated_length=2483
FT   gap             25328399..25328418
FT                   /estimated_length=20
FT   gap             25329769..25329788
FT                   /estimated_length=20
FT   gap             25331768..25331788
FT                   /estimated_length=21
FT   gene            complement(25333344..25333938)
FT                   /locus_tag="mCG_147992"
FT                   /note="gene_id=mCG147992.0"
FT   mRNA            complement(25333344..25333938)
FT                   /locus_tag="mCG_147992"
FT                   /product="mCG147992"
FT                   /note="gene_id=mCG147992.0 transcript_id=mCT188255.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(25333382..25333528)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147992"
FT                   /product="mCG147992"
FT                   /note="gene_id=mCG147992.0 transcript_id=mCT188255.0
FT                   protein_id=mCP108953.0"
FT                   /protein_id="EDL29473.1"
FT                   /translation="MPFSCGSLFLALEACAQHMQQAVFQGIILSPSTHKYLGSCRVPMC
FT                   ACQ"
FT   gap             25334242..25334261
FT                   /estimated_length=20
FT   gap             25335520..25339842
FT                   /estimated_length=4323
FT   gap             25341468..25341487
FT                   /estimated_length=20
FT   gap             25364525..25364694
FT                   /estimated_length=170
FT   gap             25367441..25367747
FT                   /estimated_length=307
FT   gap             25369077..25369096
FT                   /estimated_length=20
FT   gap             25370204..25370223
FT                   /estimated_length=20
FT   gap             25377718..25382271
FT                   /estimated_length=4554
FT   gap             25392544..25392563
FT                   /estimated_length=20
FT   gap             25396014..25396033
FT                   /estimated_length=20
FT   gap             25403678..25403697
FT                   /estimated_length=20
FT   gap             25405073..25405092
FT                   /estimated_length=20
FT   gap             25425603..25428019
FT                   /estimated_length=2417
FT   gap             25429107..25432758
FT                   /estimated_length=3652
FT   gap             25433771..25433790
FT                   /estimated_length=20
FT   gap             25439004..25443006
FT                   /estimated_length=4003
FT   gene            25487440..25491144
FT                   /gene="Ly6f"
FT                   /locus_tag="mCG_5457"
FT                   /note="gene_id=mCG5457.0"
FT   mRNA            join(25487440..25487499,25487721..25487818,
FT                   25488799..25488915,25490652..25491144)
FT                   /gene="Ly6f"
FT                   /locus_tag="mCG_5457"
FT                   /product="lymphocyte antigen 6 complex, locus F"
FT                   /note="gene_id=mCG5457.0 transcript_id=mCT5006.0 created on
FT                   15-AUG-2002"
FT   CDS             join(25487749..25487818,25488799..25488915,
FT                   25490652..25490869)
FT                   /codon_start=1
FT                   /gene="Ly6f"
FT                   /locus_tag="mCG_5457"
FT                   /product="lymphocyte antigen 6 complex, locus F"
FT                   /note="gene_id=mCG5457.0 transcript_id=mCT5006.0
FT                   protein_id=mCP17885.1"
FT                   /protein_id="EDL29474.1"
FT                   /translation="MDSCHTTKSCVLILLVVLLCAERAQGLECYNCLGVSLGIACKSIT
FT                   CPYPDAVCISQQVELIVDSQRRKVKNKLCFPFCPANLENMEILGTTVNVNTSCCKEDLC
FT                   NAPFSTGGSTWTMTRVLLLNLGSVFLQTLL"
FT   gap             25526472..25526491
FT                   /estimated_length=20
FT   gap             25598270..25604376
FT                   /estimated_length=6107
FT   gap             25622610..25622629
FT                   /estimated_length=20
FT   gene            complement(25642169..25646292)
FT                   /locus_tag="mCG_22120"
FT                   /note="gene_id=mCG22120.1"
FT   mRNA            complement(join(25642169..25642741,25644481..25644591,
FT                   25645930..25646012,25646271..25646292))
FT                   /locus_tag="mCG_22120"
FT                   /product="mCG22120"
FT                   /note="gene_id=mCG22120.1 transcript_id=mCT23885.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(25642587..25642741,25644481..25644591,
FT                   25645930..25645999))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22120"
FT                   /product="mCG22120"
FT                   /note="gene_id=mCG22120.1 transcript_id=mCT23885.2
FT                   protein_id=mCP17785.2"
FT                   /protein_id="EDL29475.1"
FT                   /translation="MDNSHATKSCVLILLVALLRAERVQGLECYQCFDVPLETSCNTTT
FT                   CLNGWCVIQIIEIIEDSQRKKAKNSYCFSICPTNKYFTILDATVSVKSFCCKEDLCNAE
FT                   IATGSSS"
FT   gap             25663812..25663831
FT                   /estimated_length=20
FT   gap             25669471..25669573
FT                   /estimated_length=103
FT   gap             25680811..25680830
FT                   /estimated_length=20
FT   gap             25706792..25706960
FT                   /estimated_length=169
FT   gap             25710520..25710555
FT                   /estimated_length=36
FT   gap             25719682..25720879
FT                   /estimated_length=1198
FT   gap             25732520..25732590
FT                   /estimated_length=71
FT   gap             25739399..25740953
FT                   /estimated_length=1555
FT   gap             25741923..25744223
FT                   /estimated_length=2301
FT   gap             25745087..25745342
FT                   /estimated_length=256
FT   gap             25746592..25746637
FT                   /estimated_length=46
FT   gap             25759038..25760033
FT                   /estimated_length=996
FT   gene            complement(25780950..25783028)
FT                   /gene="Ly6h"
FT                   /locus_tag="mCG_22121"
FT                   /note="gene_id=mCG22121.2"
FT   mRNA            complement(join(25780950..25781250,25781492..25781608,
FT                   25782041..25782168,25782906..25783028))
FT                   /gene="Ly6h"
FT                   /locus_tag="mCG_22121"
FT                   /product="lymphocyte antigen 6 complex, locus H, transcript
FT                   variant mCT171952"
FT                   /note="gene_id=mCG22121.2 transcript_id=mCT171952.0 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(25780987..25781250,25781492..25781608,
FT                   25782041..25782168,25782705..25782994))
FT                   /gene="Ly6h"
FT                   /locus_tag="mCG_22121"
FT                   /product="lymphocyte antigen 6 complex, locus H, transcript
FT                   variant mCT23886"
FT                   /note="gene_id=mCG22121.2 transcript_id=mCT23886.2 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(25781015..25781250,25781492..25781608,
FT                   25782041..25782107))
FT                   /codon_start=1
FT                   /gene="Ly6h"
FT                   /locus_tag="mCG_22121"
FT                   /product="lymphocyte antigen 6 complex, locus H, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22121.2 transcript_id=mCT171952.0
FT                   protein_id=mCP94871.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:1346030"
FT                   /db_xref="UniProtKB/TrEMBL:Q544M1"
FT                   /protein_id="EDL29476.1"
FT                   /translation="MLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQ
FT                   PTDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCC
FT                   EKDLCNGASVAGRSPWALAGGLLLSLGPALLWAGP"
FT   CDS             complement(join(25781015..25781250,25781492..25781608,
FT                   25782041..25782107))
FT                   /codon_start=1
FT                   /gene="Ly6h"
FT                   /locus_tag="mCG_22121"
FT                   /product="lymphocyte antigen 6 complex, locus H, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22121.2 transcript_id=mCT23886.2
FT                   protein_id=mCP17895.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001526"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:1346030"
FT                   /db_xref="UniProtKB/TrEMBL:Q544M1"
FT                   /protein_id="EDL29477.1"
FT                   /translation="MLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQ
FT                   PTDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCC
FT                   EKDLCNGASVAGRSPWALAGGLLLSLGPALLWAGP"
FT   gap             25782271..25782704
FT                   /estimated_length=434
FT   gap             25804930..25805068
FT                   /estimated_length=139
FT   gene            25812258..25815098
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /note="gene_id=mCG22115.1"
FT   mRNA            join(25812258..25812347,25812648..25812770,
FT                   25813130..25813246,25813347..25813956)
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, transcript
FT                   variant mCT23879"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT23879.1 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25812270..25812347,25812648..25812770,
FT                   25813130..25813246,25813764..25815098)
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, transcript
FT                   variant mCT180750"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT180750.0 created
FT                   on 28-FEB-2003"
FT   mRNA            join(25812284..25812347,25812648..25812770,
FT                   25813130..25813246,25813708..25813830)
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, transcript
FT                   variant mCT174559"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT174559.0 created
FT                   on 28-FEB-2003"
FT   CDS             join(25812296..25812347,25812648..25812770,
FT                   25813130..25813246,25813764..25813807)
FT                   /codon_start=1
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT180750.0
FT                   protein_id=mCP103672.0 isoform=CRA_c"
FT                   /protein_id="EDL29480.1"
FT                   /translation="MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEE
FT                   EEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTGRPGLSF
FT                   LTTSFRE"
FT   CDS             join(25812296..25812347,25812648..25812770,
FT                   25813130..25813246,25813708..25813787)
FT                   /codon_start=1
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT174559.0
FT                   protein_id=mCP97478.0 isoform=CRA_a"
FT                   /protein_id="EDL29478.1"
FT                   /translation="MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEE
FT                   EEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTASSLVCG
FT                   RQGPEDPFSSNQDALASPS"
FT   CDS             join(25812296..25812347,25812648..25812770,
FT                   25813130..25813246,25813347..25813741)
FT                   /codon_start=1
FT                   /gene="Gpihbp1"
FT                   /locus_tag="mCG_22115"
FT                   /product="GPI-anchored HDL-binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22115.1 transcript_id=mCT23879.1
FT                   protein_id=mCP17861.1 isoform=CRA_b"
FT                   /protein_id="EDL29479.1"
FT                   /translation="MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEE
FT                   EEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTT
FT                   YSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRH
FT                   PQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQGSGAGYPSGWTKFGNIALLLSFFTC
FT                   LWASGA"
FT   gene            25832335..25863054
FT                   /locus_tag="mCG_22117"
FT                   /note="gene_id=mCG22117.1"
FT   mRNA            join(25832335..25832437,25833661..25834391,
FT                   25858045..25858128,25860966..25861061,25862081..25863054)
FT                   /locus_tag="mCG_22117"
FT                   /product="mCG22117"
FT                   /note="gene_id=mCG22117.1 transcript_id=mCT23882.2 created
FT                   on 16-OCT-2002"
FT   CDS             join(25833818..25834391,25858045..25858128,
FT                   25860966..25861061,25862081..25862163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22117"
FT                   /product="mCG22117"
FT                   /note="gene_id=mCG22117.1 transcript_id=mCT23882.2
FT                   protein_id=mCP17880.2"
FT                   /protein_id="EDL29481.1"
FT                   /translation="MEKPATRKKKSQAPKEEAGAQKATVKGEKTSKGKKATKKPRKPRR
FT                   PRKEPVLSPEDEAHIFDAFDASFKDDFEGVPVFVPFQRKKPYECGECGRIFKHKTDHIR
FT                   HQRVHTGEKPFKCDQCGKTFRHSSDVTKHQRIHTGEKPFKCGECGKAFNCGSNLLKHQK
FT                   THTGEKPYGCEECGKSFAYSSCLIRHRKQTPGIGGGASQRPSTSGRRERAASSHSQGSP
FT                   CSSSEVPSQTADPDLQDIEEVKITRDTWLAPAHPHGRSPTPAASAARASGAGGASC"
FT   gene            complement(25847586..25851527)
FT                   /locus_tag="mCG_147999"
FT                   /note="gene_id=mCG147999.0"
FT   mRNA            complement(join(25847586..25850352,25851448..25851527))
FT                   /locus_tag="mCG_147999"
FT                   /product="mCG147999"
FT                   /note="gene_id=mCG147999.0 transcript_id=mCT188262.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(25849708..25849911)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147999"
FT                   /product="mCG147999"
FT                   /note="gene_id=mCG147999.0 transcript_id=mCT188262.0
FT                   protein_id=mCP108966.0"
FT                   /protein_id="EDL29482.1"
FT                   /translation="MGKVGCGCVQDPCEMSLDSSCLFKGMECAAATRLSLLCVFLFSVC
FT                   MCLCPPFNVFLPALFPSIDQWL"
FT   gap             25861246..25861265
FT                   /estimated_length=20
FT   gene            complement(25872666..25894523)
FT                   /gene="Top1mt"
FT                   /locus_tag="mCG_22114"
FT                   /note="gene_id=mCG22114.1"
FT   mRNA            complement(join(25872666..25872846,25873316..25873462,
FT                   25878988..25879082,25879647..25879774,25881219..25881333,
FT                   25881885..25881953,25883052..25883237,25883454..25883597,
FT                   25884258..25884402,25884919..25885106,25885694..25885816,
FT                   25890046..25890167,25891773..25891885,25894407..25894523))
FT                   /gene="Top1mt"
FT                   /locus_tag="mCG_22114"
FT                   /product="DNA topoisomerase 1, mitochondrial"
FT                   /note="gene_id=mCG22114.1 transcript_id=mCT23880.2 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(25872744..25872846,25873316..25873462,
FT                   25878988..25879082,25879647..25879774,25881219..25881333,
FT                   25881885..25881953,25883052..25883237,25883454..25883597,
FT                   25884258..25884402,25884919..25885106,25885694..25885816,
FT                   25890046..25890167,25891773..25891885,25894407..25894510))
FT                   /codon_start=1
FT                   /gene="Top1mt"
FT                   /locus_tag="mCG_22114"
FT                   /product="DNA topoisomerase 1, mitochondrial"
FT                   /note="gene_id=mCG22114.1 transcript_id=mCT23880.2
FT                   protein_id=mCP17841.2"
FT                   /db_xref="GOA:Q8R4U6"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="MGI:MGI:1920210"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4U6"
FT                   /protein_id="EDL29483.1"
FT                   /translation="MLLLWLRALCRRFQHVPCRVPSCQVSRVAKANRAGWEETSKSSVK
FT                   WRQLEHKGPYFTPAYEPLPDGVHFLYDGKPLKLSLAAEEVATFYGKMLHLECTSKEVFR
FT                   RNFFSDWRKEMTPEERRLITHLDKCDFTEIHKHFLERAEARRTLPREQKQKLKEEAEKL
FT                   QQEFGYCVLDGHREKIGNFKTEPPGLFRGRGDHPKMGMLKRRVMPEDVVINCSRDSKIP
FT                   EPPAGHQWKEVRSDNTVMWLAAWVEHIQNSFKYVILNPSSKPKGEMDWQKYEVARRLKG
FT                   VVDKIRAQYQADWKSPEMKKRQLAVALYFIDKLALRTGNEKEEGETADTVGCCSLRVEH
FT                   IRLHAPAGGQEHVVELDFLGKDSIRYKNHVTVEKLVFQNLQHFMEDKDPRDDLFDALTT
FT                   SSLNKHLQDLMEGLTAKVFRTYNASVTLQEQLRVLTRAEDSVTCKVLAYNRANRAVAVL
FT                   CNHQRAVPKTFEKSMQTLQKKIETKKAQVAEAQVELQKAETDLRMRGDSKPKSFLQKQR
FT                   RLLKLEEQLARLCAKATDKEENKQVALGTAKLNYLDPRISIAWCKRFGVPVEKIYNKTQ
FT                   RERFAWAFNQAGEDFEF"
FT   gene            25877039..25883477
FT                   /locus_tag="mCG_1051068"
FT                   /note="gene_id=mCG1051068.0"
FT   mRNA            join(25877039..25877276,25878590..25879168,
FT                   25879832..25883477)
FT                   /locus_tag="mCG_1051068"
FT                   /product="mCG1051068"
FT                   /note="gene_id=mCG1051068.0 transcript_id=mCT194857.0
FT                   created on 27-JAN-2005"
FT   CDS             25880230..25880652
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051068"
FT                   /product="mCG1051068"
FT                   /note="gene_id=mCG1051068.0 transcript_id=mCT194857.0
FT                   protein_id=mCP115886.0"
FT                   /protein_id="EDL29484.1"
FT                   /translation="MTINPEALCSVHPALLSKVLTNYIPERLNPGSGSRATHLHGLAPT
FT                   QRILRPGGHSYKIYKTTPGNRILRVFVCLFVCSFFPGLGLKDALLVAPASGFLWQAPLK
FT                   GFLPALLPLMHERCLQGHTAHWLQVRQTGYLGLVGE"
FT   gap             25889453..25889659
FT                   /estimated_length=207
FT   gap             25899615..25899688
FT                   /estimated_length=74
FT   gap             25916866..25917195
FT                   /estimated_length=330
FT   gap             25919279..25919405
FT                   /estimated_length=127
FT   gene            <25920379..25930457
FT                   /gene="Rhpn1"
FT                   /locus_tag="mCG_22116"
FT                   /note="gene_id=mCG22116.3"
FT   mRNA            join(<25920379..25920524,25924221..25924336,
FT                   25925039..25925167,25925287..25925362,25926064..25926141,
FT                   25926505..25926629,25926716..25926882,25927038..25927231,
FT                   25927604..25927760,25927841..25927948,25928342..25928501,
FT                   25929052..25929128,25929269..25929661,25930102..25930457)
FT                   /gene="Rhpn1"
FT                   /locus_tag="mCG_22116"
FT                   /product="rhophilin, Rho GTPase binding protein 1,
FT                   transcript variant mCT192625"
FT                   /note="gene_id=mCG22116.3 transcript_id=mCT192625.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<25920381..25920524,25924221..25924336,
FT                   25925039..25925167,25925287..25925362,25926064..25926141,
FT                   25926505..25926629,25926716..25926882,25927038..25927231,
FT                   25927604..25927760,25927841..25927948,25928342..25928466)
FT                   /codon_start=1
FT                   /gene="Rhpn1"
FT                   /locus_tag="mCG_22116"
FT                   /product="rhophilin, Rho GTPase binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22116.3 transcript_id=mCT192625.0
FT                   protein_id=mCP113578.0 isoform=CRA_a"
FT                   /protein_id="EDL29485.1"
FT                   /translation="SLEREGPAARSLSESASERAAMILEERPDGQGTGEESSRPQDDGS
FT                   IRKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSY
FT                   VNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFG
FT                   EDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFH
FT                   WYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAF
FT                   RLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQE
FT                   AAQVATEYGLVHRAMAQPPVRDYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKG
FT                   ELARQEHVFQPSTPHEPLGPTLPQHPEDRRKLGGGAAASHLVQSPAQGGPAAGCGDSGT
FT                   AALPGQVLTARARG"
FT   mRNA            join(<25920444..25920524,25924221..25924336,
FT                   25925039..25925167,25925287..25925362,25926064..25926141,
FT                   25926505..25926629,25926716..25926882,25927038..25927231,
FT                   25927604..25927760,25927841..25927948,25928307..25928501,
FT                   25929052..25929074,25929269..25929415,25929500..25929661,
FT                   25930102..25930454)
FT                   /gene="Rhpn1"
FT                   /locus_tag="mCG_22116"
FT                   /product="rhophilin, Rho GTPase binding protein 1,
FT                   transcript variant mCT23881"
FT                   /note="gene_id=mCG22116.3 transcript_id=mCT23881.1 created
FT                   on 15-AUG-2002"
FT   CDS             join(25920444..25920524,25924221..25924336,
FT                   25925039..25925167,25925287..25925362,25926064..25926141,
FT                   25926505..25926629,25926716..25926882,25927038..25927231,
FT                   25927604..25927760,25927841..25927948,25928307..25928501,
FT                   25929052..25929074,25929269..25929415,25929500..25929661,
FT                   25930102..25930275)
FT                   /codon_start=1
FT                   /gene="Rhpn1"
FT                   /locus_tag="mCG_22116"
FT                   /product="rhophilin, Rho GTPase binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22116.3 transcript_id=mCT23881.1
FT                   protein_id=mCP17813.1 isoform=CRA_b"
FT                   /protein_id="EDL29486.1"
FT                   /translation="MILEERPDGQGTGEESSRPQDDGSIRKGYGSFVQNQPGQLQSHRA
FT                   RLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDV
FT                   DQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATR
FT                   TPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGS
FT                   VLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLS
FT                   MLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQPPVR
FT                   DYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPLGPT
FT                   LPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLRKVDLLQVVVTQALRRSLAKYSQ
FT                   LEREDDFFEATEAPDIQPKTHQTPEGPLSVFSTKNRWQLVGPVHMTRGEGGFGFTLRGD
FT                   SPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVS
FT                   LLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCT
FT                   NRNCVTCP"
FT   gap             25947473..25947492
FT                   /estimated_length=20
FT   gap             25956338..25956429
FT                   /estimated_length=92
FT   gap             25962658..25962802
FT                   /estimated_length=145
FT   gene            complement(<25963002..>25963436)
FT                   /gene="Mafa"
FT                   /locus_tag="mCG_22118"
FT                   /note="gene_id=mCG22118.2"
FT   mRNA            complement(<25963002..>25963436)
FT                   /gene="Mafa"
FT                   /locus_tag="mCG_22118"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein A (avian)"
FT                   /note="gene_id=mCG22118.2 transcript_id=mCT23883.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(25963002..>25963436)
FT                   /codon_start=1
FT                   /gene="Mafa"
FT                   /locus_tag="mCG_22118"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein A (avian)"
FT                   /note="gene_id=mCG22118.2 transcript_id=mCT23883.2
FT                   protein_id=mCP17899.2"
FT                   /protein_id="EDL29487.1"
FT                   /translation="AGHGGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIR
FT                   LKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEK
FT                   YEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFFL"
FT   gap             25963441..25964447
FT                   /estimated_length=1007
FT   gap             25967325..25967700
FT                   /estimated_length=376
FT   gap             25968509..25968611
FT                   /estimated_length=103
FT   gene            complement(25970686..>26058089)
FT                   /locus_tag="mCG_141533"
FT                   /note="gene_id=mCG141533.0"
FT   mRNA            complement(join(25970686..25971204,25972877..25973220,
FT                   25973794..25973978,25993295..25993426,25995371..25995440,
FT                   25995585..25995743,25995819..25995861,26001758..26001942,
FT                   26025835..26025985,26053776..26053972,26055565..26056055,
FT                   26056189..26056748,26058034..>26058089))
FT                   /locus_tag="mCG_141533"
FT                   /product="mCG141533"
FT                   /note="gene_id=mCG141533.0 transcript_id=mCT175824.0
FT                   created on 09-DEC-2002"
FT   CDS             complement(join(25971173..25971204,25972877..25973220,
FT                   25973794..25973978,25993295..25993426,25995371..25995440,
FT                   25995585..25995743,25995819..25995861,26001758..26001942,
FT                   26025835..26025985,26053776..26053972,26055565..>26056055))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141533"
FT                   /product="mCG141533"
FT                   /note="gene_id=mCG141533.0 transcript_id=mCT175824.0
FT                   protein_id=mCP98746.0"
FT                   /protein_id="EDL29488.1"
FT                   /translation="VREASLLVSCRTSKFRKNNYKWVAASEKSPRVARRALSPRTTLES
FT                   GNKATLGTVGKTEKPQPKVDPEVRPEKLATPSKPGLSPSKYKWKASSPSASSSSSFRWQ
FT                   SEAGSKDHTSQLSPVPSRPTSGDRPAGGPSSLKPLFGESQLSAYKVKSRTKIIRRRGNT
FT                   SIPGDKKNSPTTATTSKNHLTQRRRQALRGKNSPVLRKTPHKGLMQVNRHRLCCLPSSR
FT                   THLSTKEASSVHMGIPPSNKVIKTRYRIVKKTPSSSFGAPSFPSSLPSWRARRIPLSRS
FT                   LVLNRLRPAITGGGKAPPGTPRWRNKGYRCIGGVLYKVSANKLSKTSSRPSDGNRTLLR
FT                   TGRLDPATTCSRSLASRAIQRSLAIIRQAKQKKEKKREYCMYYNRFGRCNRGECCPYIH
FT                   DPEKVAVCTRFVRGTCKKTDGSCPFSHHVSKEKMPVCSYFLKGICSNSNCPYSHVYVSR
FT                   KAEVCSDFLKGYCPLGAKCKKKHTLLCPDFARRGICPRGSQCQLLHRNQKRHGRRTAAP
FT                   PIPGPSDGAPRSKASAGHVLRKPTTTQRSVRQMSSGLASGAEAPASPPPSPRVLASTST
FT                   LSSKATAASSPSPSPSTSSPAPSLEQEEAVSGTGSGTGSSGLCKLPSFISLHSSPSPGG
FT                   QTETGPQAPRSPRTKDSGKPLHIKPRL"
FT   gap             25990809..25991082
FT                   /estimated_length=274
FT   gap             26056056..26056188
FT                   /estimated_length=133
FT   gap             26067986..26068262
FT                   /estimated_length=277
FT   gene            complement(26070940..>26072256)
FT                   /locus_tag="mCG_22107"
FT                   /note="gene_id=mCG22107.2"
FT   mRNA            complement(join(26070940..26071075,26071089..26071662,
FT                   26072079..>26072256))
FT                   /locus_tag="mCG_22107"
FT                   /product="mCG22107"
FT                   /note="gene_id=mCG22107.2 transcript_id=mCT23868.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(26071142..26071662,26072079..>26072256))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22107"
FT                   /product="mCG22107"
FT                   /note="gene_id=mCG22107.2 transcript_id=mCT23868.2
FT                   protein_id=mCP17883.2"
FT                   /protein_id="EDL29489.1"
FT                   /translation="LAFFTTTEKAGAHLKGGAKRVSISAPSANAPMFVMGVNHEKYDNS
FT                   LNTVSNASCTTNCLVIHDDFGIVEGLMTMVHAITATQKTVDGPFGKLWHDGRGAAQNII
FT                   PASTGAAKAVGKVIPELNRKLTGMTFPVSTPNVSIVDLTCRLEKPAKYDDIKKVVKQVS
FT                   EGPLKGILGYTEDQVVSCDFNSNSHSSTFNAGAGIALNDNFVRLISGYDNEYGYSNRVV
FT                   DLMAYMASKE"
FT   gene            26078625..26083847
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /note="gene_id=mCG22129.1"
FT   mRNA            join(26078625..26078804,26079847..26080070,
FT                   26080686..26080878,26081391..26081559,26081865..26081967,
FT                   26082202..26082252,26082529..26082618,26082738..26082913,
FT                   26082988..26083132,26083232..26083305,26083439..26083847)
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, transcript variant
FT                   mCT23877"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT23877.1 created
FT                   on 17-OCT-2002"
FT   mRNA            join(26078626..26078804,26079847..26080070,
FT                   26080686..26080878,26081391..26081553,26083232..26083305,
FT                   26083439..26083846)
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, transcript variant
FT                   mCT174561"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT174561.0 created
FT                   on 17-OCT-2002"
FT   mRNA            join(26078626..26078804,26079847..26080070,
FT                   26080797..26080878,26081391..26081559,26081865..26081967,
FT                   26082202..26082252,26082529..26082618,26082738..26082913,
FT                   26082988..26083132,26083232..26083305,26083439..26083799)
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, transcript variant
FT                   mCT174560"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT174560.0 created
FT                   on 17-OCT-2002"
FT   gap             26079518..26079678
FT                   /estimated_length=161
FT   CDS             join(26079851..26080070,26080686..26080878,
FT                   26081391..26081559,26081865..26081967,26082202..26082252,
FT                   26082529..26082618,26082738..26082913,26082988..26083132,
FT                   26083232..26083305,26083439..26083681)
FT                   /codon_start=1
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT23877.1
FT                   protein_id=mCP17851.2 isoform=CRA_c"
FT                   /protein_id="EDL29492.1"
FT                   /translation="MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKF
FT                   SSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGK
FT                   ISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTE
FT                   VLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQL
FT                   LIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEE
FT                   ELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLC
FT                   SGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETT
FT                   VLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQ
FT                   VHWEPTSLIPTSALYASLFLLSSLGQKPC"
FT   CDS             join(26079851..26080070,26080797..26080878,
FT                   26081391..26081559,26081865..26081967,26082202..26082252,
FT                   26082529..26082618,26082738..26082913,26082988..26083132,
FT                   26083232..26083305,26083439..26083681)
FT                   /codon_start=1
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT174560.0
FT                   protein_id=mCP97479.0 isoform=CRA_a"
FT                   /protein_id="EDL29490.1"
FT                   /translation="MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKF
FT                   SSSRFWKPRYSCVNLSIKDILEPSAPEPVSDSSSASMNVCILRVTQKTWETMQHERHLQ
FT                   QPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGH
FT                   QSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLN
FT                   VLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNI
FT                   GKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYL
FT                   LGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWD
FT                   EKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC"
FT   CDS             join(26079851..26080070,26080686..26080878,
FT                   26081391..26081553,26083232..26083237)
FT                   /codon_start=1
FT                   /gene="Gsdmdc1"
FT                   /locus_tag="mCG_22129"
FT                   /product="gasdermin domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG22129.1 transcript_id=mCT174561.0
FT                   protein_id=mCP97480.0 isoform=CRA_b"
FT                   /protein_id="EDL29491.1"
FT                   /translation="MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKF
FT                   SSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGK
FT                   ISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTE
FT                   VLQTKEEVQITEVHSQEGSGQFTLPGALCC"
FT   gene            complement(26107400..26111216)
FT                   /gene="Naprt1"
FT                   /locus_tag="mCG_22127"
FT                   /note="gene_id=mCG22127.1"
FT   mRNA            complement(join(26107400..26107503,26107592..26107699,
FT                   26107790..26107944,26107987..26108125,26108227..26108307,
FT                   26108406..26108490,26108785..26108925,26109000..26109196,
FT                   26109548..26109663,26109749..26109879,26109996..26110078,
FT                   26110163..26110290,26110460..26111216))
FT                   /gene="Naprt1"
FT                   /locus_tag="mCG_22127"
FT                   /product="nicotinate phosphoribosyltransferase domain
FT                   containing 1, transcript variant mCT23875"
FT                   /note="gene_id=mCG22127.1 transcript_id=mCT23875.2 created
FT                   on 14-NOV-2002"
FT   mRNA            complement(join(26107407..26107503,26107592..26107699,
FT                   26107790..26107944,26108023..26108125,26108227..26108307,
FT                   26108406..26108490,26108785..26108925,26109000..26109196,
FT                   26109548..26109663,26109749..26109879,26109996..26110078,
FT                   26110163..26110290,26110460..>26110927))
FT                   /gene="Naprt1"
FT                   /locus_tag="mCG_22127"
FT                   /product="nicotinate phosphoribosyltransferase domain
FT                   containing 1, transcript variant mCT192595"
FT                   /note="gene_id=mCG22127.1 transcript_id=mCT192595.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(26107441..26107503,26107592..26107699,
FT                   26107790..26107944,26108023..26108125,26108227..26108307,
FT                   26108406..26108490,26108785..26108925,26109000..26109196,
FT                   26109548..26109663,26109749..26109879,26109996..26110078,
FT                   26110163..26110290,26110460..>26110709))
FT                   /codon_start=1
FT                   /gene="Naprt1"
FT                   /locus_tag="mCG_22127"
FT                   /product="nicotinate phosphoribosyltransferase domain
FT                   containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG22127.1 transcript_id=mCT192595.0
FT                   protein_id=mCP113579.0 isoform=CRA_a"
FT                   /protein_id="EDL29493.1"
FT                   /translation="SGACVPRGMEMELDSEGRMVVRPLLTDLYQATMALGYWRAGRACE
FT                   AAEFELFFRHCPFGGSFALSAGLQDCMRFLRAFRLRDADVQFLASVLPPDTDPAFFEHL
FT                   RALDCSGVTVRALPEGSLAFPGVPLLQVSGPLLLVQLLETPLLCLVSYASLVATNAARL
FT                   RLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHS
FT                   FVTSFSGSEVPPDPMLAPASSEGPTVDLPARVNLWLKRVCLYLGLEEQEPHPGERAAFV
FT                   AYALAFPRAFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAKEIR
FT                   GIFRTAGAQFQMPWLESVPIAVSNNIDESELMRLAQKGSEVNVIGIGTSVVTCPKQPSM
FT                   GCVYKLVSVGGQPRIKLTEDPEKQTLPGSKAAFRFLGPDGSLLLDLLQLAEEPPPKAGQ
FT                   ELRVWPRGTQEPCTVKPAQVEPLLRLYLQQGQLCEPLPSLDESRRFAQQSLSLLRPAHK
FT                   QLQSPAVYPVALSEKLRALVDSLSARGPL"
FT   CDS             complement(join(26107441..26107503,26107592..26107699,
FT                   26107790..26107944,26107987..26108125,26108227..26108307,
FT                   26108406..26108490,26108785..26108925,26109000..26109196,
FT                   26109548..26109663,26109749..26109879,26109996..26110078,
FT                   26110163..26110290,26110460..26110685))
FT                   /codon_start=1
FT                   /gene="Naprt1"
FT                   /locus_tag="mCG_22127"
FT                   /product="nicotinate phosphoribosyltransferase domain
FT                   containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG22127.1 transcript_id=mCT23875.2
FT                   protein_id=mCP17835.2 isoform=CRA_b"
FT                   /protein_id="EDL29494.1"
FT                   /translation="MEMELDSEGRMVVRPLLTDLYQATMALGYWRAGRACEAAEFELFF
FT                   RHCPFGGSFALSAGLQDCMRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSGV
FT                   TVRALPEGSLAFPGVPLLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDK
FT                   KLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFVTSFSGS
FT                   EVPPDPMLAPASSEGPTVDLPARVNLWLKRVCLYLGLEEQEPHPGERAAFVAYALAFPR
FT                   AFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAKEIRGIFRTAGA
FT                   QFQMPWLESVPIAVSNNIDESELMRLAQKGSEVNVIGIGTSVVTCPKQPSMGCVYKLVS
FT                   VGGQPRIKLTEDPEKQTLPGSKAAFRFLGPDGDFPLSFIYPSSGSLLLDLLQLAEEPPP
FT                   KAGQELRVWPRGTQEPCTVKPAQVEPLLRLYLQQGQLCEPLPSLDESRRFAQQSLSLLR
FT                   PAHKQLQSPAVYPVALSEKLRALVDSLSARGPL"
FT   gene            complement(26111930..26125803)
FT                   /locus_tag="mCG_22130"
FT                   /note="gene_id=mCG22130.2"
FT   mRNA            complement(join(26111930..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26117606..26117729,26125719..26125803))
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, transcript variant mCT172048"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172048.0 created
FT                   on 16-AUG-2002"
FT   mRNA            complement(join(26111930..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26117134..26117162,26117197..26117236,26117606..26117729,
FT                   26125719..26125781))
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, transcript variant mCT23878"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT23878.2 created
FT                   on 16-AUG-2002"
FT   mRNA            complement(join(26111933..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26113669..26113725,26117606..26117726,26125719..26125766))
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, transcript variant mCT172049"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172049.0 created
FT                   on 16-AUG-2002"
FT   mRNA            complement(join(26111944..26112034,26112175..26112369,
FT                   26112686..26112907,26117606..26117726,26125719..26125757))
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, transcript variant mCT172050"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172050.0 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(26111996..26112034,26112175..26112369,
FT                   26112686..26112907,26117606..26117722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, isoform CRA_c"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172050.0
FT                   protein_id=mCP94968.0 isoform=CRA_c"
FT                   /db_xref="GOA:D3YY68"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="MGI:MGI:1913906"
FT                   /db_xref="UniProtKB/TrEMBL:D3YY68"
FT                   /protein_id="EDL29497.1"
FT                   /translation="MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQHVSPMR
FT                   QVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAK
FT                   SSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKV
FT                   GTDLLEEEITKFEEHVQSVDIAAFNKI"
FT   CDS             complement(join(26111996..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26117606..26117722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, isoform CRA_a"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172048.0
FT                   protein_id=mCP94967.0 isoform=CRA_a"
FT                   /protein_id="EDL29495.1"
FT                   /translation="MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQSSGPGA
FT                   SSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAISKLEARLSSLEKSSPTPRATAPQ
FT                   TQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKA
FT                   KKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQ
FT                   CVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI"
FT   CDS             complement(join(26111996..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26113669..26113725,26117606..26117722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, isoform CRA_b"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT172049.0
FT                   protein_id=mCP94969.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q91VK2"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="MGI:MGI:1913906"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VK2"
FT                   /protein_id="EDL29496.1"
FT                   /translation="MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQLKVMLP
FT                   NSPEALGQATPGTSSGPGASSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAISKLE
FT                   ARLSSLEKSSPTPRATAPQTQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEED
FT                   KEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLV
FT                   WGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI"
FT   CDS             complement(join(26111996..26112034,26112175..26112369,
FT                   26112686..26112907,26113083..26113183,26113263..26113362,
FT                   26117134..26117162,26117197..26117236,26117606..26117722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22130"
FT                   /product="mCG22130, isoform CRA_d"
FT                   /note="gene_id=mCG22130.2 transcript_id=mCT23878.2
FT                   protein_id=mCP17876.2 isoform=CRA_d"
FT                   /protein_id="EDL29498.1"
FT                   /translation="MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQENGASV
FT                   ILRDIARERTSSKSLAGSSGPGASSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAI
FT                   SKLEARLSSLEKSSPTPRATAPQTQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDE
FT                   EEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQL
FT                   DGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI"
FT   gap             26117177..26117196
FT                   /estimated_length=20
FT   gene            complement(<26119736..26121837)
FT                   /locus_tag="mCG_147993"
FT                   /note="gene_id=mCG147993.0"
FT   mRNA            complement(join(<26119736..26120282,26121810..26121837))
FT                   /locus_tag="mCG_147993"
FT                   /product="mCG147993"
FT                   /note="gene_id=mCG147993.0 transcript_id=mCT188256.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<26119736..26120282)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147993"
FT                   /product="mCG147993"
FT                   /note="gene_id=mCG147993.0 transcript_id=mCT188256.0
FT                   protein_id=mCP108957.0"
FT                   /db_xref="GOA:Q9CVV2"
FT                   /db_xref="MGI:MGI:1913906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CVV2"
FT                   /protein_id="EDL29499.1"
FT                   /translation="MRSGKASCALETVWEDRHKYEGAERRFHEQEATQVVAAAATAAAT
FT                   ASASVQQLLDEVPAVNGPSQEDTEDTEEAEAPNTSSRSDPGKSHECKKPIQKKRKRSPK
FT                   SWLGQADLALVGLSADHVWLDKPLFDQAESSYRQRLADVAAQAAQPPALAPRGPCTHGS
FT                   HVACHHVTWGIWVNKSCFD"
FT   gene            complement(26126195..26128355)
FT                   /locus_tag="mCG_148008"
FT                   /note="gene_id=mCG148008.0"
FT   mRNA            complement(join(26126195..26127531,26127549..26128355))
FT                   /locus_tag="mCG_148008"
FT                   /product="mCG148008"
FT                   /note="gene_id=mCG148008.0 transcript_id=mCT188271.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26127836..26128258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148008"
FT                   /product="mCG148008"
FT                   /note="gene_id=mCG148008.0 transcript_id=mCT188271.0
FT                   protein_id=mCP108972.0"
FT                   /protein_id="EDL29500.1"
FT                   /translation="MADCMCPLSPSEAGKRPLGQGSHTPSSEVTAEGPIPPSLRAMVMR
FT                   ERSCTSLSGPTSLGSWLSSHLRAVSSPQTASPAVGTNTPPCSVASSSSSPAPMLEGRLA
FT                   GDGGAAGATSSLQPSGRPPSSSRCSHWATSSGARRL"
FT   gene            complement(26132950..26138044)
FT                   /gene="Pycrl"
FT                   /locus_tag="mCG_22128"
FT                   /note="gene_id=mCG22128.0"
FT   mRNA            complement(join(26132950..26133553,26133711..26133803,
FT                   26134728..26134938,26135147..26135326,26135703..26135767,
FT                   26137855..26138044))
FT                   /gene="Pycrl"
FT                   /locus_tag="mCG_22128"
FT                   /product="pyrroline-5-carboxylate reductase-like,
FT                   transcript variant mCT172047"
FT                   /note="gene_id=mCG22128.0 transcript_id=mCT172047.0 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(26132950..26133553,26133711..26133803,
FT                   26134726..26134938,26135147..26135326,26135703..26135767,
FT                   26137855..26138044))
FT                   /gene="Pycrl"
FT                   /locus_tag="mCG_22128"
FT                   /product="pyrroline-5-carboxylate reductase-like,
FT                   transcript variant mCT23876"
FT                   /note="gene_id=mCG22128.0 transcript_id=mCT23876.0 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(26133371..26133553,26133711..26133803,
FT                   26134726..26134938,26135147..26135326,26135703..26135767,
FT                   26137855..26137945))
FT                   /codon_start=1
FT                   /gene="Pycrl"
FT                   /locus_tag="mCG_22128"
FT                   /product="pyrroline-5-carboxylate reductase-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22128.0 transcript_id=mCT23876.0
FT                   protein_id=mCP17857.1 isoform=CRA_b"
FT                   /protein_id="EDL29502.1"
FT                   /translation="MAATMSEPRRVGFVGAGRMAEAIARGLIQAGKVEAKQVLASAPTD
FT                   NNLCHFRALGCQTTHSNHEVLQNCPLVIFATKPQVLPTVLAEVAPIVTTEHIIVSVAAG
FT                   ISLSTMEGLLPPNTRVLRVSPNLPCVVQEGAMVMARGHHAGNDDAELLQNLLEACGQCI
FT                   EVPESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKMLQQ
FT                   EGKHPAQLRTDVLTPAGTTIHGLHALERGGFRAATMSAVEAATCRAKELSKK"
FT   CDS             complement(join(26133775..26133803,26134728..26134938,
FT                   26135147..26135326,26135703..26135767,26137855..26137945))
FT                   /codon_start=1
FT                   /gene="Pycrl"
FT                   /locus_tag="mCG_22128"
FT                   /product="pyrroline-5-carboxylate reductase-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22128.0 transcript_id=mCT172047.0
FT                   protein_id=mCP94966.0 isoform=CRA_a"
FT                   /protein_id="EDL29501.1"
FT                   /translation="MAATMSEPRRVGFVGAGRMAEAIARGLIQAGKVEAKQVLASAPTD
FT                   NNLCHFRALGCQTTHSNHEVLQNCPLVIFATKPQVLPTVLAEVAPIVTTEHIIVSVAAG
FT                   ISLSTMEGLLPPNTRVLRVSPNLPCVVQEGAMVMARGHHAGNDDAELLQNLLEACGQCI
FT                   EVPESYVDIHTGLSGSGVACVYIFRGPG"
FT   gene            complement(26141161..26146243)
FT                   /gene="Tsta3"
FT                   /locus_tag="mCG_22113"
FT                   /note="gene_id=mCG22113.2"
FT   mRNA            complement(join(26141161..26141473,26141764..26141863,
FT                   26142062..26142141,26142272..26142338,26142608..26142672,
FT                   26142803..26142936,26143278..26143351,26143446..26143574,
FT                   26144908..26145022,26145371..26145528,26146198..26146243))
FT                   /gene="Tsta3"
FT                   /locus_tag="mCG_22113"
FT                   /product="tissue specific transplantation antigen P35B,
FT                   transcript variant mCT171951"
FT                   /note="gene_id=mCG22113.2 transcript_id=mCT171951.0 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(26141163..26141473,26141764..26141863,
FT                   26142062..26142141,26142272..26142338,26142608..26142672,
FT                   26142803..26142936,26143278..26143351,26143446..26143574,
FT                   26144908..26145022,26145371..26145528,26146132..>26146209))
FT                   /gene="Tsta3"
FT                   /locus_tag="mCG_22113"
FT                   /product="tissue specific transplantation antigen P35B,
FT                   transcript variant mCT23874"
FT                   /note="gene_id=mCG22113.2 transcript_id=mCT23874.1 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(26141418..26141473,26141764..26141863,
FT                   26142062..26142141,26142272..26142338,26142608..26142672,
FT                   26142803..26142936,26143278..26143351,26143446..26143574,
FT                   26144908..26145022,26145371..26145528,26146132..>26146209))
FT                   /codon_start=1
FT                   /gene="Tsta3"
FT                   /locus_tag="mCG_22113"
FT                   /product="tissue specific transplantation antigen P35B,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22113.2 transcript_id=mCT23874.1
FT                   protein_id=mCP17840.0 isoform=CRA_b"
FT                   /protein_id="EDL29504.1"
FT                   /translation="NPSQVRFTVGFGAANRGSRRLVRAVRVQTIMGEPHGSMRILVTGG
FT                   SGLVGRAIQKVVADGAGLPGEEWVFVSSKDADLTDAAQTQALFQKVQPTHVIHLAAMVG
FT                   GLFRNIKYNLDFWRKNVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHN
FT                   GPPHSSNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPYDNFNIEDGHVLPGLI
FT                   HKVHLAKSSDSALTVWGTGKPRRQFIYSLDLARLFIWVLREYSEVEPIILSVGEEDEVS
FT                   IKEAAEAVVEAMDFNGEVTFDSTKSDGQYKKTASNGKLRSYLPDFRFTPFKQAVKETCT
FT                   WFTDNYEQARK"
FT   CDS             complement(join(26141418..26141473,26141764..26141863,
FT                   26142062..26142141,26142272..26142338,26142608..26142672,
FT                   26142803..26142936,26143278..26143351,26143446..26143574,
FT                   26144908..26145022,26145371..26145516))
FT                   /codon_start=1
FT                   /gene="Tsta3"
FT                   /locus_tag="mCG_22113"
FT                   /product="tissue specific transplantation antigen P35B,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22113.2 transcript_id=mCT171951.0
FT                   protein_id=mCP94870.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5HZI6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="MGI:MGI:98857"
FT                   /db_xref="UniProtKB/TrEMBL:Q5HZI6"
FT                   /protein_id="EDL29503.1"
FT                   /translation="MGEPHGSMRILVTGGSGLVGRAIQKVVADGAGLPGEEWVFVSSKD
FT                   ADLTDAAQTQALFQKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEV
FT                   GARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSYAKRMIDVQNRAYFQQHGC
FT                   TFTAVIPTNVFGPYDNFNIEDGHVLPGLIHKVHLAKSSDSALTVWGTGKPRRQFIYSLD
FT                   LARLFIWVLREYSEVEPIILSVGEEDEVSIKEAAEAVVEAMDFNGEVTFDSTKSDGQYK
FT                   KTASNGKLRSYLPDFRFTPFKQAVKETCTWFTDNYEQARK"
FT   gap             26149038..26149148
FT                   /estimated_length=111
FT   gene            26157429..26165879
FT                   /gene="Zfp623"
FT                   /locus_tag="mCG_22108"
FT                   /note="gene_id=mCG22108.2"
FT   mRNA            join(26157429..26157638,26163602..26165879)
FT                   /gene="Zfp623"
FT                   /locus_tag="mCG_22108"
FT                   /product="zinc finger protein 623"
FT                   /note="gene_id=mCG22108.2 transcript_id=mCT23869.2 created
FT                   on 16-APR-2003"
FT   CDS             26163676..26165175
FT                   /codon_start=1
FT                   /gene="Zfp623"
FT                   /locus_tag="mCG_22108"
FT                   /product="zinc finger protein 623"
FT                   /note="gene_id=mCG22108.2 transcript_id=mCT23869.2
FT                   protein_id=mCP17900.3"
FT                   /db_xref="GOA:Q9CY99"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1926084"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CY99"
FT                   /protein_id="EDL29505.1"
FT                   /translation="MMSDELTVLEPSASESREFHEDRLAQLLGNPDKQSLESPSSQDGG
FT                   FTQMTVTHWKIQTGDTAQTCSKSGRNPILNSNLLILQRELIDAEARSCGGGGKGFPFNS
FT                   DVVPHQISHTGEKPYKCDHCGKGFSQTSLLTEHQRVHTGDRLCVCHVCGKDFVHYASLR
FT                   EHQHVHTGEKPFKCAQCGKAFCHSSDLLRHQRVHTRERPFECKECGKGFSQSSLLIRHQ
FT                   RIHTGERPYECNECGKSFIRSSSLIRHYQIHTEVKQYECRDCGKAFRHRSDLIEHQRIH
FT                   TGERPFECQECGKAFIRSSKLIQHQRIHTGERPYVCNECGKRFSQTSNFTQHQRIHSGE
FT                   KLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTEHQKIHTGDRPF
FT                   ECKDCGKAFIQSSKLLLHQIVHTGEKPYVCSYCGKGFIQRSNFLQHQKMHTEEKRYTYS
FT                   QLGKDLTPPPDLVHQEDLSLSETSVHLGERSTDRECCGNNL"
FT   gap             26168699..26168830
FT                   /estimated_length=132
FT   gap             26181764..26181783
FT                   /estimated_length=20
FT   gene            <26185576..26192149
FT                   /locus_tag="mCG_142742"
FT                   /note="gene_id=mCG142742.0"
FT   mRNA            join(<26185576..26185804,26189482..26189608,
FT                   26189942..26190320)
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, transcript variant mCT182027"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182027.0
FT                   created on 16-APR-2003"
FT   CDS             join(<26185577..26185804,26189482..26189608,
FT                   26189942..26190132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, isoform CRA_c"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182027.0
FT                   protein_id=mCP104949.0 isoform=CRA_c"
FT                   /protein_id="EDL29508.1"
FT                   /translation="TFKGAGAGESDGGAALGCSAPRHCACAEADPTPGIPRGLQMRRRL
FT                   AAAAALGEARRERCFRRGSALPERANGDAPPVPVTFRDVAVYFCREEWECLSPSQRTLY
FT                   RNVMLENFRNLNELGCCSRRPGLITRLEQWDEPWVDDWDRSEFPDGQKSFCPGKRDELF
FT                   PLSDSARVGAPLLPLTKL"
FT   mRNA            join(<26185598..26185804,26189482..26189608,
FT                   26189942..26190055,26190870..26192149)
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, transcript variant mCT182026"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182026.0
FT                   created on 16-APR-2003"
FT   CDS             join(<26185598..26185804,26189482..26189608,
FT                   26189942..26190055,26190870..26191675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, isoform CRA_b"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182026.0
FT                   protein_id=mCP104948.0 isoform=CRA_b"
FT                   /protein_id="EDL29507.1"
FT                   /translation="GESDGGAALGCSAPRHCACAEADPTPGIPRGLQMRRRLAAAAALG
FT                   EARRERCFRRGSALPERANGDAPPVPVTFRDVAVYFCREEWECLSPSQRTLYRNVMLEN
FT                   FRNLNELGCCSRRPGLITRLEQWDEPWVDDWDRSEFPDGQKSFCPGSRKVAHSRIGAGR
FT                   GAALRKSALTSGKVRLPRATSGRRMDKREAFQNRICGKSHRKQPDLKEQGQSGPEGQPF
FT                   ICGICGKALSCHSRLAAHQTVHTGTRSFECLECGRTFRWASNLLRHQRNHTSEKPFCCE
FT                   LCGQAFSLKDRLAQHRKIHTEHRPYECGDCGKAFKQKSNLLRHKLVHTGEKPFYCDTCG
FT                   KAFRTKENLSHHQRIHSGEKPYTCGECGKAFRWPKGFSIHQRLHLTKKFYQCEQCGKGF
FT                   RHLGFFTRHQRTHGRGEV"
FT   mRNA            join(<26185620..26185804,26189523..26189608,
FT                   26189942..26190055,26190870..26191909)
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, transcript variant mCT182029"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182029.0
FT                   created on 16-APR-2003"
FT   CDS             join(<26185620..26185804,26189523..26189608,
FT                   26189942..26190055,26190870..26191675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, isoform CRA_e"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182029.0
FT                   protein_id=mCP104947.0 isoform=CRA_e"
FT                   /protein_id="EDL29510.1"
FT                   /translation="LWVALLRATALALKPTLPPASPAAFRCAGVLLQLLLSAKLDESAA
FT                   SDGAALFPSELTAMLLREEWECLSPSQRTLYRNVMLENFRNLNELGCCSRRPGLITRLE
FT                   QWDEPWVDDWDRSEFPDGQKSFCPGSRKVAHSRIGAGRGAALRKSALTSGKVRLPRATS
FT                   GRRMDKREAFQNRICGKSHRKQPDLKEQGQSGPEGQPFICGICGKALSCHSRLAAHQTV
FT                   HTGTRSFECLECGRTFRWASNLLRHQRNHTSEKPFCCELCGQAFSLKDRLAQHRKIHTE
FT                   HRPYECGDCGKAFKQKSNLLRHKLVHTGEKPFYCDTCGKAFRTKENLSHHQRIHSGEKP
FT                   YTCGECGKAFRWPKGFSIHQRLHLTKKFYQCEQCGKGFRHLGFFTRHQRTHGRGEV"
FT   mRNA            join(<26185705..26185804,26189452..26189608,
FT                   26189942..26190055,26190870..26191909)
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, transcript variant mCT182025"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182025.0
FT                   created on 16-APR-2003"
FT   CDS             join(<26185706..26185804,26189452..26189608,
FT                   26189942..26190055,26190870..26191675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, isoform CRA_a"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182025.0
FT                   protein_id=mCP104950.0 isoform=CRA_a"
FT                   /protein_id="EDL29506.1"
FT                   /translation="RLAAAAALGEARRERCFRRGSALPERANGDAPPQAILGPSVCQVP
FT                   VTFRDVAVYFCREEWECLSPSQRTLYRNVMLENFRNLNELGCCSRRPGLITRLEQWDEP
FT                   WVDDWDRSEFPDGQKSFCPGSRKVAHSRIGAGRGAALRKSALTSGKVRLPRATSGRRMD
FT                   KREAFQNRICGKSHRKQPDLKEQGQSGPEGQPFICGICGKALSCHSRLAAHQTVHTGTR
FT                   SFECLECGRTFRWASNLLRHQRNHTSEKPFCCELCGQAFSLKDRLAQHRKIHTEHRPYE
FT                   CGDCGKAFKQKSNLLRHKLVHTGEKPFYCDTCGKAFRTKENLSHHQRIHSGEKPYTCGE
FT                   CGKAFRWPKGFSIHQRLHLTKKFYQCEQCGKGFRHLGFFTRHQRTHGRGEV"
FT   mRNA            join(<26186070..26186134,26189482..26189608,
FT                   26189942..26190055,26190870..26191909)
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, transcript variant mCT182028"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182028.0
FT                   created on 16-APR-2003"
FT   CDS             join(<26186072..26186134,26189482..26189608,
FT                   26189942..26190055,26190870..26191675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142742"
FT                   /product="mCG142742, isoform CRA_d"
FT                   /note="gene_id=mCG142742.0 transcript_id=mCT182028.0
FT                   protein_id=mCP104951.0 isoform=CRA_d"
FT                   /protein_id="EDL29509.1"
FT                   /translation="CRVCGWQSLPRPVFPELRVFQVPVTFRDVAVYFCREEWECLSPSQ
FT                   RTLYRNVMLENFRNLNELGCCSRRPGLITRLEQWDEPWVDDWDRSEFPDGQKSFCPGSR
FT                   KVAHSRIGAGRGAALRKSALTSGKVRLPRATSGRRMDKREAFQNRICGKSHRKQPDLKE
FT                   QGQSGPEGQPFICGICGKALSCHSRLAAHQTVHTGTRSFECLECGRTFRWASNLLRHQR
FT                   NHTSEKPFCCELCGQAFSLKDRLAQHRKIHTEHRPYECGDCGKAFKQKSNLLRHKLVHT
FT                   GEKPFYCDTCGKAFRTKENLSHHQRIHSGEKPYTCGECGKAFRWPKGFSIHQRLHLTKK
FT                   FYQCEQCGKGFRHLGFFTRHQRTHGRGEV"
FT   gap             26208702..26209169
FT                   /estimated_length=468
FT   gene            <26210277..26215661
FT                   /gene="Mapk15"
FT                   /locus_tag="mCG_145466"
FT                   /note="gene_id=mCG145466.0"
FT   mRNA            join(<26210277..26210436,26211353..26211451,
FT                   26211581..26211610,26211743..26211833,26212336..26212466,
FT                   26212550..26212713,26212884..26213023,26213620..26213677,
FT                   26214079..26214216,26214337..26214442,26214568..26214772,
FT                   26214880..26214983,26215059..26215187,26215288..26215661)
FT                   /gene="Mapk15"
FT                   /locus_tag="mCG_145466"
FT                   /product="mitogen-activated protein kinase 15"
FT                   /note="gene_id=mCG145466.0 transcript_id=mCT184890.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<26210347..26210436,26211353..26211451,
FT                   26211581..26211610,26211743..26211833,26212336..26212466,
FT                   26212550..26212713,26212884..26213023,26213620..26213677,
FT                   26214079..26214216,26214337..26214442,26214568..26214772,
FT                   26214880..26214983,26215059..26215187,26215288..26215473)
FT                   /codon_start=1
FT                   /gene="Mapk15"
FT                   /locus_tag="mCG_145466"
FT                   /product="mitogen-activated protein kinase 15"
FT                   /note="gene_id=mCG145466.0 transcript_id=mCT184890.0
FT                   protein_id=mCP105335.0"
FT                   /protein_id="EDL29511.1"
FT                   /translation="SQRLPLAMCAAEVDRHVAQRYLIKRRLGKGAYGIVWKAMDRRTGE
FT                   VVAIKKIFDAFRDQIDAQRTFREIMLLKEFGGHPNIIRLLDVIPAKNDRDIYLVFESMD
FT                   TDLNAVIQKGRLLKDIHKRCIFYQLLRATKFIHSGRVIHRDQKPANVLLDSACRVKLCD
FT                   FGLARSLGDLPEGPGGQALTEYVATRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRG
FT                   QPLFPGTSTFHQLELILKTIPLPSMEELQDLGSDYSALILQNLGSRPQQTLDALLPPDT
FT                   PPEALDLLKRLLAFAPDKRLSAEQALQHPYVQRFHCPDREWARESDVRLPVHEGDQLSA
FT                   PEYRKRLYQIILEQSGNSRSPREEGLGVVASRAELRASPARTQSLKSGVLPQVPAETPA
FT                   RKRGPKPPRSPGHDPEHVEVRRQSSDPLFQLPPPGRGERPPGATGQPPSAPSGVKTQVR
FT                   AMAPSLTSQAEAQAANQALIRSDPARGGGPRAVGARRVPSRLPREAPEPRPGRRMFGIS
FT                   VSQGAQGAARAALGGYSQAYGTVCRSALGRLPLLPGPRA"
FT   gene            complement(26217613..>26226010)
FT                   /gene="AA409316"
FT                   /locus_tag="mCG_144786"
FT                   /note="gene_id=mCG144786.0"
FT   mRNA            complement(join(26217613..26221259,26221451..26221575,
FT                   26221645..26221809,26222611..26223072,26225884..>26226010))
FT                   /gene="AA409316"
FT                   /locus_tag="mCG_144786"
FT                   /product="expressed sequence AA409316"
FT                   /note="gene_id=mCG144786.0 transcript_id=mCT184210.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(26218367..26221259,26221451..26221575,
FT                   26221645..26221809,26222611..26223072,26225884..>26226006))
FT                   /codon_start=1
FT                   /gene="AA409316"
FT                   /locus_tag="mCG_144786"
FT                   /product="expressed sequence AA409316"
FT                   /note="gene_id=mCG144786.0 transcript_id=mCT184210.0
FT                   protein_id=mCP105328.0"
FT                   /protein_id="EDL29512.1"
FT                   /translation="IRPNGRAGRGGEWLSDGRDREAAGRRWAPAAPVPKPRSPGQAPGP
FT                   NMARRSQSSSQGDNPLAPGYLPPHYKEYYRLAVDALTEGGPEAYNRFLASEGAPDFLCP
FT                   EELEHVSRHLQPPQYVAREPPEGTPSDVDMDGSSGTYWPVNSDQAVPELDLGWPLTFGF
FT                   QGTEVTTLVQPPPPDSPSIKDEARRMIRSAQQVVAVVMDMFTDVDLLSEVLEAAARRVP
FT                   VYILLDEMNAQHFLDMADKCRVNLHHVDFLRVRTVAGPTYYCRTGKSFKGHLKEKFLLV
FT                   DCAVVMSGSYSFMWSFEKIHRSLAHVFQGELVSSFDEEFRILFAQSEPLVPSAGALARM
FT                   DAYALAPYSGAGPLVGVPGVGAPTPFSFPKRAHLLFPPPREEGLGFPSFLDPDRHFLSA
FT                   FRREELQRMPGGALEPHTGLRPLARPTEAGPFGELAGPRGFFQSRHLEMDAFKRHSYAT
FT                   PDGAGAVENFAAARQVSRQTFLSHGDDFRFQTSHFQRDQLYQQHYQWDPQFAPARPQGL
FT                   FEKLRAGRPGFADPDDFALGAGHRFPELGADVHQRLEYVPSSASREVRHGSDPAFGPSP
FT                   RGLEPSGASRPNLGQRFPCQATLRQGLDTASEAEPERRGGPEGRAGLRHWRLASYLSGC
FT                   HGDGGEEGLPMEAEACEDEVLAPGGRDLLPSAFRTPAAFPAKGPKPGSGSGGGDSSERE
FT                   GPEETSLAKQDSFRSRLNPLIQRSSRLRSSLIFASQAEGAVGTAAATTEKVQLMHKEQT
FT                   VSETLGPSGEAVRSSASAKVAELLEKYKGPARDPGGAGGAVTSSSHSKAVVSQAWREEV
FT                   VAPGGAGTERRSLESCLLDLRDSFAQQLHQEAERHPGAASLTAAQLLDTLGGTDRLPSR
FT                   FLSAQGRSLSPQGRDSPPPEGLGTHQLPYSEPKGNPTPAYPERKGSPTPAYPERKGSPT
FT                   PAYPERKGSPTPAYPERKGSPTQAYPERKGSPTSGFPNRRGSPTTGLMEQKGSPTSTYP
FT                   DRRGSPVPPVPERRGSPVPPVPERRGSLTFAGESSKTGPTEEVSSGPMEVLRKGSLRLR
FT                   QLLSPKNERRGEDEGSFPTPQENGQPESPRRPSLSRGDSTEAAAEERGSRVRLASATAN
FT                   ALYSSNLRDDTKAILEQISAHGQKHRGVPAPGPAHSSPDVGRPTTAGDLAPDMSDKDKC
FT                   SAIFRSDSLGTQGRLSRTLPGSAEERDRLLRRMESMRKEKRVYSRFEVFCKKDEAGSSG
FT                   AGDNLADEDTRDSKMGKFVPKILGTFKSKK"
FT   gap             26241766..26242094
FT                   /estimated_length=329
FT   gap             26245724..26245743
FT                   /estimated_length=20
FT   gap             26249253..26249511
FT                   /estimated_length=259
FT   gene            <26250839..>26262720
FT                   /locus_tag="mCG_141688"
FT                   /note="gene_id=mCG141688.0"
FT   mRNA            join(<26250839..26251003,26251081..26251272,
FT                   26251341..26251466,26261699..26261838,26261934..26261988,
FT                   26262096..26262188,26262451..>26262720)
FT                   /locus_tag="mCG_141688"
FT                   /product="mCG141688"
FT                   /note="gene_id=mCG141688.0 transcript_id=mCT176328.0
FT                   created on 25-NOV-2002"
FT   CDS             join(<26250839..26251003,26251081..26251272,
FT                   26251341..26251466,26261699..26261838,26261934..26261988,
FT                   26262096..26262188,26262451..26262720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141688"
FT                   /product="mCG141688"
FT                   /note="gene_id=mCG141688.0 transcript_id=mCT176328.0
FT                   protein_id=mCP99250.0"
FT                   /protein_id="EDL29513.1"
FT                   /translation="AYLALVRQEQEAARRQREKEEAEERARREELQRRRRLLEAAFEGD
FT                   LGEIRQVLKEVEQLMTREGVGYDEDGKARRLQRRVATVECEDSHGNTPLSEAAAGGQTM
FT                   AIQLLAELGANPNTKGAFGRTPLYRAAFGGHLEAVEELLKIGADPRMYADDGSTPEQVA
FT                   SLAAVASVLQSWDLSLTEAMLKNMEAEQQRRAQEAQKHKENEAKRINIKVQQLAKEQQK
FT                   CQKELQQAYCELNRRIMEHDKCERKFMGNTELTLQAIKDAEAQVDRLQQEAQKAEETLA
FT                   MARLELREQTPEGGQGCGGGAGGPEEAMPGWGLSSGISHALQLTPPQTRIQNLGSSAGS
FT                   RSSMTC"
FT   gene            complement(26263547..26286120)
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /note="gene_id=mCG22100.2"
FT   mRNA            complement(join(26263547..26263945,26264011..26264062,
FT                   26264505..26264542,26264612..26264754,26264832..26265017,
FT                   26265100..26265247,26265324..26265483,26265593..26265691,
FT                   26265847..26265930,26266440..26266502,26267792..26267866,
FT                   26268011..26268067,26268144..26268254,26273777..26273965,
FT                   26274035..26274328,26274416..26274526,26275352..26275609,
FT                   26275688..26275768,26275873..26276196,26276957..26277034,
FT                   26277524..26277613,26278129..26278191,26279060..26279437,
FT                   26279981..26280145,26280866..26280991,26281087..26281217,
FT                   26281300..26281466,26281540..26281739,26282480..26282598,
FT                   26283000..26283144,26283210..26283284,26283384..26283447,
FT                   26283535..26283591,26283680..26283769,26283867..26283945,
FT                   26284051..26284168,26285619..26286120))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT23861"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT23861.2 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(26263554..26263927,26264011..26264062,
FT                   26264505..26264542,26264612..26264754,26264832..26265017,
FT                   26265100..26265247,26265324..26265483,26265593..26265691,
FT                   26266440..26266502,26267792..26267866,26268011..26268067,
FT                   26268144..26268254,26273777..26273965,26274035..26274328,
FT                   26274416..26274526,26275352..26275609,26275688..26275768,
FT                   26275873..26276196,26276957..26277034,26277524..26277613,
FT                   26278129..26278191,26279060..26279437,26279981..26280145,
FT                   26280866..26280991,26281087..26281217,26281300..26281466,
FT                   26281540..26281739,26282480..26282598,26283000..26283144,
FT                   26283210..26283284,26283384..26283447,26283535..26283591,
FT                   26283680..26283769,26283867..26283945,26284051..26284168,
FT                   26285619..>26286112))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT192647"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT192647.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26263554..26263927,26264011..26264062,
FT                   26264505..26264542,26264612..26264754,26264832..26265017,
FT                   26265100..26265247,26265324..26265483,26265593..26265691,
FT                   26266440..26266502,26275705..26275768,26275873..26276196,
FT                   26276957..26277034,26277524..26277613,26278129..26278191,
FT                   26279060..26279437,26279981..26280145,26280866..26280991,
FT                   26281087..26281217,26281300..26281466,26281540..26281739,
FT                   26282480..26282598,26283000..26283144,26283210..26283284,
FT                   26283384..26283447,26283535..26283591,26283680..26283769,
FT                   26283867..26283945,26284051..26284168,26285619..>26286110))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT192648"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT192648.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26263576..26263927,26264011..26264062,
FT                   26264312..26264386,26264505..26264542,26264612..26264632,
FT                   26274453..26274526,26275352..26275609,26275688..26275768,
FT                   26275873..26276196,26276957..26277034,26277524..26277613,
FT                   26278129..26278191,26279060..26279437,26279981..26280145,
FT                   26280866..26280991,26281087..26281217,26281300..26281466,
FT                   26281540..26281739,26282480..26282598,26283000..26283144,
FT                   26283210..26283284,26283384..26283447,26283535..26283591,
FT                   26283680..26283769,26283867..26283945,26284051..26284168,
FT                   26285619..26286120))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT174558"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT174558.0 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(26263576..26263927,26264011..26264062,
FT                   26264312..26264386,26264505..26264542,26264612..26264754,
FT                   26264832..26265017,26265100..26265247,26265324..26265483,
FT                   26265593..26265691,26266440..26266502,26267792..26267866,
FT                   26268011..26268067,26268144..26268254,26273777..26273965,
FT                   26274035..26274328,26274416..26274526,26275352..26275609,
FT                   26275688..26275768,26275873..26276196,26276957..26277034,
FT                   26277524..26277613,26278129..26278191,26279060..26279437,
FT                   26279981..26280145,26280866..26280991,26281087..26281217,
FT                   26281300..26281466,26281540..26281739,26282480..26282598,
FT                   26283000..26283144,26283210..26283284,26283384..26283447,
FT                   26283535..26283591,26283680..26283769,26283867..26283945,
FT                   26284051..26284168,26285619..26286120))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT174557"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT174557.0 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(26263576..26263927,26264011..26264062,
FT                   26264312..26264386,26264505..26264542,26264612..26264754,
FT                   26264832..26265017,26265100..26265247,26265324..26265483,
FT                   26265593..26265691,26265847..26265930,26266440..26266502,
FT                   26267792..26267866,26268011..26268067,26268144..26268254,
FT                   26273777..26273965,26274035..26274328,26274416..26274526,
FT                   26275352..26275609,26275688..26275768,26275873..26276196,
FT                   26276957..26277034,26277524..26277613,26278129..26278191,
FT                   26279060..26279437,26279981..26280145,26280866..26280991,
FT                   26281087..26281217,26281300..26281466,26281540..26281739,
FT                   26282480..26282598,26283000..26283144,26283210..26283284,
FT                   26283384..26283447,26283535..26283591,26283680..26283769,
FT                   26283867..26283945,26284051..26284168,26285619..26286120))
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), transcript
FT                   variant mCT176135"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT176135.0 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(26263782..26263927,26264011..26264062,
FT                   26264505..26264542,26264612..26264754,26264832..26265017,
FT                   26265100..26265247,26265324..26265483,26265593..26265691,
FT                   26266440..26266502,26267792..26267866,26268011..26268067,
FT                   26268144..26268254,26273777..26273965,26274035..26274328,
FT                   26274416..26274526,26275352..26275609,26275688..26275768,
FT                   26275873..26276196,26276957..26277034,26277524..26277613,
FT                   26278129..26278191,26279060..26279437,26279981..26280145,
FT                   26280866..26280991,26281087..26281217,26281300..26281466,
FT                   26281540..26281739,26282480..26282598,26283000..26283144,
FT                   26283210..26283284,26283384..26283447,26283535..26283591,
FT                   26283680..26283769,26283867..26283945,26284051..26284168,
FT                   26285619..>26285948))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT192647.0
FT                   protein_id=mCP113607.0 isoform=CRA_c"
FT                   /protein_id="EDL29516.1"
FT                   /translation="TRAEPSADPGHSPGPGCPPHPRARRSARARRSCGPSPAPRPEPAE
FT                   RLPSPRSLPARIMLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQ
FT                   LRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKA
FT                   LEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKS
FT                   LPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVC
FT                   LDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTE
FT                   AIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSL
FT                   RDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTE
FT                   DDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEEDA
FT                   EEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAESA
FT                   LSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPR
FT                   EDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREG
FT                   PTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFD
FT                   QANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPA
FT                   ARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTITPL
FT                   RPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPYRA
FT                   GDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISLLL
FT                   ERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVEEI
FT                   CLPRAGGPLGLSIVGGSDHSSHPFGVQDPGVFISKVLPRGLAARCGLRVGDRILAVNGQ
FT                   DVREATHQEAVSALLRPCLELCLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGAKGHA
FT                   GNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHAEAVQLLRSVGD
FT                   TLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLGHRNSLESISSIDRELSPEGPGKEKE
FT                   LASQALPWESESAETTGRNLEPLKLDYRALAALPSAGSLQRGPSATTGGKTTEAPCSPG
FT                   SQQPPSPDELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKYFE
FT                   LEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDMGLASDR
FT                   ESPDDQQEAEQPWAVPSHAGGSSPSSPPPLGGNAPVRTAKAERRHQERLRMQSPELPAP
FT                   ERALSPAERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAP
FT                   SPAPTPSPTPLEDFGLQTSASPGRLSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRP
FT                   SPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS"
FT   CDS             complement(join(26263782..26263927,26264011..26264062,
FT                   26264312..26264386,26264505..26264542,26264612..26264754,
FT                   26264832..26265017,26265100..26265247,26265324..26265483,
FT                   26265593..26265691,26266440..26266502,26267792..26267866,
FT                   26268011..26268067,26268144..26268254,26273777..26273965,
FT                   26274035..26274328,26274416..26274526,26275352..26275609,
FT                   26275688..26275768,26275873..26276196,26276957..26277034,
FT                   26277524..26277613,26278129..26278191,26279060..26279437,
FT                   26279981..26280145,26280866..26280991,26281087..26281217,
FT                   26281300..26281466,26281540..26281739,26282480..26282598,
FT                   26283000..26283144,26283210..26283284,26283384..26283447,
FT                   26283535..26283591,26283680..26283769,26283867..26283945,
FT                   26284051..26284168,26285619..26285777))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT174557.0
FT                   protein_id=mCP97476.0 isoform=CRA_a"
FT                   /protein_id="EDL29514.1"
FT                   /translation="MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDA
FT                   NQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFC
FT                   KALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL
FT                   KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRL
FT                   VCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEV
FT                   TEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVL
FT                   SLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQ
FT                   TEDDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEE
FT                   DAEEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAE
FT                   SALSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLI
FT                   PREDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDR
FT                   EGPTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVS
FT                   FDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
FT                   PAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTIT
FT                   PLRPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPY
FT                   RAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISL
FT                   LLERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVE
FT                   EICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGVFISKVLPRGLAARCGLRVGDRILAVN
FT                   GQDVREATHQEAVSALLRPCLELCLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGAKG
FT                   HAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHAEAVQLLRSV
FT                   GDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLGHRNSLESISSIDRELSPEGPGKE
FT                   KELASQALPWESESAETTGRNLEPLKLDYRALAALPSAGSLQRGPSATTGGKTTEAPCS
FT                   PGSQQPPSPDELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKY
FT                   FELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDMGLAS
FT                   DRESPDDQQEAEQPWAVPSHAGGSSPSSPPPLGGNAPVRTAKAERRHQERLRMQSPELP
FT                   APERALSPAERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAE
FT                   APSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEE
FT                   LRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS"
FT   CDS             complement(join(26263782..26263945,26264011..26264062,
FT                   26264505..26264542,26264612..26264754,26264832..26265017,
FT                   26265100..26265247,26265324..26265483,26265593..26265691,
FT                   26265847..26265930,26266440..26266502,26267792..26267866,
FT                   26268011..26268067,26268144..26268254,26273777..26273965,
FT                   26274035..26274328,26274416..26274526,26275352..26275609,
FT                   26275688..26275768,26275873..26276196,26276957..26277034,
FT                   26277524..26277613,26278129..26278191,26279060..26279437,
FT                   26279981..26280145,26280866..26280991,26281087..26281217,
FT                   26281300..26281466,26281540..26281739,26282480..26282598,
FT                   26283000..26283144,26283210..26283284,26283384..26283447,
FT                   26283535..26283591,26283680..26283769,26283867..26283945,
FT                   26284051..26284168,26285619..26285777))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT23861.2
FT                   protein_id=mCP17855.2 isoform=CRA_e"
FT                   /protein_id="EDL29518.1"
FT                   /translation="MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDA
FT                   NQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFC
FT                   KALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL
FT                   KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRL
FT                   VCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEV
FT                   TEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVL
FT                   SLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQ
FT                   TEDDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEE
FT                   DAEEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAE
FT                   SALSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLI
FT                   PREDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDR
FT                   EGPTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVS
FT                   FDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
FT                   PAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTIT
FT                   PLRPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPY
FT                   RAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISL
FT                   LLERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVE
FT                   EICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGVFISKVLPRGLAARCGLRVGDRILAVN
FT                   GQDVREATHQEAVSALLRPCLELCLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGAKG
FT                   HAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHAEAVQLLRSV
FT                   GDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLGHRNSLESISSIDRELSPEGPGKE
FT                   KELASQALPWESESAETTGRNLEPLKLDYRALAALPSAGSLQRGPSATTGGKTTEAPCS
FT                   PGSQQTKPGVIQPLAQAWPRNSPAPRGRGGPCSPPSPDELPANVKQAYRAFAAVPTVHP
FT                   PENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEE
FT                   EARKLQQKRAQMLREEAVTSGPDMGLASDRESPDDQQEAEQPWAVPSHAGGSSPSSPPP
FT                   LGGNAPVRTAKAERRHQERLRMQSPELPAPERALSPAERRALEAEKRALWRAARMKSLE
FT                   QDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLSPDF
FT                   VEELRTLEASPSPAYPAQPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGR
FT                   RGLGPVPS"
FT   CDS             complement(join(26263782..26263927,26264011..26264062,
FT                   26264312..26264386,26264505..26264542,26264612..26264754,
FT                   26264832..26265017,26265100..26265247,26265324..26265483,
FT                   26265593..26265691,26265847..26265930,26266440..26266502,
FT                   26267792..26267866,26268011..26268067,26268144..26268254,
FT                   26273777..26273965,26274035..26274328,26274416..26274526,
FT                   26275352..26275609,26275688..26275768,26275873..26276196,
FT                   26276957..26277034,26277524..26277613,26278129..26278191,
FT                   26279060..26279437,26279981..26280145,26280866..26280991,
FT                   26281087..26281217,26281300..26281466,26281540..26281739,
FT                   26282480..26282598,26283000..26283144,26283210..26283284,
FT                   26283384..26283447,26283535..26283591,26283680..26283769,
FT                   26283867..26283945,26284051..26284168,26285619..26285777))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_f"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT176135.0
FT                   protein_id=mCP99057.0 isoform=CRA_f"
FT                   /protein_id="EDL29519.1"
FT                   /translation="MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDA
FT                   NQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFC
FT                   KALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL
FT                   KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRL
FT                   VCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEV
FT                   TEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVL
FT                   SLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQ
FT                   TEDDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEE
FT                   DAEEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAE
FT                   SALSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLI
FT                   PREDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDR
FT                   EGPTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVS
FT                   FDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
FT                   PAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTIT
FT                   PLRPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPY
FT                   RAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISL
FT                   LLERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVE
FT                   EICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGVFISKVLPRGLAARCGLRVGDRILAVN
FT                   GQDVREATHQEAVSALLRPCLELCLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGAKG
FT                   HAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHAEAVQLLRSV
FT                   GDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLGHRNSLESISSIDRELSPEGPGKE
FT                   KELASQALPWESESAETTGRNLEPLKLDYRALAALPSAGSLQRGPSATTGGKTTEAPCS
FT                   PGSQQTKPGVIQPLAQAWPRNSPAPRGRGGPCSPPSPDELPANVKQAYRAFAAVPTVHP
FT                   PENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEE
FT                   EARKLQQKRAQMLREEAVTSGPDMGLASDRESPDDQQEAEQPWAVPSHAGGSSPSSPPP
FT                   LGGNAPVRTAKAERRHQERLRMQSPELPAPERALSPAERRALEAEKRALWRAARMKSLE
FT                   QDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSG
FT                   KKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGA
FT                   VGPEDMTLCSSRRSVRPGRRGLGPVPS"
FT   CDS             complement(join(26264364..26264386,26264505..26264542,
FT                   26264612..26264632,26274453..26274526,26275352..26275609,
FT                   26275688..26275768,26275873..26276196,26276957..26277034,
FT                   26277524..26277613,26278129..26278191,26279060..26279437,
FT                   26279981..26280145,26280866..26280991,26281087..26281217,
FT                   26281300..26281466,26281540..26281739,26282480..26282598,
FT                   26283000..26283144,26283210..26283284,26283384..26283447,
FT                   26283535..26283591,26283680..26283769,26283867..26283945,
FT                   26284051..26284168,26285619..26285777))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT174558.0
FT                   protein_id=mCP97477.0 isoform=CRA_b"
FT                   /protein_id="EDL29515.1"
FT                   /translation="MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDA
FT                   NQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFC
FT                   KALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLL
FT                   KSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRL
FT                   VCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEV
FT                   TEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVL
FT                   SLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQ
FT                   TEDDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEE
FT                   DAEEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAE
FT                   SALSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLI
FT                   PREDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDR
FT                   EGPTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVS
FT                   FDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
FT                   PAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTIT
FT                   PLRPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPY
FT                   RAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISL
FT                   LLERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVE
FT                   EICLPRAGGPLGLSIVGGSDHSSHPITHTIGRLRPPDQCLPWTLAFVWKEV"
FT   CDS             complement(join(26266468..26266502,26275705..26275768,
FT                   26275873..26276196,26276957..26277034,26277524..26277613,
FT                   26278129..26278191,26279060..26279437,26279981..26280145,
FT                   26280866..26280991,26281087..26281217,26281300..26281466,
FT                   26281540..26281739,26282480..26282598,26283000..26283144,
FT                   26283210..26283284,26283384..26283447,26283535..26283591,
FT                   26283680..26283769,26283867..26283945,26284051..26284168,
FT                   26285619..>26285948))
FT                   /codon_start=1
FT                   /gene="Scrib"
FT                   /locus_tag="mCG_22100"
FT                   /product="scribbled homolog (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG22100.2 transcript_id=mCT192648.0
FT                   protein_id=mCP113608.0 isoform=CRA_d"
FT                   /protein_id="EDL29517.1"
FT                   /translation="TRAEPSADPGHSPGPGCPPHPRARRSARARRSCGPSPAPRPEPAE
FT                   RLPSPRSLPARIMLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQ
FT                   LRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKA
FT                   LEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKS
FT                   LPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVC
FT                   LDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTE
FT                   AIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSL
FT                   RDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTE
FT                   DDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEEDA
FT                   EEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAESA
FT                   LSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPR
FT                   EDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREG
FT                   PTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFD
FT                   QANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPA
FT                   ARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTITPL
FT                   RPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPYRA
FT                   GDGGIFISRIAEGGAAHRAGTLQVGTICDHRREDD"
FT   gene            complement(26286578..26297304)
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /note="gene_id=mCG141319.1"
FT   mRNA            complement(join(26286578..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294089,26297240..26297301))
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, transcript variant
FT                   mCT180731"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT180731.0
FT                   created on 28-FEB-2003"
FT   mRNA            complement(join(26286580..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26290997..26291047,
FT                   26291932..26292021,26292127..26292222,26293991..26294092,
FT                   26297240..26297304))
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, transcript variant
FT                   mCT174575"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT174575.0
FT                   created on 28-FEB-2003"
FT   mRNA            complement(join(26286580..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294092,26297240..26297299))
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, transcript variant
FT                   mCT174576"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT174576.0
FT                   created on 28-FEB-2003"
FT   mRNA            complement(join(26286580..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294092,26297194..>26297260))
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, transcript variant
FT                   mCT192603"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT192603.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(26286718..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294089,26297240..26297263))
FT                   /codon_start=1
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, isoform CRA_c"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT180731.0
FT                   protein_id=mCP103653.0 isoform=CRA_c"
FT                   /protein_id="EDL29522.1"
FT                   /translation="MATATIALVNGQQGGGSEPAAAAAAAAAAVVAAGDKWKPPQGTES
FT                   IKMENGQSTGTKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQM
FT                   AAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVE
FT                   YEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQ
FT                   DLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGG
FT                   QYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLATPGL
FT                   VSPALTLAQPLGALPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGL
FT                   LEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVD
FT                   PKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAIQ
FT                   ALNGRWFGGRKVVAEVYDQERFDNSDLSA"
FT   CDS             complement(join(26286718..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294092,26297240..26297263))
FT                   /codon_start=1
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, isoform CRA_b"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT174576.0
FT                   protein_id=mCP97495.0 isoform=CRA_b"
FT                   /protein_id="EDL29521.1"
FT                   /translation="MATATIALQVNGQQGGGSEPAAAAAAAAAAVVAAGDKWKPPQGTE
FT                   SIKMENGQSTGTKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQ
FT                   MAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFV
FT                   EYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVH
FT                   QDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLG
FT                   GQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLATPG
FT                   LVSPALTLAQPLGALPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLG
FT                   LLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMV
FT                   DPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAI
FT                   QALNGRWFGGRKVVAEVYDQERFDNSDLSA"
FT   CDS             complement(join(26286718..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26290997..26291047,
FT                   26291932..26292021,26292127..26292222,26293991..26294092,
FT                   26297240..26297263))
FT                   /codon_start=1
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, isoform CRA_a"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT174575.0
FT                   protein_id=mCP97494.0 isoform=CRA_a"
FT                   /protein_id="EDL29520.1"
FT                   /translation="MATATIALQVNGQQGGGSEPAAAAAAAAAAVVAAGDKWKPPQGTE
FT                   SIKMENGQSTGTKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQ
FT                   MAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSI
FT                   DMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQ
FT                   LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEK
FT                   AQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITA
FT                   QEAVAGAAVLGTLATPGLVSPALTLAQPLGALPQAVMAAQAPGVITGVTPARPPIPVTI
FT                   PSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQ
FT                   KLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEII
FT                   VKIFVEFSMASETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLSA"
FT   CDS             complement(join(26286718..26287017,26287139..26287374,
FT                   26287572..26287707,26287856..26288046,26288130..26288343,
FT                   26288623..26288715,26288797..26288958,26291932..26292021,
FT                   26292127..26292222,26293991..26294092,26297194..>26297235))
FT                   /codon_start=1
FT                   /gene="2410104I19Rik"
FT                   /locus_tag="mCG_141319"
FT                   /product="RIKEN cDNA 2410104I19, isoform CRA_d"
FT                   /note="gene_id=mCG141319.1 transcript_id=mCT192603.0
FT                   protein_id=mCP113569.0 isoform=CRA_d"
FT                   /protein_id="EDL29523.1"
FT                   /translation="VSPSRPGGGPQLGGQVNGQQGGGSEPAAAAAAAAAAVVAAGDKWK
FT                   PPQGTESIKMENGQSTGTKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQ
FT                   QLTNLQMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKH
FT                   KGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRI
FT                   YVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM
FT                   NLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLG
FT                   TLATPGLVSPALTLAQPLGALPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILA
FT                   SPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVM
FT                   VLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMAS
FT                   ETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLSA"
FT   gene            complement(26301904..26306988)
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /note="gene_id=mCG22103.2"
FT   mRNA            complement(join(26301904..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306055,26306138..26306221,
FT                   26306292..26306315,26306442..26306536,26306636..26306676,
FT                   26306843..26306868))
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, transcript
FT                   variant mCT23864"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT23864.2 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(26301985..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306055,26306138..26306221,
FT                   26306292..26306315,26306442..26306536,26306636..26306988))
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, transcript
FT                   variant mCT177781"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT177781.0 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(26301985..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306055,26306138..26306221,
FT                   26306292..26306403))
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, transcript
FT                   variant mCT177780"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT177780.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(26303466..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306055,26306138..26306221,
FT                   26306292..26306315,26306442..26306536,26306636..26306676,
FT                   26306843..26306854))
FT                   /codon_start=1
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT23864.2
FT                   protein_id=mCP17829.2 isoform=CRA_b"
FT                   /protein_id="EDL29526.1"
FT                   /translation="MNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDTIFIQHNGLI
FT                   KIGSVWYRIFSNALPDDLRSPIRAEREELRNLHFFPPEYGEVNDGTAVDIFSFGMCALE
FT                   MAVLEIQANGDTRVTEEAIARARHSLSDPNMREFILSCLARDPARRPSAHNLLFHRVLF
FT                   EVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAEMPQPHGPPMQWRYSEVSFL
FT                   ELDKFLEDVRNGIYPLMNFAAARPLGLPRVLAPPPEEAQKAKTPTPEPFDSETRKVVQM
FT                   QCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLAAELVHYGFLHEDDRTK
FT                   LAAFLETTFLKYRGTQA"
FT   CDS             complement(join(26303466..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306014))
FT                   /codon_start=1
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT177780.0
FT                   protein_id=mCP100703.0 isoform=CRA_a"
FT                   /protein_id="EDL29524.1"
FT                   /translation="MCALEMAVLEIQANGDTRVTEEAIARARHSLSDPNMREFILSCLA
FT                   RDPARRPSAHNLLFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAE
FT                   MPQPHGPPMQWRYSEVSFLELDKFLEDVRNGIYPLMNFAAARPLGLPRVLAPPPEEAQK
FT                   AKTPTPEPFDSETRKVVQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQ
FT                   DLAAELVHYGFLHEDDRTKLAAFLETTFLKYRGTQA"
FT   CDS             complement(join(26303466..26303534,26303621..26303676,
FT                   26303763..26303826,26303911..26303964,26304681..26304816,
FT                   26304900..26304950,26305040..26305142,26305255..26305387,
FT                   26305827..26305922,26306000..26306014))
FT                   /codon_start=1
FT                   /gene="Nrbp2"
FT                   /locus_tag="mCG_22103"
FT                   /product="nuclear receptor binding protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22103.2 transcript_id=mCT177781.0
FT                   protein_id=mCP100702.0 isoform=CRA_a"
FT                   /protein_id="EDL29525.1"
FT                   /translation="MCALEMAVLEIQANGDTRVTEEAIARARHSLSDPNMREFILSCLA
FT                   RDPARRPSAHNLLFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAE
FT                   MPQPHGPPMQWRYSEVSFLELDKFLEDVRNGIYPLMNFAAARPLGLPRVLAPPPEEAQK
FT                   AKTPTPEPFDSETRKVVQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQ
FT                   DLAAELVHYGFLHEDDRTKLAAFLETTFLKYRGTQA"
FT   gene            complement(26317873..26319389)
FT                   /locus_tag="mCG_148015"
FT                   /note="gene_id=mCG148015.0"
FT   mRNA            complement(26317873..26319389)
FT                   /locus_tag="mCG_148015"
FT                   /product="mCG148015"
FT                   /note="gene_id=mCG148015.0 transcript_id=mCT188278.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26318694..26319368)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148015"
FT                   /product="mCG148015"
FT                   /note="gene_id=mCG148015.0 transcript_id=mCT188278.0
FT                   protein_id=mCP108979.0"
FT                   /protein_id="EDL29527.1"
FT                   /translation="MRELAQGTKTIHEVTEMDSVKRYLGGSSCIAGVLVPVQGEPGRQE
FT                   KMSIYQAMWKGVLRPGTALVLLEAQAATGFIIDPVNNRRLSVEEAVAAGVVGGEIQEKL
FT                   LSAERAVTGYTDPYTGDQISLFQAMQRDLIVKNHGIRLLEAQIATGGVIDPVHSHRVPV
FT                   DVAYQRGYFDQEMNSILADPGDDTKGFFDPNTHENLTYLQLLQRATIDPETGLLFLSLS
FT                   KG"
FT   gap             26333569..26333588
FT                   /estimated_length=20
FT   gene            complement(26334362..>26341438)
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /note="gene_id=mCG134463.1"
FT   mRNA            complement(join(26334362..26334671,26334845..26334978,
FT                   26335096..26335180,26335301..26335525,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338849,
FT                   26338946..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..26339988,26340057..26340207,26340289..26340407,
FT                   26340677..26340799,26340874..26341195,26341356..>26341438))
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, transcript variant
FT                   mCT135848"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT135848.1
FT                   created on 15-NOV-2002"
FT   mRNA            complement(join(26334362..26335180,26335301..26335528,
FT                   26335712..26336005,26336266..26336368,26336448..26336590,
FT                   26338801..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..26339988,26340057..26340207,26340289..26340407,
FT                   26340677..26340799,26340874..26341195,26341356..>26341438))
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, transcript variant
FT                   mCT192623"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192623.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(26334362..26334671,26334845..26334978,
FT                   26335096..26335180,26335301..26335525,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338973,
FT                   26339139..26339256,26339415..26339623,26339904..26339988,
FT                   26340057..26340207,26340289..26340407,26340677..26340799,
FT                   26340874..>26341195))
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, transcript variant
FT                   mCT192621"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192621.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(26334362..26335180,26335301..26335528,
FT                   26335712..26336005,26336266..26336368,26336448..26336590,
FT                   26338801..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..>26340181))
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, transcript variant
FT                   mCT192622"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192622.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(26334363..26335180,26335301..26335525,
FT                   26335712..26336005,26336266..26336368,26336448..26336590,
FT                   26338801..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..26339988,26340057..26340207,26340289..26340407,
FT                   26340677..26340799,26340874..26341195,26341356..>26341400))
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, transcript variant
FT                   mCT192620"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192620.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(26334588..26334671,26334845..26334978,
FT                   26335096..26335180,26335301..26335525,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338849,
FT                   26338946..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..26339988,26340057..26340207,26340289..26340407,
FT                   26340677..26340799,26340874..26341195,26341356..>26341438))
FT                   /codon_start=1
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, isoform CRA_a"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT135848.1
FT                   protein_id=mCP60748.1 isoform=CRA_a"
FT                   /protein_id="EDL29528.1"
FT                   /translation="GFPRKREEEKCWGQTVWGWWSSGLKEGRAALTVLDTPATCSASRM
FT                   GNPASRLGCLGGRRNRSRLSPRTHTSPRTRGDLSPRSEAPRSPLPSGIPWAWWGSRAVQ
FT                   VTEVTETVVTETVVTEAVEMAPCKPRGQPVQAPLAALDTLRSWLDGMGELQASQGPLAA
FT                   DATLAASQLREQELLLRLLRERAPHVEPRLREAGSPSELCTQWHRLVQQAETRWRLLEQ
FT                   LVPAAQSFETACKALLVRLSSSEQLLAELWLGPKGLEESLPYLQEVCEGVVASTRDLER
FT                   VLQTGQRLAELLSSDQARLVRQQLNQFQERVKLTESQATCARQKLLFAQRTESSKPLPP
FT                   AGLEAQLELEGSASTPPQLKDLKQLSVQLVQLAERLEQLAQWAETSSQVAAPAVTIWEQ
FT                   SLSSAMLQADTKPLAIEKLKPERDWNPSLQEFLWEQQTLAVSWLGRRGAADYGSTCHLG
FT                   LLMDLQGCRAAMSSPSCERIHTLEGVLLLVGHLVEKLVLCPHRLSQAEPLGIKVVQAHS
FT                   LLEEMPPALTPKYWTRAPREILALMSLDQEPPGDLASRAKACLLGKIPKELSWRPWWSE
FT                   VMENWSLRKPEHSKRSEDKRDQWERLEQGHQVQDPADSFLSTEEQDSVGQGWPSYNWGR
FT                   RGPLHKVSITFKPGLSSGQKQPNSVVRARNPEGSSASGARGRPKVQGALAARGAMMVRV
FT                   GGGWAALDEFLVKNDPVRAKGRTSQKIHERFLCWTPSVPAPEVITLRLWTSNQMGTNRP
FT                   LSLKTGLPIVKDRRDSSSYKVKTSEQSTEEL"
FT   CDS             complement(join(26334588..26334671,26334845..26334978,
FT                   26335096..26335180,26335301..26335525,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338973,
FT                   26339139..26339256,26339415..26339623,26339904..26339988,
FT                   26340057..26340207,26340289..26340407,26340677..26340799,
FT                   26340874..>26341194))
FT                   /codon_start=1
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, isoform CRA_c"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192621.0
FT                   protein_id=mCP113565.0 isoform=CRA_c"
FT                   /protein_id="EDL29530.1"
FT                   /translation="AALTVLDTPATCSASRMGNPASRLGCLGGRRNRSRLSPRTHTSPR
FT                   TRGDLSPRSEAPRSPLPSGIPWAWWGSRAVQVTEVTETVVTETVVTEAVEMAPCKPRGQ
FT                   PVQAPLAALDTLRSWLDGMGELQASQGPLAADATLAASQLREQELLLRLLRERAPHVEP
FT                   RLREAGSPSELCTQWHRLVQQAETRWRLLEQLVPAAQSFETACKALLVRLSSSEQLLAE
FT                   LWLGPKGLEESLPYLQEVCEGVVASTRDLERVLQTGQRLAELLSSDQARLVRQQLNQFQ
FT                   ERVKLTESQATCARQKLLFAQRTESSKPLPPAGLEAQLELEGSASTPPQLKDLKQLSVQ
FT                   LVQLAERLEQLAQWAETSSQVAAPAVTIWEQSLSSAMLQADTKPLEGHWLETREQDFGP
FT                   KAIWEPAVQISCGLADQAAIEKLKPERDWNPSLQEFLWEQQTLAVSWLGRRGAADYGST
FT                   CHLGLLMDLQGCRAAMSSPSCERIHTLEGVLLLVGHLVEKLVLCPHRLSQAEPLGIKVV
FT                   QAHSLLEEMPPALTPKYWTRAPREILALMSLDQEPPGDLASRAKACLLGKIPKELSWRP
FT                   WWSEVMENWSLRKPEHSKRSEDKRDQWERLEQGHQVQDPADSFLSTEEQDSVGQGWPSY
FT                   NWGRRGPLHKVSITFKPGLSSGQKQPNSVVRARNPEGSSASGARGRPKVQGALAARGAM
FT                   MVRVGGGWAALDEFLVKNDPVRAKGRTSQKIHERFLCWTPSVPAPEVITLRLWTSNQMG
FT                   TNRPLSLKTGLPIVKDRRDSSSYKVKTSEQSTEEL"
FT   CDS             complement(join(26334983..26335180,26335301..26335525,
FT                   26335712..26336005,26336266..26336368,26336448..26336590,
FT                   26338801..26338973,26339139..26339256,26339415..26339623,
FT                   26339904..26339988,26340057..26340207,26340289..26340407,
FT                   26340677..26340799,26340874..26341195,26341356..>26341399))
FT                   /codon_start=1
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, isoform CRA_b"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192620.0
FT                   protein_id=mCP113564.0 isoform=CRA_b"
FT                   /protein_id="EDL29529.1"
FT                   /translation="QTVWGWWSSGLKEGRAALTVLDTPATCSASRMGNPASRLGCLGGR
FT                   RNRSRLSPRTHTSPRTRGDLSPRSEAPRSPLPSGIPWAWWGSRAVQVTEVTETVVTETV
FT                   VTEAVEMAPCKPRGQPVQAPLAALDTLRSWLDGMGELQASQGPLAADATLAASQLREQE
FT                   LLLRLLRERAPHVEPRLREAGSPSELCTQWHRLVQQAETRWRLLEQLVPAAQSFETACK
FT                   ALLVRLSSSEQLLAELWLGPKGLEESLPYLQEVCEGVVASTRDLERVLQTGQRLAELLS
FT                   SDQARLVRQQLNQFQERVKLTESQATCARQKLLFAQRTESSKPLPPAGLEAQLELEGSA
FT                   STPPQLKDLKQLSVQLVQLAERLEQLAQWAETSSQVAAPAVTIWEQSLSSAMLQADTKP
FT                   LEGHWLETREQDFGPKAIWEPAVQISCGLADQAAIEKLKPERDWNPSLQEFLWEQQTLA
FT                   VSWLGRRGAADYGSTCHLGLLMDLQGCRAAMSSPSCERIHTLEGVLLLVGHLVEKLVLC
FT                   PHRLSQAEPLGIKVVQAHSLLEEMPPALTPKYWTRAPREILALMSLDQEPPGDLASRAK
FT                   ACLLGKIPKELSWRPWWSEVMENWSLRKPEHSKRSEDKRDQWERLEQGHQVQDPADSFL
FT                   STEEQDSVGQGWPSYNWGRRGPLHKVSITFKPGLSSGQKQPNSVVRARNPEGSSASGAR
FT                   GRPKVQGALAARGAMMVRVGGGWAALDEFLVKNDPVRGESWGRTGHVSHQGVVVVVVDG
FT                   QERCAICFGLATWDL"
FT   CDS             complement(join(26335526..26335528,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338973,
FT                   26339139..26339256,26339415..26339623,26339904..26339988,
FT                   26340057..26340207,26340289..26340407,26340677..26340799,
FT                   26340874..26341195,26341356..>26341438))
FT                   /codon_start=1
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, isoform CRA_e"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192623.0
FT                   protein_id=mCP113567.0 isoform=CRA_e"
FT                   /protein_id="EDL29532.1"
FT                   /translation="GFPRKREEEKCWGQTVWGWWSSGLKEGRAALTVLDTPATCSASRM
FT                   GNPASRLGCLGGRRNRSRLSPRTHTSPRTRGDLSPRSEAPRSPLPSGIPWAWWGSRAVQ
FT                   VTEVTETVVTETVVTEAVEMAPCKPRGQPVQAPLAALDTLRSWLDGMGELQASQGPLAA
FT                   DATLAASQLREQELLLRLLRERAPHVEPRLREAGSPSELCTQWHRLVQQAETRWRLLEQ
FT                   LVPAAQSFETACKALLVRLSSSEQLLAELWLGPKGLEESLPYLQEVCEGVVASTRDLER
FT                   VLQTGQRLAELLSSDQARLVRQQLNQFQERVKLTESQATCARQKLLFAQRTESSKPLPP
FT                   AGLEAQLELEGSASTPPQLKDLKQLSVQLVQLAERLEQLAQWAETSSQVAAPAVTIWEQ
FT                   SLSSAMLQADTKPLEGHWLETREQDFGPKAIWEPAVQISCGLADQAAIEKLKPERDWNP
FT                   SLQEFLWEQQTLAVSWLGRRGAADYGSTCHLGLLMDLQGCRAAMSSPSCERIHTLEGVL
FT                   LLVGHLVEKLVLCPHRLSQAEPLGIKVVQAHSLLEEMPPALTPKYWTRAPREILALMSL
FT                   DQEPPGDLASRAKACLLGKIPKELSWRPWWSEVMENWSLRKPEHSKRSEDKRDQWERLE
FT                   QGHQVQ"
FT   CDS             complement(join(26335526..26335528,26335712..26336005,
FT                   26336266..26336368,26336448..26336590,26338801..26338973,
FT                   26339139..26339256,26339415..26339623,26339904..>26340078))
FT                   /codon_start=1
FT                   /gene="BC024139"
FT                   /locus_tag="mCG_134463"
FT                   /product="cDNA sequence BC024139, isoform CRA_d"
FT                   /note="gene_id=mCG134463.1 transcript_id=mCT192622.0
FT                   protein_id=mCP113566.0 isoform=CRA_d"
FT                   /protein_id="EDL29531.1"
FT                   /translation="GVVAVPPGMAQAWCGSLWGVTGSVPCVCSQEVCEGVVASTRDLER
FT                   VLQTGQRLAELLSSDQARLVRQQLNQFQERVKLTESQATCARQKLLFAQRTESSKPLPP
FT                   AGLEAQLELEGSASTPPQLKDLKQLSVQLVQLAERLEQLAQWAETSSQVAAPAVTIWEQ
FT                   SLSSAMLQADTKPLEGHWLETREQDFGPKAIWEPAVQISCGLADQAAIEKLKPERDWNP
FT                   SLQEFLWEQQTLAVSWLGRRGAADYGSTCHLGLLMDLQGCRAAMSSPSCERIHTLEGVL
FT                   LLVGHLVEKLVLCPHRLSQAEPLGIKVVQAHSLLEEMPPALTPKYWTRAPREILALMSL
FT                   DQEPPGDLASRAKACLLGKIPKELSWRPWWSEVMENWSLRKPEHSKRSEDKRDQWERLE
FT                   QGHQVQ"
FT   gap             26358771..26358790
FT                   /estimated_length=20
FT   gap             26363644..26363663
FT                   /estimated_length=20
FT   gene            complement(26386233..26458824)
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /note="gene_id=mCG134437.0"
FT   mRNA            complement(join(26386233..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409776..26409865,26410186..26410247,26446583..26446787,
FT                   26448200..26449016,26449108..26449282,26455460..26455593,
FT                   26455698..26456342,26456567..26456639,26456737..26456958,
FT                   26457069..26457733,26457814..26458050,26458143..26458397,
FT                   26458475..26458653,26458758..26458824))
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, transcript variant mCT135822"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT135822.1
FT                   created on 17-OCT-2002"
FT   mRNA            complement(join(26386236..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409776..26409865,26410186..26410247,26444767..>26444906))
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, transcript variant mCT192650"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT192650.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(26387036..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409401..26409436,26409776..26409865,26410186..26410247,
FT                   26446583..26446787,26448200..26449016,26449108..26449282,
FT                   26455460..26455593,26455698..26456342,26456567..26456639,
FT                   26456737..26456958,26457069..26457733,26457814..26458050,
FT                   26458143..26458397,26458475..26458653,26458758..26458807))
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, transcript variant mCT174544"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT174544.0
FT                   created on 17-OCT-2002"
FT   CDS             complement(join(26387430..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409776..26409865,26410186..26410247,26446583..26446781))
FT                   /codon_start=1
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, isoform CRA_a"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT135822.1
FT                   protein_id=mCP60630.1 isoform=CRA_a"
FT                   /protein_id="EDL29533.1"
FT                   /translation="MSGEDSEVRPVAVAEGSSNGSSGSPSPGDTLPWNLGKTQRSRRSG
FT                   GGSVGNGSVLDPAERAVIRIADERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHN
FT                   LISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTL
FT                   GLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLF
FT                   NAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSII
FT                   TYVSSLYDAMPRVPGAQDGVRANELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSF
FT                   EEIEILWCQFLKFKETELPAKEADKNRSKVIYQSLEGAVQAGQLKIPPGYHPLDVEKEW
FT                   GKLHVAILEREKQLRSEFERLECLQRIVSKLQMEAGLCEEQLNQADALLQSDIRLLASG
FT                   KVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEY
FT                   NLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPS
FT                   VEAQLGSHRGMHQSIEEFRAKIERARNDESQLSPATRGAYRDCLGRLDLQYAKLLNSSK
FT                   ARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYSALMRELEMK
FT                   EKKIKEIQNTGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKENTAYFQF
FT                   FSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAK
FT                   RAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGS
FT                   SSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQ
FT                   LIRSWSLVTFRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSR
FT                   HYQQLLQSLEQGEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQR
FT                   IAEQQAAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLS
FT                   AIYLEKLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLKKLRAQAE
FT                   AQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQ
FT                   RELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEKALLEEI
FT                   ERHGEKVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPAKKPKVQSGSESVIQEYV
FT                   DLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLA
FT                   EAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQA
FT                   KAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQE
FT                   EAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLR
FT                   QAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAER
FT                   RAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAER
FT                   EARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQ
FT                   LLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRL
FT                   EAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRL
FT                   KTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELE
FT                   RQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAE
FT                   LEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLR
FT                   ERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAE
FT                   AARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAE
FT                   QEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQK
FT                   SILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDN
FT                   TQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQ
FT                   EATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMS
FT                   AEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQR
FT                   QQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLS
FT                   EKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEAR
FT                   RRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIA
FT                   TTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQG
FT                   HTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQA
FT                   ASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMK
FT                   KDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKG
FT                   FFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVS
FT                   APFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKG
FT                   QLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGV
FT                   WLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVG
FT                   PELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPS
FT                   KSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTG
FT                   LSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEE
FT                   QRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILS
FT                   RAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPS
FT                   TATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSG
FT                   NTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRV
FT                   LADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTE
FT                   EETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMI
FT                   IIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLE
FT                   MESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPV
FT                   KGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEA
FT                   LRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERL
FT                   SYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEG
FT                   LTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAAT
FT                   GYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKG
FT                   LILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFF
FT                   DPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGK
FT                   EMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAI
FT                   TKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLA
FT                   SWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTG
FT                   ERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQR
FT                   FLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKIS
FT                   YKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRG
FT                   SFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA"
FT   CDS             complement(join(26387430..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409401..26409436,26409776..26409865,26410186..26410247,
FT                   26446583..26446781))
FT                   /codon_start=1
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, isoform CRA_b"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT174544.0
FT                   protein_id=mCP97463.0 isoform=CRA_b"
FT                   /protein_id="EDL29534.1"
FT                   /translation="MSGEDSEVRPVAVAEGSSNGSSGSPSPGDTLPWNLGKTQRSRRSG
FT                   GGSVGNGSVLDPAERAVIRIADERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHN
FT                   LISLLEVLSGDSLPRERDVIRSVRLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRN
FT                   DDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCD
FT                   NFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED
FT                   VDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRANELQLRWQEYRELVLLLLQWIRHHT
FT                   AAFEERKFPSSFEEIEILWCQFLKFKETELPAKEADKNRSKVIYQSLEGAVQAGQLKIP
FT                   PGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVSKLQMEAGLCEEQLNQADA
FT                   LLQSDIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRRVYR
FT                   LHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRR
FT                   IDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDESQLSPATRGAYRDCLGRL
FT                   DLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKE
FT                   SYSALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIE
FT                   AHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQDEKEQL
FT                   NEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVEVTVHKGDQCQLVGP
FT                   AQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQLHVDMKS
FT                   LLAWQSLSRDIQLIRSWSLVTFRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDR
FT                   LVAEREYGSCSRHYQQLLQSLEQGEQEESRCQRCISELKDIRLQLEACETRTVHRLRLP
FT                   LDKDPARECAQRIAEQQAAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELEL
FT                   TLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEAT
FT                   KASLKKLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLER
FT                   WQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAARE
FT                   QLRQEKALLEEIERHGEKVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPAKKPKV
FT                   QSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAE
FT                   VEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQ
FT                   HLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARA
FT                   EEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDEL
FT                   RLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEH
FT                   VTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQ
FT                   ADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRL
FT                   RAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEE
FT                   SRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLT
FT                   EKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERL
FT                   AQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSN
FT                   AEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVER
FT                   LKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQE
FT                   QNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQA
FT                   QAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTT
FT                   LRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEA
FT                   ENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALA
FT                   EKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRT
FT                   LEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQE
FT                   KVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQIL
FT                   QETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQE
FT                   KQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEE
FT                   EHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGI
FT                   LSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLS
FT                   PGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPY
FT                   TGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMN
FT                   RILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDT
FT                   EARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKI
FT                   VITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVR
FT                   QALRGTNVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARL
FT                   TVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLD
FT                   AQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQ
FT                   LQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTV
FT                   WELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPV
FT                   PASELLDAKILSRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTI
FT                   YEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAE
FT                   KAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAY
FT                   QRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEK
FT                   TEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMAD
FT                   FQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLF
FT                   REGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLE
FT                   AQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQ
FT                   AMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEV
FT                   RSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQV
FT                   MDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPG
FT                   TAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSG
FT                   KLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEI
FT                   LTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRK
FT                   RRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDR
FT                   RSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSY
FT                   PISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQ
FT                   ACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQAL
FT                   KKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSK
FT                   YLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTG
FT                   SRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA"
FT   CDS             complement(join(26387430..26393645,26393779..26397159,
FT                   26398170..26398268,26398351..26398455,26398622..26398705,
FT                   26398783..26399139,26399227..26399365,26400745..26400919,
FT                   26401039..26401200,26401289..26401472,26401576..26401702,
FT                   26401795..26401949,26402046..26402198,26403072..26403197,
FT                   26403414..26403509,26403608..26403712,26403899..26404060,
FT                   26404143..26404220,26404306..26404615,26404692..26404846,
FT                   26405537..26405630,26405894..26406021,26406284..26406379,
FT                   26406452..26406571,26406677..26406783,26406855..26406970,
FT                   26407616..26407782,26408656..26408748,26408845..26408922,
FT                   26409776..26409865,26410186..26410247,26444767..>26444905))
FT                   /codon_start=1
FT                   /gene="Plec1"
FT                   /locus_tag="mCG_134437"
FT                   /product="plectin 1, isoform CRA_c"
FT                   /note="gene_id=mCG134437.0 transcript_id=mCT192650.0
FT                   protein_id=mCP113606.0 isoform=CRA_c"
FT                   /protein_id="EDL29535.1"
FT                   /translation="RPPGLALRGGPLRSSPASMAHLLTSGPPPDEQDFIQAYEEVREKY
FT                   KDERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRM
FT                   RFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQ
FT                   SEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQ
FT                   TNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGV
FT                   RANELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIEILWCQFLKFKETELPA
FT                   KEADKNRSKVIYQSLEGAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFER
FT                   LECLQRIVSKLQMEAGLCEEQLNQADALLQSDIRLLASGKVAQRAGEVERDLDKADGMI
FT                   RLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQST
FT                   QRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRA
FT                   KIERARNDESQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKEL
FT                   MWLNEKEEEEVGFDWSDRNTNMAAKKESYSALMRELEMKEKKIKEIQNTGDRLLREDHP
FT                   ARPTVESFQAALQTQWSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRR
FT                   KYSCDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGH
FT                   VPLIAVCDYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEA
FT                   QEAVARLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVTFRTLKPEEQRQ
FT                   ALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQGEQEESRCQ
FT                   RCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQAAQAEVEGLGKGVAR
FT                   LSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGA
FT                   EEVLKTHEEQLKEAQAVPATLQELEATKASLKKLRAQAEAQQPVFNTLRDELRGAQEVG
FT                   ERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPL
FT                   SAWLQDAKRRQEQIQAVPIANCQAAREQLRQEKALLEEIERHGEKVEECQKFAKQYINA
FT                   IKDYELQLITYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFI
FT                   SETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRR
FT                   MQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIR
FT                   VVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAE
FT                   AELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRS
FT                   AEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELE
FT                   RWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAE
FT                   QELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKR
FT                   QELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRAL
FT                   AEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRR
FT                   LAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEI
FT                   MALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREA
FT                   EERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQK
FT                   RLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREA
FT                   AQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAA
FT                   DAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQ
FT                   RSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAA
FT                   RLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQ
FT                   EQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARA
FT                   EEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELERE
FT                   KEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLE
FT                   QLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHL
FT                   EQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGP
FT                   SVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGR
FT                   SSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAV
FT                   KEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATG
FT                   GIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCV
FT                   EDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSE
FT                   YFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSG
FT                   VISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKKDLL
FT                   QPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDP
FT                   YSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKET
FT                   NRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYS
FT                   ELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVI
FT                   KIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEV
FT                   GSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVR
FT                   NQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAI
FT                   RLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENL
FT                   TYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSH
FT                   GGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLAS
FT                   YDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLP
FT                   GSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPEL
FT                   HDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGF
FT                   HLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLL
FT                   LLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSC
FT                   IAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRM
FT                   GIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGI
FT                   IDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITD
FT                   PQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLE
FT                   LSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSI
FT                   TEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTET
FT                   LEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVD
FT                   RINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRV
FT                   SLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLE
FT                   AAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSS
FT                   SGYGRRYASGPSASLGGPESAVA"
FT   gap             26400096..26400115
FT                   /estimated_length=20
FT   gap             26437993..26438259
FT                   /estimated_length=267
FT   gene            26462166..26465315
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /note="gene_id=mCG22092.1"
FT   mRNA            join(26462166..26462311,26463051..26463594,
FT                   26463678..>26463742)
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   transcript variant mCT171950"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171950.0 created
FT                   on 15-AUG-2002"
FT   mRNA            join(26462167..26462311,26463262..26463327,
FT                   26463393..26463588,26463655..26463737,26465203..26465315)
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   transcript variant mCT171949"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171949.0 created
FT                   on 15-AUG-2002"
FT   mRNA            join(26462167..26462311,26463262..26463588,
FT                   26463670..26463779,26463860..26464060,26464183..26464311,
FT                   26464389..26464532,26464628..26464929,26465209..26465296)
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   transcript variant mCT171948"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171948.0 created
FT                   on 15-AUG-2002"
FT   mRNA            join(26462234..26462311,26463051..26463148,
FT                   26463262..26463588,26463670..26463779,26463860..26464060,
FT                   26464183..26464311,26464389..26464532,26464628..26465315)
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   transcript variant mCT171947"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171947.0 created
FT                   on 15-AUG-2002"
FT   mRNA            join(<26462234..26462311,26463262..26463588,
FT                   26463670..26463779,26463860..26464060,26464183..26464311,
FT                   26464389..26464532,26464628..26465315)
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   transcript variant mCT22910"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT22910.0 created
FT                   on 15-AUG-2002"
FT   CDS             join(<26462236..26462311,26463262..26463588,
FT                   26463670..26463779,26463860..26464060,26464183..26464311,
FT                   26464389..26464532,26464628..26464777)
FT                   /codon_start=1
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT22910.0
FT                   protein_id=mCP17804.0 isoform=CRA_c"
FT                   /protein_id="EDL29538.1"
FT                   /translation="CGRTGHHRARLRSGHRKHRSLAPGSGAATEPEAMSHEKSFLVSGD
FT                   SYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQPSPYGQPGYPHGPSPYPQGGYPQGPY
FT                   PQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYYDNQDFPAVNWDKN
FT                   IRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAIFFISLIVLS
FT                   CCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQ
FT                   TRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLG
FT                   NKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE"
FT   CDS             join(26463285..26463588,26463670..26463779,
FT                   26463860..26464060,26464183..26464311,26464389..26464532,
FT                   26464628..26464777)
FT                   /codon_start=1
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171947.0
FT                   protein_id=mCP94867.0 isoform=CRA_a"
FT                   /protein_id="EDL29536.1"
FT                   /translation="MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQ
FT                   PSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQ
FT                   HGNYQEEGPPSYYDNQDFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEV
FT                   KGFVRENVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASF
FT                   YNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRI
FT                   LEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTII
FT                   GRAKE"
FT   CDS             join(26463285..26463588,26463670..26463779,
FT                   26463860..26464060,26464183..26464311,26464389..26464532,
FT                   26464628..26464777)
FT                   /codon_start=1
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171948.0
FT                   protein_id=mCP94866.0 isoform=CRA_a"
FT                   /protein_id="EDL29539.1"
FT                   /translation="MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQ
FT                   PSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQ
FT                   HGNYQEEGPPSYYDNQDFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEV
FT                   KGFVRENVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASF
FT                   YNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRI
FT                   LEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTII
FT                   GRAKE"
FT   CDS             join(26463292..26463327,26463393..26463588,
FT                   26463655..26463737,26465203..26465301)
FT                   /codon_start=1
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171949.0
FT                   protein_id=mCP94868.0 isoform=CRA_b"
FT                   /protein_id="EDL29537.1"
FT                   /translation="MKRVSWCLGTVIAPYPQAPFQPSPYGQPGYPHGPSPYPQGGYPQG
FT                   PYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSSMSPAPQHGNYQEEGPPSYYDNQDFP
FT                   AGGVSFLRWAPRAERMSCFKGGGSLVLPLLKCQ"
FT   CDS             join(26463292..26463594,26463678..>26463742)
FT                   /codon_start=1
FT                   /gene="Grina"
FT                   /locus_tag="mCG_22092"
FT                   /product="glutamate receptor, ionotropic, N-methyl
FT                   D-asparate-associated protein 1 (glutamate binding),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG22092.1 transcript_id=mCT171950.0
FT                   protein_id=mCP94869.0 isoform=CRA_d"
FT                   /protein_id="EDL29540.1"
FT                   /translation="MKRVSWCLGTVILPKTLWGPKPLCLPMFRLPTLGPHTHRPLSSPL
FT                   PMVSQDIPMVPAPIHRVVTLKGPTLKEATHRGHTHRAPSRPTPMDSHHPSRTLAVSHGN
FT                   YQEEGPPSYYDNQDFPAV"
FT   gene            <26483498..26508172
FT                   /gene="Spatc1"
FT                   /locus_tag="mCG_144783"
FT                   /note="gene_id=mCG144783.0"
FT   mRNA            join(<26483498..26483786,26499006..26499662,
FT                   26500153..26500263,26500373..26500512,26507763..26508172)
FT                   /gene="Spatc1"
FT                   /locus_tag="mCG_144783"
FT                   /product="spermatogenesis and centriole associated 1"
FT                   /note="gene_id=mCG144783.0 transcript_id=mCT184207.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<26483498..26483786,26499006..26499662,
FT                   26500153..26500263,26500373..26500512,26507763..26508092)
FT                   /codon_start=1
FT                   /gene="Spatc1"
FT                   /locus_tag="mCG_144783"
FT                   /product="spermatogenesis and centriole associated 1"
FT                   /note="gene_id=mCG144783.0 transcript_id=mCT184207.0
FT                   protein_id=mCP105327.0"
FT                   /protein_id="EDL29541.1"
FT                   /translation="QPGQGPGPWAASRCSALSWAAPSPLPWGMSLLTSYEGLRHQIERL
FT                   VRENEELKKLVRLIRENQELKSAIKTQAGGLCISGFTGGLGEAAAGPPQHQGVFLPPAS
FT                   AAAKEPCSEDLGMVALAPLADMLNTPQLSPAAGSLVNPLAATLNPLLSGQIPLLQNNQF
FT                   ANLVPCSMSNQLTNPTTVSPGVTLASSLGLPSTGPLNSQMTSPMTVPPGTTLASSLGLT
FT                   STGSLTTSSRLVGPLAVSQSSPIMAPLAGTVAVSLSSPLLSSTATPLGVAQNVVPNPIN
FT                   NIGQPETPRVRLAEPTRGNFSGTSAYAGPAPTSKVNDTRGSRVMEQSRKNVVEMERKTP
FT                   HRKSNKLPDNPRDTKQLVCERLVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKIIQ
FT                   ASLNPSNHKLDEDLCQTLTQRYVSIMNKLQSLGYNGRVHPALTEQLVNEYGILRERPEL
FT                   AASEGGCYTVDFLQRVLLETVHPSKLTDALLLLSCLHQLSHDDGKPMFIW"
FT   gap             26498172..26498191
FT                   /estimated_length=20
FT   gap             26502644..26502885
FT                   /estimated_length=242
FT   gap             26508442..26509019
FT                   /estimated_length=578
FT   gene            26509809..26512897
FT                   /locus_tag="mCG_22096"
FT                   /note="gene_id=mCG22096.1"
FT   mRNA            join(26509809..26510814,26510913..26510985,
FT                   26511207..26511347,26511418..26511507,26511601..26511664,
FT                   26511749..26511884,26511959..26512543,26512642..26512897)
FT                   /locus_tag="mCG_22096"
FT                   /product="mCG22096"
FT                   /note="gene_id=mCG22096.1 transcript_id=mCT23857.1 created
FT                   on 18-OCT-2002"
FT   CDS             join(26509957..26510814,26510913..26510985,
FT                   26511207..26511347,26511418..26511507,26511601..26511664,
FT                   26511749..26511884,26511959..26512048)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22096"
FT                   /product="mCG22096"
FT                   /note="gene_id=mCG22096.1 transcript_id=mCT23857.1
FT                   protein_id=mCP17887.2"
FT                   /db_xref="GOA:D6MZJ6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:3709877"
FT                   /db_xref="UniProtKB/TrEMBL:D6MZJ6"
FT                   /protein_id="EDL29542.1"
FT                   /translation="MSLPDISRRRSPVPQEDWPLTPNALRPSPFPNPVLQALYSLSRVL
FT                   LFPTYWSLDQLLGCWAPSVRSKSLGWFKVLAGSGVLLPLVVVGLPLALVGLALWLPLQV
FT                   WRRPFCYQPPPACWVWPQPWHPPAERRRCFVFLTANLCLLPHGLAHFNNLSHSLQRAEA
FT                   VGAALLDSLQSSQYRVSECSQPPPRVPGGELKATLPMGLDFVCLQEVFDLRAARRLVRV
FT                   LVPNLGPVIYDVGTFGLMAGPYIKVLGSGLLLASRYPLLRATFRCFPNARREDAMASKG
FT                   LLSVQAQLGIVDGHPIVGYLHCTHLHAPVEDGHIRCKQLTLLLEWVEEFEAENRQSDEA
FT                   VAFSVLLGDLNFDNCSQDHAKEQGHKLFSCFQDPCRLGVCQEQPWALGTILNSSMLRHS
FT                   IACSPEMLRRALRQEKGRRLYLSGPLHGSYPAQSWKGRRLDYITYRRVPGSRLSPEAEQ
FT                   VTFSTAFAGLTDHLAMGLKLQVVCS"
FT   gene            complement(26511958..26522797)
FT                   /gene="Oplah"
FT                   /locus_tag="mCG_22089"
FT                   /note="gene_id=mCG22089.2"
FT   mRNA            complement(join(26511958..26512304,26512444..26512541,
FT                   26512640..26512800,26512882..26513039,26513142..26513291,
FT                   26513429..26513563,26513659..26513805,26513910..26514094,
FT                   26516349..26516523,26516616..26516717,26516810..26516970,
FT                   26517569..26517720,26517905..26518017,26518154..26518292,
FT                   26518379..26518516,26518701..26518871,26518959..26519071,
FT                   26519610..26519875,26519989..26520056,26520157..26520295,
FT                   26520416..26520581,26520663..26520858,26520971..26521094,
FT                   26521184..26521283,26521722..26521913,26521998..26522221,
FT                   26522751..26522797))
FT                   /gene="Oplah"
FT                   /locus_tag="mCG_22089"
FT                   /product="5-oxoprolinase (ATP-hydrolysing)"
FT                   /note="gene_id=mCG22089.2 transcript_id=mCT22907.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(26512158..26512304,26512444..26512541,
FT                   26512640..26512800,26512882..26513039,26513142..26513291,
FT                   26513429..26513563,26513659..26513805,26513910..26514094,
FT                   26516349..26516523,26516616..26516717,26516810..26516970,
FT                   26517569..26517720,26517905..26518017,26518154..26518292,
FT                   26518379..26518516,26518701..26518871,26518959..26519071,
FT                   26519610..26519875,26519989..26520056,26520157..26520295,
FT                   26520416..26520581,26520663..26520858,26520971..26521094,
FT                   26521184..26521283,26521722..26521913,26521998..26522168))
FT                   /codon_start=1
FT                   /gene="Oplah"
FT                   /locus_tag="mCG_22089"
FT                   /product="5-oxoprolinase (ATP-hydrolysing)"
FT                   /note="gene_id=mCG22089.2 transcript_id=mCT22907.2
FT                   protein_id=mCP17836.2"
FT                   /protein_id="EDL29543.1"
FT                   /translation="MGSPEERFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYAD
FT                   APTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGF
FT                   RDLLHIGTQARPDLFDLAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGDLLEI
FT                   QQPVDLAALRGKLEGLLTRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEV
FT                   MPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFS
FT                   GSRAVLSGPAGGVVGYSTTTYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGV
FT                   TLQAPQLDINTVAAGGGSRLFFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLG
FT                   RLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLASGPCPASQLSLEEVAMGFV
FT                   RVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLL
FT                   SALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTES
FT                   FLHLRYQGTDCALMVSANQHPATTCSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVR
FT                   VRGTGRSGLQLEETSKIQSGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLI
FT                   IDNNSTILVEPGCQAEVIETGDIRISVGAEAPSMIDTKLDPIQLSIFSHRFMSIAEQMG
FT                   RILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLH
FT                   PGDVLLSNHPSAGGSHLPDLTVITPVFWPGQSRPVFYVASRGHHADIGGITPGSMPPHS
FT                   TTLQQEGAVFLSFKLVQGGVFQEEAVTEALQAPGKISGCSGTRNLHDNLSDLRAQVAAN
FT                   QKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSAKDH
FT                   MDDGSPICLHVQINLNQGSAVFDFSGSGSEVFGNLNAPRAITLSALIYCLRCLVGRDIP
FT                   LNQGCLAPVQVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNV
FT                   TLGNARMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRP
FT                   GSGGRGRFRGGDGVVRELVFREEALLSVLTERRAFQPYGLHGGEPGTRGLNLLIRKDGR
FT                   TVNLGGKTSVTVYPGDAFCLHTPGGGGYGDPEDPAPPPGSPPLYPAFPERGSVYEYRRA
FT                   QEAV"
FT   gene            <26542919..26546200
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /note="gene_id=mCG22095.2"
FT   mRNA            join(<26542919..26543186,26544553..26544759,
FT                   26544879..26546193)
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, transcript variant
FT                   mCT192601"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT192601.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26542938..26543186,26544553..26544759,
FT                   26544879..26545238)
FT                   /codon_start=1
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, isoform CRA_b"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT192601.0
FT                   protein_id=mCP113577.0 isoform=CRA_b"
FT                   /protein_id="EDL29545.1"
FT                   /translation="KGNVPTEVVVLKVQVELSEAESGLYIMAGLELLSDQGYRIDGRRA
FT                   GELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSS
FT                   ATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAA
FT                   CVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQI
FT                   ALLEMDSRLHEDHLEQVLEAAAQAARGVHTLLDLVVRQHVQEASVSLGD"
FT   mRNA            join(26542951..26543190,26544553..26544759,
FT                   26544879..26546200)
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, transcript variant mCT22913"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT22913.2 created
FT                   on 18-OCT-2002"
FT   mRNA            join(26542959..26543190,26544553..26544631,
FT                   26545168..26546196)
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, transcript variant
FT                   mCT174556"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT174556.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(26543122..26543190,26544553..26544759,
FT                   26544879..26545238)
FT                   /codon_start=1
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, isoform CRA_c"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT22913.2
FT                   protein_id=mCP17884.2 isoform=CRA_c"
FT                   /protein_id="EDL29546.1"
FT                   /translation="MARLTSSRATPRHWRWSTGRTRRIRGSRSRALPDRALVNCQYSSA
FT                   TFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAAC
FT                   VNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIA
FT                   LLEMDSRLHEDHLEQVLEAAAQAARGVHTLLDLVVRQHVQEASVSLGD"
FT   CDS             join(26543122..26543190,26544553..26544631,
FT                   26545168..26545238)
FT                   /codon_start=1
FT                   /gene="Exosc4"
FT                   /locus_tag="mCG_22095"
FT                   /product="exosome component 4, isoform CRA_a"
FT                   /note="gene_id=mCG22095.2 transcript_id=mCT174556.0
FT                   protein_id=mCP97475.0 isoform=CRA_a"
FT                   /protein_id="EDL29544.1"
FT                   /translation="MARLTSSRATPRHWRWSTGRTRRIRGSRSRALPDRALVNCQYSSA
FT                   TFSTGVHTLLDLVVRQHVQEASVSLGD"
FT   gene            26546882..26550422
FT                   /gene="Gpaa1"
FT                   /locus_tag="mCG_22090"
FT                   /note="gene_id=mCG22090.1"
FT   mRNA            join(26546882..26546986,26547419..26547598,
FT                   26547683..26547794,26548007..26548154,26548233..26548334,
FT                   26548426..26548896,26548987..26549140,26549318..26549413,
FT                   26549537..26549727,26549813..26549983,26550105..26550422)
FT                   /gene="Gpaa1"
FT                   /locus_tag="mCG_22090"
FT                   /product="GPI anchor attachment protein 1, transcript
FT                   variant mCT172046"
FT                   /note="gene_id=mCG22090.1 transcript_id=mCT172046.0 created
FT                   on 15-AUG-2002"
FT   mRNA            join(26546888..26546986,26547419..26547598,
FT                   26547683..26547794,26548007..26548154,26548233..26548334,
FT                   26548426..26548622,26548700..26548896,26548987..26549140,
FT                   26549318..26549413,26549537..26549727,26549813..26549983,
FT                   26550105..26550422)
FT                   /gene="Gpaa1"
FT                   /locus_tag="mCG_22090"
FT                   /product="GPI anchor attachment protein 1, transcript
FT                   variant mCT22908"
FT                   /note="gene_id=mCG22090.1 transcript_id=mCT22908.1 created
FT                   on 15-AUG-2002"
FT   CDS             join(26546913..26546986,26547419..26547598,
FT                   26547683..26547794,26548007..26548154,26548233..26548334,
FT                   26548426..26548622,26548700..26548896,26548987..26549140,
FT                   26549318..26549413,26549537..26549727,26549813..26549983,
FT                   26550105..26550348)
FT                   /codon_start=1
FT                   /gene="Gpaa1"
FT                   /locus_tag="mCG_22090"
FT                   /product="GPI anchor attachment protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG22090.1 transcript_id=mCT22908.1
FT                   protein_id=mCP17907.1 isoform=CRA_b"
FT                   /protein_id="EDL29548.1"
FT                   /translation="MGLLSDPVRRRALARIVLRLNTPLCVLSYVAGIAWFLALAFPPLT
FT                   QRTYMSENAMGSTMVEEQFVGGDRARSFARDFAAHRKKPGALPVAWLERSMRSVGLEVY
FT                   TQSFSRKLPFPDETHERYMVSGTNVYGILRAPRSASTESLVLTVPCGPDATNSQAVGLL
FT                   LALAAHFRGQIYWAKDIIFLVTDHDLLGTEAWLEAYHDINVTGIQSSPLQGRAGAIQAA
FT                   VALELSSDVVTSLDVTVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPQDWTSLE
FT                   GPLQGLQTLLLMVLRQASGRPHGPHGLFLRYGVEALTLRGINSFRQYKYDLATVGKALE
FT                   GMFRKLNHLLERLHQSFFFYLLPALSRFVSIGLYMPATGFLLLVLGLKALELWMQLHQA
FT                   GVNPEEAGKAPSPGTPLLPTQGVGLASLTAPLLISQAMGLALYFLPVLGQHLATQHFPV
FT                   AEAEAVVLTLLAIYVAGLALPHNTHRVVNSQVPDRGWMALKLVALIYLALQLGCIALLN
FT                   FSLGFLLAATMVPAAALAKPHGPRTLYAALLVVTSPAVTLFGSLFLWRELLEVPLSLAE
FT                   GWQLFLTALAQGVLEHYTYGALLFPILALGLYPCWLLFWNVLFWK"
FT   CDS             join(26546913..26546986,26547419..26547598,
FT                   26547683..26547794,26548007..26548154,26548233..26548334,
FT                   26548426..26548667)
FT                   /codon_start=1
FT                   /gene="Gpaa1"
FT                   /locus_tag="mCG_22090"
FT                   /product="GPI anchor attachment protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG22090.1 transcript_id=mCT172046.0
FT                   protein_id=mCP94965.0 isoform=CRA_a"
FT                   /protein_id="EDL29547.1"
FT                   /translation="MGLLSDPVRRRALARIVLRLNTPLCVLSYVAGIAWFLALAFPPLT
FT                   QRTYMSENAMGSTMVEEQFVGGDRARSFARDFAAHRKKPGALPVAWLERSMRSVGLEVY
FT                   TQSFSRKLPFPDETHERYMVSGTNVYGILRAPRSASTESLVLTVPCGPDATNSQAVGLL
FT                   LALAAHFRGQIYWAKDIIFLVTDHDLLGTEAWLEAYHDINVTGIQSSPLQGRAGAIQAA
FT                   VALELSSDVVTSLDVTVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKVGPPAWEPGA
FT                   REKG"
FT   gene            26553108..26553928
FT                   /locus_tag="mCG_22088"
FT                   /note="gene_id=mCG22088.0"
FT   mRNA            26553108..26553928
FT                   /locus_tag="mCG_22088"
FT                   /product="mCG22088"
FT                   /note="gene_id=mCG22088.0 transcript_id=mCT22906.0 created
FT                   on 15-NOV-2002"
FT   CDS             26553139..26553888
FT                   /codon_start=1
FT                   /locus_tag="mCG_22088"
FT                   /product="mCG22088"
FT                   /note="gene_id=mCG22088.0 transcript_id=mCT22906.0
FT                   protein_id=mCP17906.1"
FT                   /protein_id="EDL29549.1"
FT                   /translation="MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
FT                   KGYVVRISGGNDKQGFPMKQGVLTRGRVHLLLSKGHSCYRPRRTGDRKRKSVHGCIVDA
FT                   NLSVLNLAIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLN
FT                   KEGKKPRTKAPKIQRLVTPRVLQHKCRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKE
FT                   KRQEQIAKRRRLSSLRASTSKSESSQK"
FT   gene            26559045..26561458
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /note="gene_id=mCG22086.1"
FT   mRNA            join(26559045..26559216,26559826..26560022,
FT                   26560106..26560232,26560336..26560493,26560577..26560737,
FT                   26561001..26561101,26561179..26561458)
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, transcript variant mCT22904"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT22904.1 created
FT                   on 15-AUG-2002"
FT   mRNA            join(26559045..26559216,26559826..26560022,
FT                   26560106..26560136,26560388..26560493,26560577..26560737,
FT                   26561001..26561101,26561179..26561458)
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, transcript variant mCT172045"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT172045.0 created
FT                   on 15-AUG-2002"
FT   CDS             join(26559088..26559216,26559826..26560022,
FT                   26560106..26560232,26560336..26560493,26560577..26560737,
FT                   26561001..26561101,26561179..26561283)
FT                   /codon_start=1
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, isoform CRA_c"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT22904.1
FT                   protein_id=mCP17889.1 isoform=CRA_c"
FT                   /protein_id="EDL29552.1"
FT                   /translation="MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAV
FT                   SLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSS
FT                   LDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGE
FT                   MFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPP
FT                   TGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPE
FT                   HDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK"
FT   CDS             join(26559088..26559216,26559826..26560022,
FT                   26560106..26560136,26560388..26560493,26560577..26560737,
FT                   26561001..26561027)
FT                   /codon_start=1
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, isoform CRA_b"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT172045.0
FT                   protein_id=mCP94963.0 isoform=CRA_b"
FT                   /protein_id="EDL29551.1"
FT                   /translation="MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAV
FT                   SLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSS
FT                   LDHTSIRRGFQVYKQGSCLTIFQNHTLTLRLQELLTMELYPLTSATSFELGMVVRTTYF
FT                   PCSLATVSPPLGCHCEKASISTLTFPARPLAWLLPSTQKSWSMMMAPQLPCHK"
FT   mRNA            join(<26560377..26560420,26560654..26560718,
FT                   26561064..26561101,26561179..26561453)
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, transcript variant mCT172044"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT172044.0 created
FT                   on 15-AUG-2002"
FT   CDS             join(<26560401..26560420,26560654..26560718,
FT                   26561064..26561101,26561179..26561283)
FT                   /codon_start=1
FT                   /gene="Cyc1"
FT                   /locus_tag="mCG_22086"
FT                   /product="cytochrome c-1, isoform CRA_a"
FT                   /note="gene_id=mCG22086.1 transcript_id=mCT172044.0
FT                   protein_id=mCP94964.0 isoform=CRA_a"
FT                   /protein_id="EDL29550.1"
FT                   /translation="LFSKTIPPLFQPLLSRPGHWHGSSHLHRKPEHDHRKRMGLKMLLM
FT                   MGLLLPLTYAMKRHKWSVLKSRKLAYRPPK"
FT   gene            complement(26562562..>26566634)
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /note="gene_id=mCG22093.2"
FT   mRNA            complement(join(26562562..26562709,26562783..26562911,
FT                   26563006..26563118,26563188..26563341,26563420..26563528,
FT                   26563610..26563751,26563825..26563959,26565579..26565753,
FT                   26566005..26566628))
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   transcript variant mCT22911"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT22911.2 created
FT                   on 22-OCT-2002"
FT   mRNA            complement(join(26562565..26562709,26562783..26563341,
FT                   26563420..26563528,26563610..26563751,26563825..26563959,
FT                   26565579..26565753,26566005..>26566634))
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   transcript variant mCT192599"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT192599.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26562565..26562709,26562783..26562911,
FT                   26563006..26563118,26563188..26563341,26563420..26563528,
FT                   26563610..26563751,26563825..26563959,26566005..>26566575))
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   transcript variant mCT174879"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT174879.0 created
FT                   on 22-OCT-2002"
FT   mRNA            complement(join(26562565..26562709,26562783..26562911,
FT                   26563006..26563118,26563188..26563341,26563420..26563528,
FT                   26563610..26563751,26563825..26563959,26565579..26565715,
FT                   26566005..>26566575))
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   transcript variant mCT174880"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT174880.0 created
FT                   on 22-OCT-2002"
FT   CDS             complement(join(26562795..26562911,26563006..26563118,
FT                   26563188..26563341,26563420..26563528,26563610..26563751,
FT                   26563825..26563959,26565579..26565753,26566005..26566202))
FT                   /codon_start=1
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT22911.2
FT                   protein_id=mCP17808.2 isoform=CRA_c"
FT                   /protein_id="EDL29555.1"
FT                   /translation="MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQL
FT                   IADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLD
FT                   PEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQS
FT                   SGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTV
FT                   EDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLA
FT                   SYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSP
FT                   SQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST"
FT   CDS             complement(join(26562795..26562911,26563006..26563118,
FT                   26563188..26563341,26563420..26563528,26563610..26563751,
FT                   26563825..26563959,26566005..>26566053))
FT                   /codon_start=1
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT174879.0
FT                   protein_id=mCP97798.0 isoform=CRA_a"
FT                   /protein_id="EDL29553.1"
FT                   /translation="AAWTLPARTVRHRAWGGSGSPAPAPAPAMCPISPPCSSMAQIPKA
FT                   TQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFP
FT                   PGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGR
FT                   CLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDL
FT                   QPSSSSLPSPSQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST"
FT   CDS             complement(join(26562795..26562911,26563006..26563118,
FT                   26563188..26563341,26563420..26563528,26563610..26563751,
FT                   26563825..26563959,26565579..26565715,26566005..>26566021))
FT                   /codon_start=1
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT174880.0
FT                   protein_id=mCP97799.0 isoform=CRA_d"
FT                   /protein_id="EDL29556.1"
FT                   /translation="APSLGRVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDA
FT                   TAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLS
FT                   QAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAH
FT                   VSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLY
FT                   LLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFIN
FT                   ASNRPGCEMCSTQRPCAWDPLAAAST"
FT   CDS             complement(join(26563183..26563341,26563420..26563528,
FT                   26563610..26563751,26563825..26563959,26565579..26565753,
FT                   26566005..>26566427))
FT                   /codon_start=1
FT                   /gene="Sharpin"
FT                   /locus_tag="mCG_22093"
FT                   /product="SHANK-associated RH domain interacting protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22093.2 transcript_id=mCT192599.0
FT                   protein_id=mCP113576.0 isoform=CRA_b"
FT                   /protein_id="EDL29554.1"
FT                   /translation="KVTSLAGPCLEIWDHSYRLASHQALVVRSIGSFLFSKLWGIRNRG
FT                   SQSEFLAGGSTRQFSITEALSESQDSAGSEMSPPAGGAAVAADPASPVVLLAVHAAVRP
FT                   LGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHEL
FT                   QPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSM
FT                   AQIPKATQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQL
FT                   MEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQ
FT                   RWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSG"
FT   gene            <26566830..26569902
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /note="gene_id=mCG22085.4"
FT   mRNA            join(<26566830..26567183,26567944..26568076,
FT                   26568170..26568298,26568371..26568536,26568662..26568783,
FT                   26568865..26568984,26569110..26569244,26569371..26569896)
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), transcript variant
FT                   mCT192632"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT192632.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(26566875..26567183,26567520..26567565,
FT                   26567944..26568076,26568170..26568298,26568371..26568536,
FT                   26568662..26568783,26568865..26568984,26569110..26569244,
FT                   26569371..26569902)
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), transcript variant
FT                   mCT174553"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174553.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(26566875..26567183,26567991..26568076,
FT                   26568170..26568298,26568371..26568536,26568662..26568783,
FT                   26568865..26568984,26569110..26569244,26569371..26569902)
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), transcript variant
FT                   mCT174552"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174552.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(26566899..26567183,26567991..26568076,
FT                   26569212..26569244,26569371..26569902)
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), transcript variant
FT                   mCT174555"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174555.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(26567022..26567183,26567944..26568076,
FT                   26568170..26568298,26568371..26568536,26568662..26568687,
FT                   26569655..26569886)
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), transcript variant
FT                   mCT174554"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174554.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(<26567165..26567183,26567944..26568076,
FT                   26568170..26568298,26568371..26568536,26568662..26568783,
FT                   26568865..26568984,26569110..26569244,26569371..26569392)
FT                   /codon_start=1
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT192632.0
FT                   protein_id=mCP113575.0 isoform=CRA_d"
FT                   /protein_id="EDL29561.1"
FT                   /translation="SSPILAGSAALIPLAQESPFPKDMKLLENSSFEAINSQLTVETGD
FT                   AHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDE
FT                   SPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVR
FT                   EDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIV
FT                   FFSCRSISGSTYTPSEAGNALDLELGAEEADEESGGGGGEGRAEETSTMEEDRVPVICM
FT                   "
FT   CDS             join(26567994..26568076,26568170..26568298,
FT                   26568371..26568536,26568662..26568687,26569655..26569730)
FT                   /codon_start=1
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174554.0
FT                   protein_id=mCP97471.0 isoform=CRA_b"
FT                   /protein_id="EDL29559.1"
FT                   /translation="MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFK
FT                   QFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNESF
FT                   RPDYDFSTARSHEFSREPSLRWVVNAVNCSLLSQTGQLDHRVYFCISYWACTLQL"
FT   CDS             join(26567994..26568076,26568170..26568298,
FT                   26568371..26568536,26568662..26568783,26568865..26568984,
FT                   26569110..26569244,26569371..26569392)
FT                   /codon_start=1
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174552.0
FT                   protein_id=mCP97472.0 isoform=CRA_a"
FT                   /protein_id="EDL29557.1"
FT                   /translation="MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFK
FT                   QFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNESF
FT                   RPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVREDFKALKPQLWNAVDEEICLAEC
FT                   DIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNALDL
FT                   ELGAEEADEESGGGGGEGRAEETSTMEEDRVPVICM"
FT   CDS             join(26567994..26568076,26568170..26568298,
FT                   26568371..26568536,26568662..26568783,26568865..26568984,
FT                   26569110..26569244,26569371..26569392)
FT                   /codon_start=1
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174553.0
FT                   protein_id=mCP97473.0 isoform=CRA_a"
FT                   /protein_id="EDL29558.1"
FT                   /translation="MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFK
FT                   QFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNESF
FT                   RPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVREDFKALKPQLWNAVDEEICLAEC
FT                   DIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNALDL
FT                   ELGAEEADEESGGGGGEGRAEETSTMEEDRVPVICM"
FT   CDS             join(26567994..26568076,26569212..26569244,
FT                   26569371..26569392)
FT                   /codon_start=1
FT                   /gene="Maf1"
FT                   /locus_tag="mCG_22085"
FT                   /product="MAF1 homolog (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG22085.4 transcript_id=mCT174555.0
FT                   protein_id=mCP97474.0 isoform=CRA_c"
FT                   /protein_id="EDL29560.1"
FT                   /translation="MKLLENSSFEAINSQLTVETGDAHIIGRAEETSTMEEDRVPVICM
FT                   "
FT   gap             26578693..26578712
FT                   /estimated_length=20
FT   gene            26584433..26586977
FT                   /gene="Brp16"
FT                   /locus_tag="mCG_22084"
FT                   /note="gene_id=mCG22084.1"
FT   mRNA            join(26584433..26585057,26585103..26585143,
FT                   26585226..26585326,26585430..26585528,26585736..26585827,
FT                   26585906..26586028,26586106..26586977)
FT                   /gene="Brp16"
FT                   /locus_tag="mCG_22084"
FT                   /product="brain protein 16"
FT                   /note="gene_id=mCG22084.1 transcript_id=mCT22902.2 created
FT                   on 16-AUG-2002"
FT   CDS             join(26584491..26585057,26585103..26585143,
FT                   26585226..26585326,26585430..26585528,26585736..26585827,
FT                   26585906..26586028,26586106..26586258)
FT                   /codon_start=1
FT                   /gene="Brp16"
FT                   /locus_tag="mCG_22084"
FT                   /product="brain protein 16"
FT                   /note="gene_id=mCG22084.1 transcript_id=mCT22902.2
FT                   protein_id=mCP17867.2"
FT                   /protein_id="EDL29562.1"
FT                   /translation="MRGPGVGSGFSGERGLLEQEAGADTEAVELLPFLVLGARADLQAA
FT                   AAQHVLALTGAGSGRTLLAGQPELLRALVDLAVAPAPAPSRDASRALVNLAADPNVHWQ
FT                   LLAADPELPARLLRCVLDPQWPWAEEAAAVLANLSREPAPCAALMEKLMAAEPERLGLE
FT                   RLVNALCTPSYNAAAPLHYLGPLLSNPQAEVRAFLLDPDRCVVQRLLPLTQYTDSSVRR
FT                   GGVVGTLRNCCFEHRHHKWLLGAQVDILPFLLLPLAGPEEFSEEEMDQLPVDLQYLSPD
FT                   KQREPDADIRKMLIEAVMLLTATAPGRKQVRDQGAYLILRELHSWEPEPDVRMACEKLI
FT                   QVLIGDEPEAGMENLLEVQVPEDVEQQLQELDQQEQQELAQELRGNGAPHT"
FT   gap             26585058..26585077
FT                   /estimated_length=20
FT   gene            complement(26587529..26590516)
FT                   /gene="Tssk5"
FT                   /locus_tag="mCG_22091"
FT                   /note="gene_id=mCG22091.0"
FT   mRNA            complement(join(26587529..26587841,26587931..26588062,
FT                   26588437..26588552,26588634..26588766,26589084..26589139,
FT                   26589217..26589419,26589599..26589706,26590057..26590516))
FT                   /gene="Tssk5"
FT                   /locus_tag="mCG_22091"
FT                   /product="testis-specific serine kinase 5"
FT                   /note="gene_id=mCG22091.0 transcript_id=mCT22909.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(26587675..26587841,26587931..26588062,
FT                   26588437..26588552,26588634..26588766,26589084..26589139,
FT                   26589217..26589419,26589599..26589706,26590057..26590260))
FT                   /codon_start=1
FT                   /gene="Tssk5"
FT                   /locus_tag="mCG_22091"
FT                   /product="testis-specific serine kinase 5"
FT                   /note="gene_id=mCG22091.0 transcript_id=mCT22909.1
FT                   protein_id=mCP17866.1"
FT                   /protein_id="EDL29563.1"
FT                   /translation="MRSSSWRKSDQRVFIEQVRECMNNGYLLSSKKIGSGAFSKVYLAY
FT                   ATRERMKHNPRLSSDLRGKRHTMVAIKIVSMAEAPAEYSRKFLPREILSLNATYKHMNI
FT                   VQLYETYQNSQRSYLVLELAARGDLLEHINAVSDLRCCPGLEEEEARRLFWQLVSAVAH
FT                   CHNVGIVHRDLKCENILLDDQGFIKLTDFGFANWVGLKNSLLSTFCGSVAYTAPEILMS
FT                   KKYNGEQADLWSLGIILHAMVSGKLPFKEHQPHRMLNLIRRGPIFRPGLSPECRDLIRG
FT                   LLQLHPCERLDLQQVAAHCWMLPAEHMLSSALGAPREQDHSWSTVAPDNTEPDRDTRHA
FT                   RSKGSSSSSGRTSPRRPSLAQLCNTWKPAPEQ"
FT   gene            <26596093..26668933
FT                   /locus_tag="mCG_134445"
FT                   /note="gene_id=mCG134445.2"
FT   mRNA            join(<26596093..26596147,26605602..26605698,
FT                   26607952..26608030,26609374..26609519,26617226..26617357,
FT                   26617783..26617945,26618133..26618231,26623543..26624179,
FT                   26624534..26624626,26628553..26628631,26629913..26629983,
FT                   26632944..26633066,26636788..26639483,26642759..26642866,
FT                   26643162..26644035,26644299..26644351,26644803..26644910,
FT                   26645438..26645557,26645827..26645949,26647799..26647945,
FT                   26648022..26648048,26648924..26649046,26649188..26649267,
FT                   26649477..26649591,26649713..26650437,26651420..26651555,
FT                   26651655..26651767,26652888..26653040,26662412..26663261,
FT                   26664649..26664895,26665982..26666119,26666535..26666649,
FT                   26666958..26667104,26667243..26667431,26667701..26667856,
FT                   26667940..26668074,26668143..26668245,26668324..26668389,
FT                   26668722..26668933)
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, transcript variant mCT192618"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT192618.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(26596103..26596147,26605602..26605698,
FT                   26607952..26608030,26609374..26609519,26617226..26617357,
FT                   26617783..26617945,26618133..26618231,26623543..26623694,
FT                   26624039..26624179,26624534..26624626,26628553..26628631,
FT                   26629870..26629983,26636788..26636861,26639364..26639483,
FT                   26642759..26642866,26643162..26643306,26643552..26643592,
FT                   26643894..26644035,26644299..26644351,26644803..26644910,
FT                   26645438..26645557,26645827..26645949,26647799..26647945,
FT                   26648924..26649046,26649188..26649267,26649477..26649591,
FT                   26649713..26649808,26650333..26650437,26651420..26651555,
FT                   26651655..26651767,26652888..26653040,26659146..26659300,
FT                   26662412..26662577,26663065..26663261,26665982..26666119,
FT                   26666535..26666649,26666958..26667104,26667243..26667431,
FT                   26667701..26667856,26667940..26668074,26668143..26668245,
FT                   26668324..26668389,26668722..26668932)
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, transcript variant mCT135830"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT135830.1
FT                   created on 15-NOV-2002"
FT   mRNA            join(<26605594..26605698,26607952..26608030,
FT                   26609374..26609519,26617226..26617357,26617783..26617945,
FT                   26618133..26618231,26623543..26623694,26624039..26624179,
FT                   26624534..26624626,26628553..26628631,26629870..26629983,
FT                   26636788..26636861,26639364..26639483,26642759..26642866,
FT                   26643162..26643306,26643552..26643592,26643894..26644035,
FT                   26644299..26644351,26644803..26644910,26645438..26645557,
FT                   26645827..26645949,26647799..26647945,26648022..26648048,
FT                   26648924..26649046,26649188..26649267,26649477..26649591,
FT                   26649713..26649808,26650333..26650437,26651420..26651555,
FT                   26651655..26651767,26652888..26653040,26659146..26659300,
FT                   26662412..26662577,26663065..26663261,26665982..26666119,
FT                   26666535..26666649,26666958..26667104,26667243..26667431,
FT                   26667701..26667856,26667940..26668074,26668143..26668245,
FT                   26668324..26668389,26668722..26668933)
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, transcript variant mCT192617"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT192617.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<26605594..26605698,26607952..26608030,
FT                   26609374..26609519,26617226..26617357,26617783..26617945,
FT                   26618133..26618231,26623543..26623694,26624039..26624179,
FT                   26624534..26624626,26628553..26628631,26629870..26629983,
FT                   26636788..26636861,26639364..26639483,26642759..26642866,
FT                   26643162..26643306,26643552..26643592,26643894..26644035,
FT                   26644299..26644351,26644803..26644910,26645438..26645557,
FT                   26645827..26645949,26647799..26647945,26648022..26648048,
FT                   26648924..26649046,26649188..26649267,26649477..26649591,
FT                   26649713..26649808,26650333..26650437,26651420..26651555,
FT                   26651655..26651767,26652888..26653040,26659146..26659300,
FT                   26662412..26662577,26663065..26663261,26665982..26666119,
FT                   26666535..26666649,26666958..26667104,26667243..26667431,
FT                   26667701..26667856,26667940..26668074,26668143..26668245,
FT                   26668324..26668389,26668722..26668807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, isoform CRA_b"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT192617.0
FT                   protein_id=mCP113561.0 isoform=CRA_b"
FT                   /protein_id="EDL29565.1"
FT                   /translation="LFRCSPGRRLGCCADAAVLKALCLPSVLSATWDFLAGEEAIHAHT
FT                   GQAEAESTEMTRPYIKRLSFTLLDSITDKDPMVQEQVCSALCSLGDAQPDETLHACEEY
FT                   LRQHDKLAHPYRTKILRAMETVLSSHIHDLDKDTAGAVILLATSEMTRTKELDCDWQQA
FT                   AGSVLVAVGKRFTNQVMEEVLSRFQPGMLPHSSVLHTLANLSVSNAFDMVPFLPSILST
FT                   MLPMLSMAKQDALKVVFCGALQHFSESILEYLANLDQAPDPTVRKDTFGADIFGAYDVL
FT                   FHHWLQSRDAKLRLAVVAALGPMSHLLPSERLEEQLPKLLPAVLGLYKKHAEAFQISKS
FT                   LGQILEAAVNVSSRTLEVQLDALLVALHAQICVPVESSSPLVMNSQKEVLRCFTVLACC
FT                   SPDRLLAFLLPRLDTSNERLRVGTLQILRHIINSAAAQMEAKQPFILSSMRLPLLDTND
FT                   KVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPAEEPEKPGPDGEDLAADSVRA
FT                   VSIRTLYLVSTTVDRMNSVLWPYLLEFLTPVRFTAALTPLCRSLVHLALKRQEAGADDF
FT                   LIQYNANANLPSPFAMTTRLLVVSSNPYLGDGRGAASLRLLKVMHQNIHPFLGQRWETT
FT                   MPMLLEYLDEHTEESLSLKEWEEKLLMFLRDTLAVVSDNIWICQLSQEMCKQLPSYSGT
FT                   PQEKNFLYKCIGTTLGAASSKEVVRKHLRELLETARYQEEAEQEGLACCFGICAITHLE
FT                   DTLAQLEDFVRSDVFRKSTGIFSIFKDRSEHEVERMKSCLILCYGHVAAQAPRELVLAR
FT                   VESDILRSMFQCFNTKVLGIKVETKDPALKLCLVQSLCMVSQAMCSSAQASSFHFLRKT
FT                   ELVTQMMEFIRAEPPDCLRTPIRKKAMLACTYLVNLEPALEEQTQADVVHSCLHSVMAL
FT                   PPEAEGGDGVGREPLYLDTVCALEDLLTRLLRQNMTPQGLQIMVEHLSPWIKSPRGHER
FT                   ARALGLGACLLEFFQEHLLVSTLVPFHNLGLLVGLFAPRCADTWTTTRQKAVGCVYSLL
FT                   YLQLGYEGFSRDHRDDVAERLLTLQDGLVNADPTILFHTCHSIAQVIAKRLPSDQLISL
FT                   LLTVFESLGDPDKNCSRAATVMINCLLKERGNVLLEKVPEIVSVLRAKLRDTQEEHVLP
FT                   AAQHSVYLLASQHCEAVVSSLLGSPLPFDSHTCALWRALAVEPGLTAQVLELLLEKMSK
FT                   DVPFKESRAFLLGSTADRVATLLPLAATCALYEVLSAPSSGTVVLELYPQLFAALLLRV
FT                   SCTVGVQLPRNLQAKERRSTSPARAARNLDPCSSAVDALQALLLRSGSQDMLRCVELER
FT                   GWELLKTSAGHEDGVAQLASSMAKYAGPRLPPVTKALACTQNSVYEIQRVTSTAFLAEL
FT                   LSSNVVNDLMLLEPLLDNLTARLKDSSASVRRLVLRGLANMASGSPDKVRAHGPQLLTA
FT                   MVSGLDDGDEPHSPVALEAMVGLSRLLDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRT
FT                   ASIRLFGHLNKACHGDCEDVFLEQVVGGLVPLLLHLRDPQVPVASACKFALCMCVPHLE
FT                   CAELAAAFYKYLQEGRSVHFGEFLNSTCKHLMHHFPDLLGRLVSTNLFYFKSSWDDVRA
FT                   AAPMFTGFLVLHAEPEQKTQVDLEQLIVALQLLLKDPVPGVREKAAETLGRLVKFA"
FT   CDS             join(26608009..26608030,26609374..26609519,
FT                   26617226..26617357,26617783..26617945,26618133..26618231,
FT                   26623543..26623694,26624039..26624179,26624534..26624626,
FT                   26628553..26628631,26629870..26629983,26636788..26636861,
FT                   26639364..26639483,26642759..26642866,26643162..26643306,
FT                   26643552..26643592,26643894..26644035,26644299..26644351,
FT                   26644803..26644910,26645438..26645557,26645827..26645949,
FT                   26647799..26647945,26648924..26649046,26649188..26649267,
FT                   26649477..26649591,26649713..26649808,26650333..26650437,
FT                   26651420..26651555,26651655..26651767,26652888..26653040,
FT                   26659146..26659300,26662412..26662577,26663065..26663261,
FT                   26665982..26666119,26666535..26666649,26666958..26667104,
FT                   26667243..26667431,26667701..26667856,26667940..26668074,
FT                   26668143..26668245,26668324..26668389,26668722..26668807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, isoform CRA_a"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT135830.1
FT                   protein_id=mCP60447.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA21"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="MGI:MGI:2442558"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA21"
FT                   /protein_id="EDL29564.1"
FT                   /translation="MTRPYIKRLSFTLLDSITDKDPMVQEQVCSALCSLGDAQPDETLH
FT                   ACEEYLRQHDKLAHPYRTKILRAMETVLSSHIHDLDKDTAGAVILLATSEMTRTKELDC
FT                   DWQQAAGSVLVAVGKRFTNQVMEEVLSRFQPGMLPHSSVLHTLANLSVSNAFDMVPFLP
FT                   SILSTMLPMLSMAKQDALKVVFCGALQHFSESILEYLANLDQAPDPTVRKDTFGADIFG
FT                   AYDVLFHHWLQSRDAKLRLAVVAALGPMSHLLPSERLEEQLPKLLPAVLGLYKKHAEAF
FT                   QISKSLGQILEAAVNVSSRTLEVQLDALLVALHAQICVPVESSSPLVMNSQKEVLRCFT
FT                   VLACCSPDRLLAFLLPRLDTSNERLRVGTLQILRHIINSAAAQMEAKQPFILSSMRLPL
FT                   LDTNDKVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPAEEPEKPGPDGEDLAA
FT                   DSVRAVSIRTLYLVSTTVDRMNSVLWPYLLEFLTPVRFTAALTPLCRSLVHLALKRQEA
FT                   GADDFLIQYNANANLPSPFAMTTRLLVVSSNPYLGDGRGAASLRLLKVMHQNIHPFLGQ
FT                   RWETTMPMLLEYLDEHTEESLSLKEWEEKLLMFLRDTLAVVSDNIWICQLSQEMCKQLP
FT                   SYSGTPQEKNFLYKCIGTTLGAASSKEVVRKHLRELLETARYQEEAEQEGLACCFGICA
FT                   ITHLEDTLAQLEDFVRSDVFRKSTGIFSIFKDRSEHEVERMKSCLILCYGHVAAQAPRE
FT                   LVLARVESDILRSMFQCFNTKDPALKLCLVQSLCMVSQAMCSSAQASSFHFLRKTELVT
FT                   QMMEFIRAEPPDCLRTPIRKKAMLACTYLVNLEPALEEQTQADVVHSCLHSVMALPPEA
FT                   EGGDGVGREPLYLDTVCALEDLLTRLLRQNMTPQGLQIMVEHLSPWIKSPRGHERARAL
FT                   GLGACLLEFFQEHLLVSTLVPFHNLGLLVGLFAPRCADTWTTTRQKAVGCVYSLLYLQL
FT                   GYEGFSRDHRDDVAERLLTLQDGLVNADPTILFHTCHSIAQVIAKRLPSDQLISLLLTV
FT                   FESLGDPDKNCSRAATVMINCLLKERGNVLLEKVPEIVSVLRAKLRDTQEEHVLPAAQH
FT                   SVYLLASQHCEAVVSSLLGSPLPFDSHTCALWRALAVEPGLTAQVLELLLEKMSKDVPF
FT                   KESRAFLLGSTADRVATLLPLAATCALYEVLSAPSSGTVVLELYPQLFAALLLRVSCTV
FT                   GVQLPRNLQAKERRSTSPARAARNLDPCSSAVDALQALLLRSGSQDMLRCVELERGWEL
FT                   LKTSAGHEDGVAQLASSMAKYAGPRLPPVTKALACTQNSVYEIQRVTSTAFLAELLSSN
FT                   VVNDLMLLEPLLDNLTARLKDSSASVRRLVLRGLANMASGSPDKVRAHGPQLLTAMVSG
FT                   LDDGDEPHSPVALEAMVGLSRLLDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRTASIR
FT                   LFGHLNKACHGDCEDVFLEQVVGGLVPLLLHLRDPQVPVASACKFALCMCVPHLECAEL
FT                   AAAFYKYLQEGRSVHFGEFLNSTCKHLMHHFPDLLGRLVSTNLFYFKSSWDDVRAAAPM
FT                   FTGFLVLHAEPEQKTQVDLEQLIVALQLLLKDPVPGVREKAAETLGRLVKFA"
FT   gap             26613559..26613704
FT                   /estimated_length=146
FT   gap             26655656..26655911
FT                   /estimated_length=256
FT   CDS             join(<26664780..26664895,26665982..26666119,
FT                   26666535..26666649,26666958..26667104,26667243..26667431,
FT                   26667701..26667856,26667940..26668074,26668143..26668245,
FT                   26668324..26668389,26668722..26668807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134445"
FT                   /product="mCG134445, isoform CRA_c"
FT                   /note="gene_id=mCG134445.2 transcript_id=mCT192618.0
FT                   protein_id=mCP113562.0 isoform=CRA_c"
FT                   /protein_id="EDL29566.1"
FT                   /translation="VGPYLPSHPALPFGSQSFLWDPWRKEPLQLQALAAITSCSAVDAL
FT                   QALLLRSGSQDMLRCVELERGWELLKTSAGHEDGVAQLASSMAKYAGPRLPPVTKALAC
FT                   TQNSVYEIQRVTSTAFLAELLSSNVVNDLMLLEPLLDNLTARLKDSSASVRRLVLRGLA
FT                   NMASGSPDKVRAHGPQLLTAMVSGLDDGDEPHSPVALEAMVGLSRLLDLVEPWDLRLVL
FT                   LHTTIRIRPFFDSEKVEFRTASIRLFGHLNKACHGDCEDVFLEQVVGGLVPLLLHLRDP
FT                   QVPVASACKFALCMCVPHLECAELAAAFYKYLQEGRSVHFGEFLNSTCKHLMHHFPDLL
FT                   GRLVSTNLFYFKSSWDDVRAAAPMFTGFLVLHAEPEQKTQVDLEQLIVALQLLLKDPVP
FT                   GVREKAAETLGRLVKFA"
FT   gene            complement(26668892..26693243)
FT                   /gene="Bop1"
FT                   /locus_tag="mCG_23643"
FT                   /note="gene_id=mCG23643.1"
FT   mRNA            complement(join(26668892..26669274,26669359..26669466,
FT                   26669540..26669624,26669713..26670001,26670074..26670254,
FT                   26670348..26670480,26670569..26670638,26670713..26670793,
FT                   26670865..26671026,26671103..26671315,26671391..26671492,
FT                   26671576..26671693,26671766..26671922,26690721..26690895,
FT                   26693103..26693243))
FT                   /gene="Bop1"
FT                   /locus_tag="mCG_23643"
FT                   /product="block of proliferation 1"
FT                   /note="gene_id=mCG23643.1 transcript_id=mCT23592.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(26669121..26669274,26669359..26669466,
FT                   26669540..26669624,26669713..26670001,26670074..26670254,
FT                   26670348..26670480,26670569..26670638,26670713..26670793,
FT                   26670865..26671026,26671103..26671315,26671391..26671492,
FT                   26671576..26671693,26671766..26671922,26690721..26690895,
FT                   26693103..26693195))
FT                   /codon_start=1
FT                   /gene="Bop1"
FT                   /locus_tag="mCG_23643"
FT                   /product="block of proliferation 1"
FT                   /note="gene_id=mCG23643.1 transcript_id=mCT23592.1
FT                   protein_id=mCP17874.2"
FT                   /protein_id="EDL29567.1"
FT                   /translation="MAGACGKPHMSPASLPGKRRLEPDQELQIQEPPLLSDPDSSLSDS
FT                   EESVFSGLEDSGSDSSEEDTEGVAGSSGDEDNHRAEETSEELAQEDIRNTVGNVPLAWY
FT                   DEFPHVGYDLDGKRIYKPLRTRDELDQFLDKMDDPDFWRTVQDKMTGRDLRLTDEQVAL
FT                   VHRLQRGQFGDSGFNPYEPAVDFFSGDIMIHPVTNRPADKRSFIPSLVEKEKVSRMVHA
FT                   IKMGWIKPRRPHDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYL
FT                   PTEEERSAWMQQEPVERKLNFLPQKFPSLRTVPAYSRFIQERFERCLDLYLCPRQRKMR
FT                   VNVDPEDLIPKLPRPRDLQPFPVCQALVYRGHSDLVRCLSVSPGGQWLASGSDDGTLKL
FT                   WEVATARCMKTVHVGGVVRSIAWNPNPTICLVAAAMDDAVLLLNPALGDRLLVGSTDQL
FT                   LEAFTPPEEPALQPARWLEVSEEEHQRGLRLRICHSKPVTQVTWHGRGDYLAVVLSSQE
FT                   HTQVLLHQVSRRRSQSPFRRSHGQVQCVAFHPSRPFLLVASQRSIRIYHLLRQELTKKL
FT                   MPNCKWVSSMAVHPAGDNIICGSYDSKLVWFDLDLSTKPYKVLRHHKKALRAVAFHPRY
FT                   PLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHTLTRDLGVLDVAFHPTQPWVF
FT                   SSGADGTIRLFS"
FT   gene            26673331..26675352
FT                   /gene="Scx"
FT                   /locus_tag="mCG_23627"
FT                   /note="gene_id=mCG23627.2"
FT   mRNA            join(26673331..26674080,26674976..26675352)
FT                   /gene="Scx"
FT                   /locus_tag="mCG_23627"
FT                   /product="scleraxis"
FT                   /note="gene_id=mCG23627.2 transcript_id=mCT23574.2 created
FT                   on 18-OCT-2002"
FT   CDS             join(26673496..26674080,26674976..26675014)
FT                   /codon_start=1
FT                   /gene="Scx"
FT                   /locus_tag="mCG_23627"
FT                   /product="scleraxis"
FT                   /note="gene_id=mCG23627.2 transcript_id=mCT23574.2
FT                   protein_id=mCP17802.2"
FT                   /db_xref="GOA:Q53ZC3"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:102934"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZC3"
FT                   /protein_id="EDL29568.1"
FT                   /translation="MSFAMLRSAPPPGRYLYPEVSPLSEDEDRGSESSGSDEKPCRVHA
FT                   ARCGLQGARRRAGGRRAAGSGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTL
FT                   IPTEPADRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCHSGPAFFHSGRAGSPLP
FT                   PPPPPPPLARDGGENTQPKQICTFCLSNQRKLSKDRDRKTAIRS"
FT   gap             26677873..26677984
FT                   /estimated_length=112
FT   gap             26680239..26684117
FT                   /estimated_length=3879
FT   gene            <26693394..26717916
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /note="gene_id=mCG23616.2"
FT   mRNA            join(<26693394..26693691,26711973..26712081,
FT                   26712456..26712592,26713771..26713918,26714425..26714694,
FT                   26715951..26716056,26716134..26716199,26716270..26716339,
FT                   26716420..26717916)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant
FT                   mCT192611"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192611.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<26693394..26693691,26711973..26712081,
FT                   26712456..26712592,26713622..26713697,26713771..26713832,
FT                   26713955..26714051,26714157..26714293,26714425..26714694,
FT                   26715951..26716056,26716134..26716339,26716420..26716925)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant
FT                   mCT192612"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192612.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(26693409..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716134..26716199,
FT                   26716270..26716339,26716420..26717157)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant mCT22895"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT22895.2 created
FT                   on 15-NOV-2002"
FT   mRNA            join(26693419..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716270..26716339,
FT                   26716420..26716974)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant
FT                   mCT175825"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT175825.0 created
FT                   on 15-NOV-2002"
FT   mRNA            join(26693419..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716134..26716169,
FT                   26716825..26716901)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant
FT                   mCT175826"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT175826.0 created
FT                   on 15-NOV-2002"
FT   mRNA            join(<26693429..26693691,26711973..26712081,
FT                   26713771..26714051,26714157..26714293,26714425..26714694,
FT                   26715951..26716056,26716270..26716339,26716420..26717158)
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, transcript variant
FT                   mCT192610"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192610.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(26693575..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716134..26716169,
FT                   26716825..26716887)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT175826.0
FT                   protein_id=mCP98748.0 isoform=CRA_b"
FT                   /protein_id="EDL29570.1"
FT                   /translation="MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFH
FT                   VFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCF
FT                   LRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKH
FT                   ENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSV
FT                   PKYGRQYSLEHVHGPGPYSAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPG
FT                   RSIDERPLSSSTLVRVKQEPPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEP
FT                   TPAASNTAPMDTTGAQAPALPTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLT
FT                   SHGFSVDTSALLDLFSPSVTMPDMSLPLPQPQVYSLVTASQPHLD"
FT   CDS             join(26693575..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716134..26716199,
FT                   26716270..26716339,26716420..26716625)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_f"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT22895.2
FT                   protein_id=mCP17797.2 isoform=CRA_f"
FT                   /protein_id="EDL29574.1"
FT                   /translation="MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFH
FT                   VFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCF
FT                   LRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKH
FT                   ENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSV
FT                   PKYGRQYSLEHVHGPGPYSAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPG
FT                   RSIDERPLSSSTLVRVKQEPPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEP
FT                   TPAASNTAPMDTTGAQAPALPTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLT
FT                   SHGFSVDTSALLDLFSPSVTMPDMSLPDLDSSLASIQELLSPQEPPRPIEAENSNPDSG
FT                   KQLVHYTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPH
FT                   KAKDPTVS"
FT   CDS             join(26693575..26693691,26711973..26712081,
FT                   26712456..26712592,26712839..26712963,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716270..26716339,
FT                   26716420..26716625)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT175825.0
FT                   protein_id=mCP98747.0 isoform=CRA_a"
FT                   /protein_id="EDL29569.1"
FT                   /translation="MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFH
FT                   VFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCF
FT                   LRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKH
FT                   ENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSV
FT                   PKYGRQYSLEHVHGPGPYSAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPG
FT                   RSIDERPLSSSTLVRVKQEPPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEP
FT                   TPAASNTAPMDTTGAQAPALPTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLT
FT                   SHGFSVDTSALLDIQELLSPQEPPRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTG
FT                   SSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS"
FT   gap             26697383..26697535
FT                   /estimated_length=153
FT   CDS             join(<26712588..26712592,26713622..26713697,
FT                   26713771..26713832,26713955..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716134..26716313)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_e"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192612.0
FT                   protein_id=mCP113582.0 isoform=CRA_e"
FT                   /protein_id="EDL29573.1"
FT                   /translation="PAENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVK
FT                   RKIPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPYSAPSPAYSSSSLYSSDAVTSSGPII
FT                   SDITELAPTSPLASPGRSIDERPLSSSTLVRVKQEPPSPPHSPRVLEASPGRPSSMDTP
FT                   LSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPALPTPSTPEKCLSVACLDKNELSDH
FT                   LDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTMPDMSLPDLDSSLASVRRRAGWG
FT                   AEGAINNPHCVPCPTDSGASVSTRASQAY"
FT   CDS             join(<26713869..26713918,26714425..26714694,
FT                   26715951..26716056,26716134..26716199,26716270..26716339,
FT                   26716420..26716625)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_d"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192611.0
FT                   protein_id=mCP113581.0 isoform=CRA_d"
FT                   /protein_id="EDL29572.1"
FT                   /translation="PCALVSSACCISWAPPRPLSSSTLVRVKQEPPSPPHSPRVLEASP
FT                   GRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPALPTPSTPEKCLSVAC
FT                   LDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTMPDMSLPDLDSSLA
FT                   SIQELLSPQEPPRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTGSSELPVLFELGE
FT                   SSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS"
FT   CDS             join(<26713929..26714051,26714157..26714293,
FT                   26714425..26714694,26715951..26716056,26716270..26716339,
FT                   26716420..26716625)
FT                   /codon_start=1
FT                   /gene="Hsf1"
FT                   /locus_tag="mCG_23616"
FT                   /product="heat shock factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG23616.2 transcript_id=mCT192610.0
FT                   protein_id=mCP113580.0 isoform=CRA_c"
FT                   /protein_id="EDL29571.1"
FT                   /translation="AVDLSLPCSPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPYSAPSP
FT                   AYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQEPPSP
FT                   PHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPALPTP
FT                   STPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDIQELLSPQEP
FT                   PRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYT
FT                   DDPTISLLTGTEPHKAKDPTVS"
FT   gene            complement(26718055..26727862)
FT                   /gene="Dgat1"
FT                   /locus_tag="mCG_134424"
FT                   /note="gene_id=mCG134424.1"
FT   mRNA            complement(join(26718055..26718391,26718495..26718557,
FT                   26718647..26718734,26718822..26718887,26718962..26719004,
FT                   26719277..26719318,26719393..26719431,26719521..26719624,
FT                   26719709..26719783,26719868..26719975,26720118..26720223,
FT                   26720352..26720404,26720489..26720574,26720669..26720709,
FT                   26722569..26722656,26727527..26727862))
FT                   /gene="Dgat1"
FT                   /locus_tag="mCG_134424"
FT                   /product="diacylglycerol O-acyltransferase 1, transcript
FT                   variant mCT174543"
FT                   /note="gene_id=mCG134424.1 transcript_id=mCT174543.0
FT                   created on 18-OCT-2002"
FT   mRNA            complement(join(26718181..26718391,26718495..26718557,
FT                   26718647..26718734,26718822..26718887,26718962..26719074,
FT                   26719157..26719201,26719277..26719318,26719393..26719431,
FT                   26719521..26719624,26719709..26719783,26719868..26719975,
FT                   26720118..26720223,26720352..26720404,26720489..26720574,
FT                   26720669..26720709,26722569..26722656,26727527..>26727785))
FT                   /gene="Dgat1"
FT                   /locus_tag="mCG_134424"
FT                   /product="diacylglycerol O-acyltransferase 1, transcript
FT                   variant mCT135808"
FT                   /note="gene_id=mCG134424.1 transcript_id=mCT135808.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(26718239..26718391,26718495..26718557,
FT                   26718647..26718734,26718822..26718887,26718962..26719074,
FT                   26719157..26719201,26719277..26719318,26719393..26719431,
FT                   26719521..26719624,26719709..26719783,26719868..26719975,
FT                   26720118..26720223,26720352..26720404,26720489..26720574,
FT                   26720669..26720709,26722569..26722656,26727527..>26727783))
FT                   /codon_start=1
FT                   /gene="Dgat1"
FT                   /locus_tag="mCG_134424"
FT                   /product="diacylglycerol O-acyltransferase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG134424.1 transcript_id=mCT135808.0
FT                   protein_id=mCP60332.0 isoform=CRA_a"
FT                   /protein_id="EDL29575.1"
FT                   /translation="LGRDEVRAEAMGDRGGAGSSRRRRTGSRVSVQGGSGPKVEEDEVR
FT                   DAAVSPDLGAGGDAPAPAPAPAHTRDKDGRTSVGDGYWDLRCHRLQDSLFSSDSGFSNY
FT                   RGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCVIIASNIFV
FT                   VAAFQIEKRLAVGALTEQMGLLLHVVNLATIICFPAAVALLVESITPVGSVFALASYSI
FT                   MFLKLYSYRDVNLWCRQRRVKAKAVSTGKKVSGAAAQQAVSYPDNLTYRDLYYFIFAPT
FT                   LCYELNFPRSPRIRKRFLLRRVLEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRI
FT                   IERLLKLAVPNHLIWLIFFYWFFHSCLNAVAELLQFGDREFYRDWWNAESVTYFWQNWN
FT                   IPVHKWCIRHFYKPMLRHGSSKWVARTGVFLTSAFFHEYLVSVPLRMFRLWAFTAMMAQ
FT                   VPLAWIVGRFFQGNYGNAAVWVTLIIGQPVAVLMYVHDYYVLNYDAPVGV"
FT   CDS             complement(join(26718667..26718734,26718822..26718887,
FT                   26718962..26719004,26719277..26719318,26719393..26719431,
FT                   26719521..26719624,26719709..26719783,26719868..26719975,
FT                   26720118..26720223,26720352..26720404,26720489..26720574,
FT                   26720669..26720709,26722569..26722656,26727527..26727753))
FT                   /codon_start=1
FT                   /gene="Dgat1"
FT                   /locus_tag="mCG_134424"
FT                   /product="diacylglycerol O-acyltransferase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG134424.1 transcript_id=mCT174543.0
FT                   protein_id=mCP97462.0 isoform=CRA_b"
FT                   /protein_id="EDL29576.1"
FT                   /translation="MGDRGGAGSSRRRRTGSRVSVQGGSGPKVEEDEVRDAAVSPDLGA
FT                   GGDAPAPAPAPAHTRDKDGRTSVGDGYWDLRCHRLQDSLFSSDSGFSNYRGILNWCVVM
FT                   LILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCVIIASNIFVVAAFQIEKRL
FT                   AVGALTEQMGLLLHVVNLATIICFPAAVALLVESITPVGSVFALASYSIMFLKLYSYRD
FT                   VNLWCRQRRVKAKAVSTGKKVSGAAAQQAVSYPDNLTYRDLYYFIFAPTLCYELNFPRS
FT                   PRIRKRFLLRRVLEMLFFTQLQVGLIQQWMVPTIQNSMKPFKSFCSLETASSTEIGGML
FT                   SLSPTFGRTGISPCTSGASDTSTSLCSDMAAANGWPGQEYF"
FT   gap             26734100..26734119
FT                   /estimated_length=20
FT   gene            complement(26734300..26737848)
FT                   /gene="Scrt1"
FT                   /locus_tag="mCG_23633"
FT                   /note="gene_id=mCG23633.2"
FT   mRNA            complement(join(26734300..26735624,26737498..26737848))
FT                   /gene="Scrt1"
FT                   /locus_tag="mCG_23633"
FT                   /product="scratch homolog 1, zinc finger protein
FT                   (Drosophila)"
FT                   /note="gene_id=mCG23633.2 transcript_id=mCT23580.1 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(26734693..26735624,26737498..26737612))
FT                   /codon_start=1
FT                   /gene="Scrt1"
FT                   /locus_tag="mCG_23633"
FT                   /product="scratch homolog 1, zinc finger protein
FT                   (Drosophila)"
FT                   /note="gene_id=mCG23633.2 transcript_id=mCT23580.1
FT                   protein_id=mCP17868.0"
FT                   /protein_id="EDL29577.1"
FT                   /translation="MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYV
FT                   GPASVYDGDAEAALLKGPSPEPMYAAAVRGELGPAASGSAPPPTPRPELATAAGGYING
FT                   DAAVSEGYAADAFFITDGRSRRKAANANAAAAPSTASVAAPDSDAGGGGGPGTRGSGSG
FT                   SASRGGTRVGAGTEARAGSGATGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLAR
FT                   RCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHC
FT                   GKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESACFKGGASGPATPAP
FT                   PQLSPVQA"
FT   gap             26735800..26735824
FT                   /estimated_length=25
FT   gap             26737998..26738398
FT                   /estimated_length=401
FT   gene            complement(26751629..>26754656)
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /note="gene_id=mCG23641.2"
FT   mRNA            complement(join(26751629..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..26753695,26753826..26753984,
FT                   26754234..26754644))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT23590"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT23590.0 created
FT                   on 16-AUG-2002"
FT   mRNA            complement(join(26751638..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..>26754656))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT192641"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192641.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26751638..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753329,
FT                   26753632..26753695,26753826..26753969,26754234..26754646))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT172051"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT172051.0 created
FT                   on 16-AUG-2002"
FT   mRNA            complement(join(26751638..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26753329,26753632..26753695,
FT                   26753826..>26754645))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT192639"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192639.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26751638..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753240,26753826..26753984,26754234..>26754632))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT192640"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192640.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26751638..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..26753695,26753826..>26754606))
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6,
FT                   transcript variant mCT192642"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192642.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(26751712..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753240,26753826..26753984,26754234..>26754631))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192640.0
FT                   protein_id=mCP113591.0 isoform=CRA_c"
FT                   /protein_id="EDL29580.1"
FT                   /translation="GAMAPVASRRVRRRVRSSKRPDARGRSAEDWWWDRLAPRGSGYHL
FT                   LQADSMLLVLPDLEPPRARAHRRARRRAPRSLARGPTAVAKPRTKPRPEPSLDQGLDSG
FT                   WGDRIPLEVLVHIFGLLVAAHGPMPFLGRAARVCRHWHEATSHPSLWHTVTLSPSLVGR
FT                   AGKGNLKGEKKLLACLEWLVPNRACCQLHSLDLHHSMVESTAVVSFLEEAGSRMRKLWL
FT                   TYSSQTTAILGALLDNCCPQLQVLQVSTGMNCNNTPLQLPVEALQKGCPQLQVLRLLNL
FT                   IWLPKPCGRGVPQGPGFPSLEELCLAGSTCNFVSNEVLGRLLHRSPKLRMLDLRGCARV
FT                   TPSGLCHLPCQELEQLYLGLYGISDGLTLAKDGSPLLTRKWYHTLRELDFSGQGFSEKD
FT                   LEQALAVFSGTPGGLHPALCSLNLRGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGL
FT                   KRVYRGLEEVQWCLEQLLTSPPSAKEPT"
FT   CDS             complement(join(26751712..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..26753695,26753826..26753984,
FT                   26754234..26754625))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT23590.0
FT                   protein_id=mCP17824.1 isoform=CRA_f"
FT                   /protein_id="EDL29583.1"
FT                   /translation="MAPVASRRVRRRVRSSKRPDARGRSAEDWWWDRLAPRGSGYHLLQ
FT                   ADSMLLVLPDLEPPRARAHRRARRRAPRSLARGPTAVAKPRTKPRPEPSLDQGLDSGWG
FT                   DRIPLEVLVHIFGLLVAAHGPMPFLGRAARVCRHWHEATSHPSLWHTVTLSPSLVGRAG
FT                   KGNLKGEKKLLACLEWLVPNRFSQLQSLTLIHWKSQVHSVLELVSKFCPRLTFLKLSDC
FT                   HTVTAETLVMLARACCQLHSLDLHHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAIL
FT                   GALLDNCCPQLQVLQVSTGMNCNNTPLQLPVEALQKGCPQLQVLRLLNLIWLPKPCGRG
FT                   VPQGPGFPSLEELCLAGSTCNFVSNEVLGRLLHRSPKLRMLDLRGCARVTPSGLCHLPC
FT                   QELEQLYLGLYGISDGLTLAKDGSPLLTRKWYHTLRELDFSGQGFSEKDLEQALAVFSG
FT                   TPGGLHPALCSLNLRGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGLKRVYRGLEEV
FT                   QWCLEQLLTSPPSAKEPT"
FT   CDS             complement(join(26751712..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..26753695,26753826..>26754070))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192642.0
FT                   protein_id=mCP113593.0 isoform=CRA_e"
FT                   /protein_id="EDL29582.1"
FT                   /translation="DRCAAPKTLHCRHYPQKATHSQQTFSSPRAARVCRHWHEATSHPS
FT                   LWHTVTLSPSLVGRAGKGNLKGEKKLLACLEWLVPNRFSQLQSLTLIHWKSQVHSVLEL
FT                   VSKFCPRLTFLKLSDCHTVTAETLVMLARACCQLHSLDLHHSMVESTAVVSFLEEAGSR
FT                   MRKLWLTYSSQTTAILGALLDNCCPQLQVLQVSTGMNCNNTPLQLPVEALQKGCPQLQV
FT                   LRLLNLIWLPKPCGRGVPQGPGFPSLEELCLAGSTCNFVSNEVLGRLLHRSPKLRMLDL
FT                   RGCARVTPSGLCHLPCQELEQLYLGLYGISDGLTLAKDGSPLLTRKWYHTLRELDFSGQ
FT                   GFSEKDLEQALAVFSGTPGGLHPALCSLNLRGTRVTPSTVSSVISGCPGLLYLNLESCR
FT                   CLPRGLKRVYRGLEEVQWCLEQLLTSPPSAKEPT"
FT   CDS             complement(join(26751712..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..26752915,26752999..26753106,
FT                   26753198..26753329,26753632..>26753736))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192641.0
FT                   protein_id=mCP113592.0 isoform=CRA_d"
FT                   /protein_id="EDL29581.1"
FT                   /translation="GQEHNYSRALLSPRFSQLQSLTLIHWKSQVHSVLELVSKFCPRLT
FT                   FLKLSDCHTVTAETLVMLARACCQLHSLDLHHSMVESTAVVSFLEEAGSRMRKLWLTYS
FT                   SQTTAILGALLDNCCPQLQVLQVSTGMNCNNTPLQLPVEALQKGCPQLQVLRLLNLIWL
FT                   PKPCGRGVPQGPGFPSLEELCLAGSTCNFVSNEVLGRLLHRSPKLRMLDLRGCARVTPS
FT                   GLCHLPCQELEQLYLGLYGISDGLTLAKDGSPLLTRKWYHTLRELDFSGQGFSEKDLEQ
FT                   ALAVFSGTPGGLHPALCSLNLRGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGLKRV
FT                   YRGLEEVQWCLEQLLTSPPSAKEPT"
FT   CDS             complement(join(26751712..26751871,26752133..26752379,
FT                   26752482..26752713,26752802..>26753050))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT192639.0
FT                   protein_id=mCP113590.0 isoform=CRA_b"
FT                   /protein_id="EDL29579.1"
FT                   /translation="TVADLQFPDDGHLGRTAGRLGMVRKRAQWGPAQAFDLAVFIPPFQ
FT                   DNCCPQLQVLQVSTGMNCNNTPLQLPVEALQKGCPQLQVLRLLNLIWLPKPCGRGVPQG
FT                   PGFPSLEELCLAGSTCNFVSNEVLGRLLHRSPKLRMLDLRGCARVTPSGLCHLPCQELE
FT                   QLYLGLYGISDGLTLAKDGSPLLTRKWYHTLRELDFSGQGFSEKDLEQALAVFSGTPGG
FT                   LHPALCSLNLRGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGLKRVYRGLEEVQWCL
FT                   EQLLTSPPSAKEPT"
FT   CDS             complement(join(26753162..26753329,26753632..26753695,
FT                   26753826..26753969,26754234..26754625))
FT                   /codon_start=1
FT                   /gene="Fbxl6"
FT                   /locus_tag="mCG_23641"
FT                   /product="F-box and leucine-rich repeat protein 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23641.2 transcript_id=mCT172051.0
FT                   protein_id=mCP94970.0 isoform=CRA_a"
FT                   /protein_id="EDL29578.1"
FT                   /translation="MAPVASRRVRRRVRSSKRPDARGRSAEDWWWDRLAPRGSGYHLLQ
FT                   ADSMLLVLPDLEPPRARAHRRARRRAPRSLARGPTAVAKPRTKPRPEPSLDQGLDSGWG
FT                   DRIPLEVLVHIFGLLVAAHGPMPFLGSRHWHEATSHPSLWHTVTLSPSLVGRAGKGNLK
FT                   GEKKLLACLEWLVPNRFSQLQSLTLIHWKSQVHSVLELVSKFCPRLTFLKLSDCHTVTA
FT                   ETLVMLARACCQLHSLDLHHSMVSPLPWVGGGP"
FT   gene            26754741..26758039
FT                   /gene="Gpr172b"
FT                   /locus_tag="mCG_23635"
FT                   /note="gene_id=mCG23635.2"
FT   mRNA            join(26754741..26755104,26755292..26755511,
FT                   26755603..26756488,26756581..26756704,26756823..26758038)
FT                   /gene="Gpr172b"
FT                   /locus_tag="mCG_23635"
FT                   /product="G protein-coupled receptor 172B, transcript
FT                   variant mCT23582"
FT                   /note="gene_id=mCG23635.2 transcript_id=mCT23582.1 created
FT                   on 18-OCT-2002"
FT   mRNA            join(<26754872..26755104,26755292..26755511,
FT                   26755603..26758039)
FT                   /gene="Gpr172b"
FT                   /locus_tag="mCG_23635"
FT                   /product="G protein-coupled receptor 172B, transcript
FT                   variant mCT192615"
FT                   /note="gene_id=mCG23635.2 transcript_id=mCT192615.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26755301..26755511,26755603..26756528)
FT                   /codon_start=1
FT                   /gene="Gpr172b"
FT                   /locus_tag="mCG_23635"
FT                   /product="G protein-coupled receptor 172B, isoform CRA_a"
FT                   /note="gene_id=mCG23635.2 transcript_id=mCT192615.0
FT                   protein_id=mCP113588.0 isoform=CRA_a"
FT                   /protein_id="EDL29584.1"
FT                   /translation="RSFGSTWEKGGLLPSLCPGGPALTFDLMAAPPLGRLVLTHLLVAL
FT                   FGMGSWAAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRRLARGKGE
FT                   QVPIRVVQGLGIVGTGLLASLWNHVAPVAGKPYSVAFLTLAFVLALACCASNVTFLPFL
FT                   SHLPPPFLRSFFLGQGLSALLPCVLALGQGVGRLECLHVPANRTTGPPIEVSPINFPER
FT                   FSATTFFWVLTALLGTSAAAFQGLLLLLPSPTSEPTTGTGLRVETPGTEEEEEEEEASP
FT                   LQEPPGQVAGIVSSPDPKAHQLFSSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRL
FT                   AYHLAVVLGSCANPLACFLAMAVLCRCSRTPKPPWGRA"
FT   CDS             join(26755382..26755511,26755603..26756488,
FT                   26756581..26756704,26756823..26757035)
FT                   /codon_start=1
FT                   /gene="Gpr172b"
FT                   /locus_tag="mCG_23635"
FT                   /product="G protein-coupled receptor 172B, isoform CRA_b"
FT                   /note="gene_id=mCG23635.2 transcript_id=mCT23582.1
FT                   protein_id=mCP17842.1 isoform=CRA_b"
FT                   /protein_id="EDL29585.1"
FT                   /translation="MAAPPLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGW
FT                   SLPSYLSVLVALGNLGLLLVTLWRRLARGKGEQVPIRVVQGLGIVGTGLLASLWNHVAP
FT                   VAGKPYSVAFLTLAFVLALACCASNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLAL
FT                   GQGVGRLECLHVPANRTTGPPIEVSPINFPERFSATTFFWVLTALLGTSAAAFQGLLLL
FT                   LPSPTSEPTTGTGLRVETPGTEEEEEEEEASPLQEPPGQVAGIVSSPDPKAHQLFSSRS
FT                   ACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVLCRS
FT                   LAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAGVVLVVLSWVLCAGTFSYIKVAIS
FT                   SMLHSGGRPALLAAGVAIQVGSLLGAVAMFPPTSIYRVFRSGKDCVDQCGL"
FT   gap             26762426..26762583
FT                   /estimated_length=158
FT   gap             26775797..26779366
FT                   /estimated_length=3570
FT   gap             26782294..26782313
FT                   /estimated_length=20
FT   gene            26785161..26804665
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /note="gene_id=mCG23632.2"
FT   mRNA            join(26785161..26785349,26796614..26796717,
FT                   26797925..26798074,26802090..26802165,26802287..26802487,
FT                   26802575..26802715,26802794..26802907,26803009..26803140,
FT                   26803220..26803303,26803385..26803466,26803530..26803608,
FT                   26803703..26803794,26803870..26804122,26804193..26804309,
FT                   26804395..26804664)
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, transcript
FT                   variant mCT23579"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT23579.1 created
FT                   on 15-NOV-2002"
FT   mRNA            join(<26785213..26785349,26796614..26796717,
FT                   26797925..26798074,26802090..26802165,26802292..26802487,
FT                   26802575..26802715,26802794..26802907,26803009..26803140,
FT                   26803220..26803303,26803385..26803466,26803530..26803608,
FT                   26803703..26803794,26803870..26804122,26804193..26804309,
FT                   26804395..26804664)
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, transcript
FT                   variant mCT192609"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT192609.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<26785234..26785349,26796614..26796717,
FT                   26797925..26798074,26802090..26802165,26802287..26802487,
FT                   26802575..26802715,26802794..26803303,26803385..26803608,
FT                   26803703..26803794,26803870..26804122,26804193..26804309,
FT                   26804395..26804665)
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, transcript
FT                   variant mCT192608"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT192608.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26785236..26785349,26796614..26796717,
FT                   26797925..26798074,26802090..26802165,26802287..26802487,
FT                   26802575..26802715,26802794..26802967)
FT                   /codon_start=1
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, isoform CRA_a"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT192608.0
FT                   protein_id=mCP113586.0 isoform=CRA_a"
FT                   /protein_id="EDL29586.1"
FT                   /translation="ACGPVRKRIAYSFAGSSGHQGRLRRNREESTAGDMWRPMRLCHFH
FT                   STLLQSRQKPWPCPAIFFRRNFKSPPARTSRARLLWRRALSATVVGTPFLLGAYYFMAE
FT                   ASERRKLRLAVDGIGRFGRSVKIGLFISTDYWWCTNVVLRGVEENSPKYVEIMSACHQR
FT                   AADALVAGAIRNGGLYVKLGQGLCSFNHLLPTEYIQTLRVLEDKALTRGFREVDELFLE
FT                   DFQALPNELFQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFDGDVQTLEL
FT                   LLRLVELMHPSFGFSWVLQVGATHGGQVGGGLAASCKC"
FT   CDS             join(26785338..26785349,26796614..26796717,
FT                   26797925..26798074,26802090..26802165,26802287..26802487,
FT                   26802575..26802715,26802794..26802907,26803009..26803140,
FT                   26803220..26803303,26803385..26803466,26803530..26803608,
FT                   26803703..26803794,26803870..26804122,26804193..26804309,
FT                   26804395..26804506)
FT                   /codon_start=1
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, isoform CRA_c"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT23579.1
FT                   protein_id=mCP17816.2 isoform=CRA_c"
FT                   /protein_id="EDL29588.1"
FT                   /translation="MWRPMRLCHFHSTLLQSRQKPWPCPAIFFRRNFKSPPARTSRARL
FT                   LWRRALSATVVGTPFLLGAYYFMAEASERRKLRLAVDGIGRFGRSVKIGLFISTDYWWC
FT                   TNVVLRGVEENSPKYVEIMSACHQRAADALVAGAIRNGGLYVKLGQGLCSFNHLLPTEY
FT                   IQTLRVLEDKALTRGFREVDELFLEDFQALPNELFQEFDYEPMAAASLAQVHRAKLHDG
FT                   TDVAVKVQYIDLRDRFDGDVQTLELLLRLVELMHPSFGFSWVLQDLKGTLVQELDFENE
FT                   GRNAERCAQELKHFHYVVIPRVHWDRSSKRVLTADFCNGCKVNDMEGIKSQGLAVQDVA
FT                   KKLIQTFAEQIFHTGFIHSDPHPGNVLVRKGPDGKAELVLLDHGLYQFLDEKDRSSLCQ
FT                   LWRAIILRDNAAMKKHAAALGVQDYMLFSEVLMQRPVRLGQLWGSHLISREEAAYMQDM
FT                   AREHFDGIMEVLKALPRPMLLVLRNINTVRAINSNLGTPVDRYFLMAKSAVWGWSRLVG
FT                   AAYQGIYGSSLLRHIKVLWEALKFEMALRLEILAMRLTALMLRVLVRLGFAPKAEAEEV
FT                   YQYLEM"
FT   gap             26794706..26794867
FT                   /estimated_length=162
FT   CDS             join(<26802098..26802165,26802292..26802487,
FT                   26802575..26802715,26802794..26802907,26803009..26803140,
FT                   26803220..26803303,26803385..26803466,26803530..26803608,
FT                   26803703..26803794,26803870..26804122,26804193..26804309,
FT                   26804395..26804506)
FT                   /codon_start=1
FT                   /gene="Adck5"
FT                   /locus_tag="mCG_23632"
FT                   /product="aarF domain containing kinase 5, isoform CRA_b"
FT                   /note="gene_id=mCG23632.2 transcript_id=mCT192609.0
FT                   protein_id=mCP113587.0 isoform=CRA_b"
FT                   /protein_id="EDL29587.1"
FT                   /translation="RLVCSSPRTTGGAQTLSFEEWKSPKYVEIMSACHQRAADALVAGA
FT                   IRNGGLYVKLGQGLCSFNHLLPTEYIQTLRVLEDKALTRGFREVDELFLEDFQALPNEL
FT                   FQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFDGDVQTLELLLRLVELMH
FT                   PSFGFSWVLQDLKGTLVQELDFENEGRNAERCAQELKHFHYVVIPRVHWDRSSKRVLTA
FT                   DFCNGCKVNDMEGIKSQGLAVQDVAKKLIQTFAEQIFHTGFIHSDPHPGNVLVRKGPDG
FT                   KAELVLLDHGLYQFLDEKDRSSLCQLWRAIILRDNAAMKKHAAALGVQDYMLFSEVLMQ
FT                   RPVRLGQLWGSHLISREEAAYMQDMAREHFDGIMEVLKALPRPMLLVLRNINTVRAINS
FT                   NLGTPVDRYFLMAKSAVWGWSRLVGAAYQGIYGSSLLRHIKVLWEALKFEMALRLEILA
FT                   MRLTALMLRVLVRLGFAPKAEAEEVYQYLEM"
FT   gene            complement(26804665..26816689)
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /note="gene_id=mCG23630.2"
FT   mRNA            complement(join(26804665..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810032,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812497,26812576..26812603,
FT                   26816413..26816689))
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   transcript variant mCT23577"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT23577.2 created
FT                   on 15-NOV-2002"
FT   mRNA            complement(join(26804665..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810038,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812497,26812576..26812603,
FT                   26816413..>26816638))
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   transcript variant mCT192606"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT192606.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26804665..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810038,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812421,26812576..26812603,
FT                   26816413..>26816567))
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   transcript variant mCT192607"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT192607.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(26804741..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810038,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812497,26812576..26812603,
FT                   26816413..>26816637))
FT                   /codon_start=1
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT192606.0
FT                   protein_id=mCP113584.0 isoform=CRA_a"
FT                   /protein_id="EDL29589.1"
FT                   /translation="GWRARPDRVRCRPCPPSRRLRRDSGGDMYAVYKQAHPPTGLEFTM
FT                   YCNFFNNSERNLVVAGTSQLYVYRLNRDAEALTKNDGSTEGKAHREKLELVASFSFFGN
FT                   VMSMASVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSLHYFEEPELRDGFVQNV
FT                   HTPRVRVDPDGRCAAMLIYGTRLVVLPFRRESLAEEHEGLMGEGQRSSFLPSYIIDVRA
FT                   LDEKLLNIIDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSIVAISLNITQKVHPV
FT                   IWSLTSLPFDCTQALAVPKPIGGVVIFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLR
FT                   TQEGVRITLDCAQAAFISYDKMVISLKGGEIYVLTLITDGMRSVRAFHFDKAAASVLTT
FT                   SMVTMEPGYLFLGSRLGNSLLLKYTEKLQEPPASSVREAADKEEPPSKKKRVEPAVGWT
FT                   GGKTVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSMLNIGPCANAAVGEPAFLSEEFQ
FT                   NSPEPDLEIVVCSGYGKNGALSVLQKSIRPQVVTTFELPGCYDMWTVIAPVRKEEEETP
FT                   KAESTEQEPSAPKAEEDGRRHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVFAG
FT                   NIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCAVADPYVVIMSAEGHVTMFL
FT                   LKSDSYGGRHHRLALHKPPLHHQSKVIALCLYRDVSGMFTTESRLGGARDELGGRSGSE
FT                   AEGLGSETSPTVDDEEEMLYGDSSALFSPSKEEARRSSQPPADRDPAPFKADPTHWCLL
FT                   VRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEVRKEEATRQGELPLV
FT                   KEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKK
FT                   PKPSKKKAEGCSTEEGSGGRGRVARFRYFEDIYGYSGVFICGPSPHWLLVTGRGALRLH
FT                   PMGIDGPIDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRCTAH
FT                   YVAYHVESKVYAVATSTNTPCTRIPRMTGEEKEFEAIERDDRYIHPQQEAFSIQLISPV
FT                   SWEAIPNARIELEEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEEVTCRGRIFL
FT                   WSLRASELTGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAK
FT                   PLEVYSVDFMVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRADFHVGAHVNT
FT                   FWRTPCRGAAEGPSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTM
FT                   LPHHAGLNPRAFRMLHVDRRILQNAVRNVLDGELLNRYLYLSTMERSELAKKIGTTPDI
FT                   ILDDLLETDRVTAHF"
FT   CDS             complement(join(26804741..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810032,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812497,26812576..26812603,
FT                   26816413..26816556))
FT                   /codon_start=1
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT23577.2
FT                   protein_id=mCP17875.2 isoform=CRA_c"
FT                   /protein_id="EDL29591.1"
FT                   /translation="MYAVYKQAHPPTGLEFTMYCNFFNNSERNLVVAGTSQLYVYRLNR
FT                   DAEALTKNDGSTEGKAHREKLELVASFSFFGNVMSMASVQLAGAKRDALLLSFKDAKLS
FT                   VVEYDPGTHDLKTLSLHYFEEPELRDGFVQNVHTPRVRVDPDGRCAAMLIYGTRLVVLP
FT                   FRRESLAEEHEGLMGEGQRSSFLPSYIIDVRALDEKLLNIIDLQFLHGYYEPTLLILFE
FT                   PNQTWPGRVAVRQDTCSIVAISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVIF
FT                   AVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRTQEGVRITLDCAQAAFISYDKMVISLK
FT                   GGEIYVLTLITDGMRSVRAFHFDKAAASVLTTSMVTMEPGYLFLGSRLGNSLLLKYTEK
FT                   LQEPPASSVREAADKEEPPSKKKRVEPAVGWTGGKTVPQDEVDEIEVYGSEAQSGTQLA
FT                   TYSFEVCDSMLNIGPCANAAVGEPAFLSEENSPEPDLEIVVCSGYGKNGALSVLQKSIR
FT                   PQVVTTFELPGCYDMWTVIAPVRKEEEETPKAESTEQEPSAPKAEEDGRRHGFLILSRE
FT                   DSTMILQTGQEIMELDTSGFATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIP
FT                   VDLGAPIVQCAVADPYVVIMSAEGHVTMFLLKSDSYGGRHHRLALHKPPLHHQSKVIAL
FT                   CLYRDVSGMFTTESRLGGARDELGGRSGSEAEGLGSETSPTVDDEEEMLYGDSSALFSP
FT                   SKEEARRSSQPPADRDPAPFKADPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQR
FT                   VLVDSSFGQPTTQGEVRKEEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYE
FT                   AFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGCSTEEGSGGRGRVARFRYF
FT                   EDIYGYSGVFICGPSPHWLLVTGRGALRLHPMGIDGPIDSFAPFHNVNCPRGFLYFNRQ
FT                   GELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVYAVATSTNTPCTRIPRMTG
FT                   EEKEFEAIERDDRYIHPQQEAFSIQLISPVSWEAIPNARIELEEWEHVTCMKTVSLRSE
FT                   ETVSGLKGYVAAGTCLMQGEEVTCRGRIFLWSLRASELTGMAFIDTQLYIHQMISVKNF
FT                   ILAADVMKSISLLRYQEESKTLSLVSRDAKPLEVYSVDFMVDNAQLGFLVSDRDRNLMV
FT                   YMYLPEAKESFGGMRLLRRADFHVGAHVNTFWRTPCRGAAEGPSKKSVVWENKHITWFA
FT                   TLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPHHAGLNPRAFRMLHVDRRILQNAVRNV
FT                   LDGELLNRYLYLSTMERSELAKKIGTTPDIILDDLLETDRVTAHF"
FT   CDS             complement(join(26804741..26804788,26804865..26805003,
FT                   26805076..26805205,26805272..26805427,26805507..26805554,
FT                   26805633..26805699,26805773..26805949,26806283..26806424,
FT                   26806498..26806582,26806662..26806752,26806828..26806944,
FT                   26807655..26807807,26807886..26808029,26808120..26808209,
FT                   26808308..26808514,26808592..26808766,26808842..26808978,
FT                   26809065..26809243,26809320..26809461,26809534..26809644,
FT                   26809790..26809879,26809958..26810038,26810115..26810189,
FT                   26810256..26810350,26810426..26810477,26810579..26810701,
FT                   26810774..26810861,26810980..26811073,26811173..26811283,
FT                   26811361..26811500,26811643..26811789,26811886..26812037,
FT                   26812154..26812234,26812364..26812421,26812576..>26812586))
FT                   /codon_start=1
FT                   /gene="Cpsf1"
FT                   /locus_tag="mCG_23630"
FT                   /product="cleavage and polyadenylation specific factor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23630.2 transcript_id=mCT192607.0
FT                   protein_id=mCP113585.0 isoform=CRA_b"
FT                   /protein_id="EDL29590.1"
FT                   /translation="WEHSVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSLHYFE
FT                   EPELRDGFVQNVHTPRVRVDPDGRCAAMLIYGTRLVVLPFRRESLAEEHEGLMGEGQRS
FT                   SFLPSYIIDVRALDEKLLNIIDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSIVA
FT                   ISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVIFAVNSLLYLNQSVPPYGVALN
FT                   SLTTGTTAFPLRTQEGVRITLDCAQAAFISYDKMVISLKGGEIYVLTLITDGMRSVRAF
FT                   HFDKAAASVLTTSMVTMEPGYLFLGSRLGNSLLLKYTEKLQEPPASSVREAADKEEPPS
FT                   KKKRVEPAVGWTGGKTVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSMLNIGPCANAA
FT                   VGEPAFLSEEFQNSPEPDLEIVVCSGYGKNGALSVLQKSIRPQVVTTFELPGCYDMWTV
FT                   IAPVRKEEEETPKAESTEQEPSAPKAEEDGRRHGFLILSREDSTMILQTGQEIMELDTS
FT                   GFATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCAVADPYVV
FT                   IMSAEGHVTMFLLKSDSYGGRHHRLALHKPPLHHQSKVIALCLYRDVSGMFTTESRLGG
FT                   ARDELGGRSGSEAEGLGSETSPTVDDEEEMLYGDSSALFSPSKEEARRSSQPPADRDPA
FT                   PFKADPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEVRK
FT                   EEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFK
FT                   KVPHNINFREKKPKPSKKKAEGCSTEEGSGGRGRVARFRYFEDIYGYSGVFICGPSPHW
FT                   LLVTGRGALRLHPMGIDGPIDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPW
FT                   PVRKIPLRCTAHYVAYHVESKVYAVATSTNTPCTRIPRMTGEEKEFEAIERDDRYIHPQ
FT                   QEAFSIQLISPVSWEAIPNARIELEEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQ
FT                   GEEVTCRGRIFLWSLRASELTGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEE
FT                   SKTLSLVSRDAKPLEVYSVDFMVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLR
FT                   RADFHVGAHVNTFWRTPCRGAAEGPSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYR
FT                   RLLMLQNALTTMLPHHAGLNPRAFRMLHVDRRILQNAVRNVLDGELLNRYLYLSTMERS
FT                   ELAKKIGTTPDIILDDLLETDRVTAHF"
FT   gap             26806092..26806250
FT                   /estimated_length=159
FT   gene            complement(26821462..26826325)
FT                   /gene="Slc39a4"
FT                   /locus_tag="mCG_23621"
FT                   /note="gene_id=mCG23621.1"
FT   mRNA            complement(join(26821462..26821741,26821833..26822020,
FT                   26822282..26822434,26822535..26822589,26822676..26822795,
FT                   26822865..26823023,26823135..26823307,26823565..26823736,
FT                   26823828..26823991,26824122..26824317,26824953..26825237,
FT                   26825651..26826325))
FT                   /gene="Slc39a4"
FT                   /locus_tag="mCG_23621"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 4, transcript variant mCT23568"
FT                   /note="gene_id=mCG23621.1 transcript_id=mCT23568.2 created
FT                   on 18-OCT-2002"
FT   mRNA            complement(join(26821463..26821741,26821833..26822020,
FT                   26822282..26822434,26822535..26822589,26822676..26822795,
FT                   26822865..26823023,26823135..26823307,26823565..26823736,
FT                   26823828..26823991,26824953..26825237,26825651..26825970))
FT                   /gene="Slc39a4"
FT                   /locus_tag="mCG_23621"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 4, transcript variant mCT174562"
FT                   /note="gene_id=mCG23621.1 transcript_id=mCT174562.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(26821613..26821741,26821833..26822020,
FT                   26822282..26822434,26822535..26822589,26822676..26822795,
FT                   26822865..26823023,26823135..26823307,26823565..26823736,
FT                   26823828..26823991,26824122..26824317,26824953..26825237,
FT                   26825651..26825839))
FT                   /codon_start=1
FT                   /gene="Slc39a4"
FT                   /locus_tag="mCG_23621"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 4, isoform CRA_b"
FT                   /note="gene_id=mCG23621.1 transcript_id=mCT23568.2
FT                   protein_id=mCP17879.1 isoform=CRA_b"
FT                   /protein_id="EDL29593.1"
FT                   /translation="MLPKSVTQGLVLALLVGTVAVARPRNLLSLLALGQGALDRLELDG
FT                   LLNTLVARVHCTDGPCEKCLSVENVLALGKPDKPQPAPESVLESRHIIYLSAAAALYLN
FT                   NPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLSQLLQKIEAHAASQPTGEKTCVDL
FT                   PQLLEEAEAAGVSKSAGLVLTALLDHVINGSCFQGLPSPQYFVDFVFRLHSSDPPNITL
FT                   HELENLMHHLGVGGEDHSDHDDHGDHADHSHPDRKASHQDSELHTPHNSNSSVWDTLCL
FT                   SAKDIMAVYGLSEEAGVSPQAWAQLTPALVQQQLSGACSPYPTIRIQDQLSQTERYLYG
FT                   SLATLLICLCAVFGLLLLTCAKCSTATHYIMQTFLSLAVGALTGDALLHLIPKVLGLHT
FT                   HGGEGHTHEEEVGVGGQATWRLLAVLGGFYIFFLFESFFNLLLPRDQDSEKDGPCSHGG
FT                   HSHGISLQLAPSNLRQSKQTHESSRSDLVAEETPELLNPETRRLRAELRLLPYLITLGD
FT                   AVHNFADGLAVGAAFSSSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVKRALLLNL
FT                   ASALTAFAGLYVALAVGVGEEGEAWILAVATGLFLYVALCDMLPAMMNVRDQRPWLLFL
FT                   LHNVGLLGGWTVLLLLSLYEDNITF"
FT   CDS             complement(join(26823977..26823991,26824953..26825237,
FT                   26825651..26825839))
FT                   /codon_start=1
FT                   /gene="Slc39a4"
FT                   /locus_tag="mCG_23621"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 4, isoform CRA_a"
FT                   /note="gene_id=mCG23621.1 transcript_id=mCT174562.0
FT                   protein_id=mCP97481.0 isoform=CRA_a"
FT                   /protein_id="EDL29592.1"
FT                   /translation="MLPKSVTQGLVLALLVGTVAVARPRNLLSLLALGQGALDRLELDG
FT                   LLNTLVARVHCTDGPCEKCLSVENVLALGKPDKPQPAPESVLESRHIIYLSAAAALYLN
FT                   NPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLSQLLQKIEAHAASQPTGEKNWRI"
FT   gene            complement(26831155..26835138)
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /note="gene_id=mCG23640.2"
FT   mRNA            complement(join(26831155..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833245,26833518..26833555,26833662..26833788,
FT                   26834204..26834275,26835059..26835138))
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), transcript
FT                   variant mCT171953"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT171953.0 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(26831158..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833245,26833518..26833555,26833662..26833690,
FT                   26834204..26834275,26835059..26835138))
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), transcript
FT                   variant mCT23587"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT23587.2 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(26831164..26831420,26831541..26832342,
FT                   26832459..26833245,26833518..26833555,26833662..26833788,
FT                   26834204..26834275,26835059..>26835126))
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), transcript
FT                   variant mCT192638"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT192638.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26831164..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833245,26833518..26833551,26833658..26833690,
FT                   26834204..26834275,26835059..26835095))
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), transcript
FT                   variant mCT180751"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT180751.0 created
FT                   on 24-FEB-2003"
FT   CDS             complement(join(26831303..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833245,26833518..26833555,26833662..26833690,
FT                   26834204..26834240))
FT                   /codon_start=1
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT23587.2
FT                   protein_id=mCP17807.2 isoform=CRA_c"
FT                   /protein_id="EDL29596.1"
FT                   /translation="MFHGIPATPGVGAPGNKPELYEEVKLYKNAREREKYDNMAELFAV
FT                   VKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCP
FT                   LAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMET
FT                   MHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA"
FT   CDS             complement(join(26831303..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833245,26833518..26833551,26833658..26833690,
FT                   26834204..26834240))
FT                   /codon_start=1
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT180751.0
FT                   protein_id=mCP103673.0 isoform=CRA_d"
FT                   /protein_id="EDL29597.1"
FT                   /translation="MFHGIPATPGVGAPGNKPELYEVVKLYKNAREREKYDNMAELFAV
FT                   VKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCP
FT                   LAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMET
FT                   MHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA"
FT   CDS             complement(join(26831303..26831420,26831541..26831632,
FT                   26831725..26831778,26832241..26832342,26832459..26832564,
FT                   26833156..26833235))
FT                   /codon_start=1
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT171953.0
FT                   protein_id=mCP94872.0 isoform=CRA_a"
FT                   /protein_id="EDL29594.1"
FT                   /translation="MAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQ
FT                   VQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDK
FT                   LRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQV
FT                   RQMLFDLESAYNAFNRFLHA"
FT   CDS             complement(join(26832139..26832342,26832459..>26832614))
FT                   /codon_start=1
FT                   /gene="Vps28"
FT                   /locus_tag="mCG_23640"
FT                   /product="vacuolar protein sorting 28 (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23640.2 transcript_id=mCT192638.0
FT                   protein_id=mCP113589.0 isoform=CRA_b"
FT                   /protein_id="EDL29595.1"
FT                   /translation="GKLDCPQPPEATGPLSRYTAACSRLLVQYKAAFRQVQGSEISSID
FT                   EFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSVCPTAPGRVLWGLEGRDY
FT                   WPRSVINVYSWGFWS"
FT   gene            complement(26835306..26849004)
FT                   /gene="Nfkbil2"
FT                   /locus_tag="mCG_134454"
FT                   /note="gene_id=mCG134454.0"
FT   mRNA            complement(join(26835306..26835552,26837819..26837952,
FT                   26838327..26838400,26838736..26838911,26839547..26839718,
FT                   26839901..26840202,26840864..26840942,26841031..26841181,
FT                   26841677..26841753,26841843..26842573,26842656..26842779,
FT                   26842861..26843024,26843115..26843187,26843635..26843724,
FT                   26843839..26843921,26845186..26845375,26845632..26845757,
FT                   26846011..26846163,26846250..26846395,26846922..26847036,
FT                   26847112..26847283,26847542..26847671,26847910..26848093,
FT                   26848518..26848660,26848748..26848843,26848924..26849004))
FT                   /gene="Nfkbil2"
FT                   /locus_tag="mCG_134454"
FT                   /product="nuclear factor of kappa light polypeptide gene
FT                   enhancer in B-cells inhibitor-like 2"
FT                   /note="gene_id=mCG134454.0 transcript_id=mCT135839.1
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(26835371..26835552,26837819..26837952,
FT                   26838327..26838400,26838736..26838911,26839547..26839718,
FT                   26839901..26840202,26840864..26840942,26841031..26841181,
FT                   26841677..26841753,26841843..26842573,26842656..26842779,
FT                   26842861..26843024,26843115..26843187,26843635..26843724,
FT                   26843839..26843921,26845186..26845375,26845632..26845757,
FT                   26846011..26846163,26846250..26846395,26846922..26847036,
FT                   26847112..26847283,26847542..26847671,26847910..26848093,
FT                   26848518..26848660,26848748..26848843,26848924..26848948))
FT                   /codon_start=1
FT                   /gene="Nfkbil2"
FT                   /locus_tag="mCG_134454"
FT                   /product="nuclear factor of kappa light polypeptide gene
FT                   enhancer in B-cells inhibitor-like 2"
FT                   /note="gene_id=mCG134454.0 transcript_id=mCT135839.1
FT                   protein_id=mCP60719.1"
FT                   /db_xref="GOA:G3UW83"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1919999"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW83"
FT                   /protein_id="EDL29598.1"
FT                   /translation="MTLEQELRQLSKAKTRAQRNGQLREEAAYCHQLGELLASHGRFKD
FT                   ALEEHQQELHLLESVQDTLGCAVAHRKIGERLAEMENYSAALKHQHLYLDLAGSLSNHT
FT                   ELQRAWATIGRTHLDIYDHCQSRDSLLQAQAAFEKSLAIVDEKLEGMLTQRELSEMRTR
FT                   LYLNLGLTCESLQQTALCNNYFKKSIFLAEQNHLYEDLFRARYNLGAIHWRGGQHSQAM
FT                   RCLEGARECARAMKMRFMESECCVLVSQVLQDLGDFLAAKRALKKAYRLGSQKPNQRVT
FT                   VCQSLKYVLAVIQLQQQLEEAEGNDLQGAMAICEQLGDLFSKAGDFPKAAEAYQKQLHL
FT                   AELLNRPDLELAVIHVSLATTLGDMKDHRKAVHHYEEELRLRKGNALEEAKTWFNIALS
FT                   REEAGDAYELLAPCFQKAFCCAQQAQRFQLQRQILQHLYTVQLKLQPQEARDTEIRLQE
FT                   LSMAKDTEEEEEEEEEEEEEASEAPETSELELSESEDDADGLSQQLEEDEELQGCVGRR
FT                   KVNKWNRRNDMGETLLHRACIEGQLRRVQDLVKQGHPLNPRDYCGWTPLHEACNYGHLE
FT                   IVRFLLDHGAAVDDPGGQGCDGITPLHDALNCGHFEVAELLIERGASVTLRTRKGLSPL
FT                   ETLQQWVKLYFRDLDLETRQKAATMEKRLQMASSGQASRSSPALQTIPSNHLFDPETSP
FT                   PSSPCPEPSSYTPRPPEASPAPAKVFLEETVSAVSRPRKTRHRPTSSSSSSEDEDNPSP
FT                   CRPSQKRLRHTTQQGEVKIPDPPKSRETATSSACRAAYQAAIRGVGSAQSRRLVPSLPR
FT                   GSEEVPAPKTALIPEEEYLAGEWLEVDTPLTRSGRPSTSVSDYERCPARPRTRVKQSRL
FT                   TSLDGWCARTQAGDGSLNAEPAENPSVPRTSGPNKENYAAGQPLLLVQPPPIRVRVQIQ
FT                   DNLFLIPVPQSDIRPVAWLTEQAAQRYFQTCGLLPRLTLRKDGALLAPQDPIPDVLQSN
FT                   DEVLAEVTSWDLPPLKDRYRRACLSLGQGEHQQVLHAMDHQSSSPSFSACSLALCQAQL
FT                   TPLLRALKLHTALRELRLAGNRLGDACATELLATLGTTPNLVLLDLSSNHLGQEGLRQL
FT                   VEGSSGQAALQNLEELDLSMNPLGDGCGQALASLLRACPMLSTLRLQACGFSSSFFLSH
FT                   QAALGGAFQDAVHLKTLSLSYNLLGAPALARVLQTLPACTLKRLDLSSVAASKSNSGII
FT                   EPVIKYLTKEGCALAHLTLSANCLGDKAVRELSRCLPCCPSLTSLDLSANPEVSCASLE
FT                   ELLSALQERSQGLSFLGLSGCSIQGPLNSDLWDKIFVQLQELQLCTKDLSTKDRDSVCQ
FT                   RLPEGACTMDQSSKLFFKCL"
FT   gene            complement(26854838..26869136)
FT                   /gene="Cyhr1"
FT                   /locus_tag="mCG_23639"
FT                   /note="gene_id=mCG23639.1"
FT   mRNA            complement(join(26854838..26855644,26857169..26857380,
FT                   26858011..26858249,26868294..26868514,26869030..26869136))
FT                   /gene="Cyhr1"
FT                   /locus_tag="mCG_23639"
FT                   /product="cysteine and histidine rich 1"
FT                   /note="gene_id=mCG23639.1 transcript_id=mCT23586.1 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(26855253..26855644,26857169..26857380,
FT                   26858011..26858249,26868294..26868386))
FT                   /codon_start=1
FT                   /gene="Cyhr1"
FT                   /locus_tag="mCG_23639"
FT                   /product="cysteine and histidine rich 1"
FT                   /note="gene_id=mCG23639.1 transcript_id=mCT23586.1
FT                   protein_id=mCP17794.1"
FT                   /protein_id="EDL29599.1"
FT                   /translation="MVSKPRTEWSTVLSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIH
FT                   LLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
FT                   KEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEM
FT                   QLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSER
FT                   NPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYV
FT                   PLPIIDSVECNKLLAAKNINLRLFLFQIQK"
FT   gap             26865913..26865932
FT                   /estimated_length=20
FT   gene            26869640..26877269
FT                   /gene="Kifc2"
FT                   /locus_tag="mCG_23628"
FT                   /note="gene_id=mCG23628.2"
FT   mRNA            join(26869640..26869840,26870081..26870162,
FT                   26870311..26870459,26870555..26870693,26870802..26870947,
FT                   26871021..26871086,26871176..26871304,26871670..26871747,
FT                   26871857..26871971,26872049..26872158,26873146..26873254,
FT                   26873357..26873520,26875104..26875208,26875304..26875425,
FT                   26875522..26875645,26875738..26875867,26875950..26876206,
FT                   26876279..26877269)
FT                   /gene="Kifc2"
FT                   /locus_tag="mCG_23628"
FT                   /product="kinesin family member C2"
FT                   /note="gene_id=mCG23628.2 transcript_id=mCT23575.2 created
FT                   on 16-AUG-2002"
FT   CDS             join(26869742..26869840,26870081..26870162,
FT                   26870311..26870459,26870555..26870693,26870802..26870947,
FT                   26871021..26871086,26871176..26871304,26871670..26871747,
FT                   26871857..26871971,26872049..26872158,26873146..26873254,
FT                   26873357..26873520,26875104..26875208,26875304..26875425,
FT                   26875522..26875645,26875738..26875867,26875950..26876206,
FT                   26876279..26876533)
FT                   /codon_start=1
FT                   /gene="Kifc2"
FT                   /locus_tag="mCG_23628"
FT                   /product="kinesin family member C2"
FT                   /note="gene_id=mCG23628.2 transcript_id=mCT23575.2
FT                   protein_id=mCP17908.2"
FT                   /db_xref="GOA:G3X8Q6"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:109187"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q6"
FT                   /protein_id="EDL29600.1"
FT                   /translation="MYAFYSLLIYIFYSLFRRDGGAAAVSDPGDPTQKSGGQPRGRRRP
FT                   DQFTSELWSELNSLAGCSESEDGQKGAEGGAAEVSLEEALMRLAEFLSVQLGAEESCGT
FT                   TPDLGKPGEVPPLLTVTSQLLALLAWTRSPRGRQALLQGTQPTCPVQPSTLDGSLSQEE
FT                   SSSQPTPILDEVPRDETQEHQPLQLEEEQRVWQRLEQLILGQLEELRQQLEQQEEELSR
FT                   LRLGVGVTDSEKRVQHLTLENEALKQSLSLTRDLLLHWGPGPLPRLSQEEAGALLELQG
FT                   QLQEAQDTTEALRVQLGAQELQLQGLQGALRQLQQETEQNCRQELQQVHGQLAGLRARM
FT                   ASLRQGCGDLRGLVSTFTQSCQGSLSEAQGQVSWALGALSAGKAKTQLSEGNQAPPTGC
FT                   SGRLLELKGNIRVLCRLRPAEGQPSSLVSVEPGQGGTITTCYRGRQHRFRLDWVFPQDA
FT                   SQEEVFRQLEPAVLSCLQGYSVCIFTYGQTGTGKTYSMEGPPEDPGIAPRALQLLFREM
FT                   GTGGHHHVTLSMVEIYNEAVRDLLATGPPERLVVRQGPAGQGGIQVAGLTHWDVPNLET
FT                   LHQMLSLGRSNRATAATVMNQHSSRSHALVTLTLRAASPPRAQGITGTLHLVDLAGSER
FT                   VWKAGVASPVQRDPNGARRLREAQAINRSLLALGGVMAALRARRPHVPFRDSQLTRLLQ
FT                   PALCAGTTAVLLLQISTRAEDLGETICSLKFAERVGQVELGPARRRRAPRSGTPSSLST
FT                   DTPLTGTSCTPTPSPGSPPSTSPNSCSGLTLEPPGDPPP"
FT   gene            complement(<26877382..26878950)
FT                   /gene="Foxh1"
FT                   /locus_tag="mCG_23626"
FT                   /note="gene_id=mCG23626.0"
FT   mRNA            complement(join(<26877382..26878215,26878304..26878408,
FT                   26878680..26878950))
FT                   /gene="Foxh1"
FT                   /locus_tag="mCG_23626"
FT                   /product="forkhead box H1"
FT                   /note="gene_id=mCG23626.0 transcript_id=mCT23573.0 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(26877382..26878215,26878304..26878408,
FT                   26878680..26878946))
FT                   /codon_start=1
FT                   /gene="Foxh1"
FT                   /locus_tag="mCG_23626"
FT                   /product="forkhead box H1"
FT                   /note="gene_id=mCG23626.0 transcript_id=mCT23573.0
FT                   protein_id=mCP17905.1"
FT                   /db_xref="GOA:Q0VEP8"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1347465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEP8"
FT                   /protein_id="EDL29601.1"
FT                   /translation="MASGWDLASTYTPTTPSPQLALAPAQGYLPCMGPRDNSQLRPPEA
FT                   ESLSKTPKRRKKRYLRHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDD
FT                   YEGWKDSIRHNLSSNRCFHKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQ
FT                   NRGTHRAFAKDLSPYVLHGQPYQPPSPPPPPREGFSIKSLLGDPGKESTWPQHPGLPGQ
FT                   STAAQAGTLSKGEEGMGTGPSSSSETPLWPLCSLPGPTIIEGESSQGEVIRPSPVTPDQ
FT                   GSWPLHLLEDSADSRGVPRRGSRASLWGQLPTSYLPIYTPNVVMPLATLPTTSCPQCPS
FT                   SASPAYWSVGTESQGSQDLLCDLDSLFQGVPPNKSIYDVWVSHPRDLAAPAPGWLLSWY
FT                   SM"
FT   gene            26880799..26903990
FT                   /gene="Ppp1r16a"
FT                   /locus_tag="mCG_23619"
FT                   /note="gene_id=mCG23619.1"
FT   mRNA            join(26880799..26880837,26899245..26900225,
FT                   26900770..26900840,26900928..26901073,26901910..26902013,
FT                   26902087..26902211,26902300..26902425,26902512..26902587,
FT                   26902668..26902797,26902941..26903103,26903371..26903990)
FT                   /gene="Ppp1r16a"
FT                   /locus_tag="mCG_23619"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16A"
FT                   /note="gene_id=mCG23619.1 transcript_id=mCT23567.2 created
FT                   on 18-OCT-2002"
FT   CDS             join(26899967..26900225,26900770..26900840,
FT                   26900928..26901073,26901910..26902013,26902087..26902211,
FT                   26902300..26902425,26902512..26902587,26902668..26902797,
FT                   26902941..26903103,26903371..26903745)
FT                   /codon_start=1
FT                   /gene="Ppp1r16a"
FT                   /locus_tag="mCG_23619"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16A"
FT                   /note="gene_id=mCG23619.1 transcript_id=mCT23567.2
FT                   protein_id=mCP17856.1"
FT                   /protein_id="EDL29602.1"
FT                   /translation="MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAH
FT                   SKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDG
FT                   LTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADL
FT                   LAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAG
FT                   ANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLV
FT                   ELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHKQDALLRAQGRQRSLLRRRTS
FT                   SAGSRGKVVRRVSLTHRTNLYRKEHAQEAIVWQQPPPTSPEPLEDEDRQTDAELRLQPP
FT                   EDDGPEVARPHNGQVGAPPGRHLYSKRLDRSVSYHLSPEENSAPDALVRDKAHHTLAEL
FT                   KRQRAAAKLQRPAPEGPETFEPGLSVDAGTSQPDCGFSTIGDPPLLKLTAPSEEASVEK
FT                   RPCCLLM"
FT   gene            26905600..26908758
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /note="gene_id=mCG23646.1"
FT   mRNA            join(26905600..26906092,26906232..26906321,
FT                   26906395..26906503,26906615..26906748,26906913..26907156,
FT                   26907376..26907455,26907529..26907665,26907788..26907962,
FT                   26908069..26908224,26908309..26908421,26908493..26908758)
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble,
FT                   transcript variant mCT23595"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT23595.2 created
FT                   on 26-FEB-2003"
FT   mRNA            join(<26905803..26906092,26906232..26908747)
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble,
FT                   transcript variant mCT192649"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT192649.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(26905828..26906092,26906232..26906321,
FT                   26906395..26906481,26906913..26907156,26907376..26907455,
FT                   26907529..26907665,26907788..26907962,26908069..26908224,
FT                   26908309..26908421,26908493..26908758)
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble,
FT                   transcript variant mCT174565"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT174565.0 created
FT                   on 26-FEB-2003"
FT   CDS             join(26905931..26906092,26906232..26906321,
FT                   26906395..26906503,26906615..26906748,26906913..26907156,
FT                   26907376..26907455,26907529..26907665,26907788..26907962,
FT                   26908069..26908224,26908309..26908421,26908493..26908583)
FT                   /codon_start=1
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT23595.2
FT                   protein_id=mCP17781.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q566C3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:95802"
FT                   /db_xref="UniProtKB/TrEMBL:Q566C3"
FT                   /protein_id="EDL29605.1"
FT                   /translation="MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRA
FT                   LELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDA
FT                   KRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDA
FT                   IVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELR
FT                   RALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYA
FT                   EGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQM
FT                   AKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNE
FT                   APGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFG
FT                   QQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEYS"
FT   CDS             join(26905931..26906092,26906232..26906321,
FT                   26906395..26906481,26906913..26907156,26907376..26907455,
FT                   26907529..26907665,26907788..26907962,26908069..26908224,
FT                   26908309..26908421,26908493..26908583)
FT                   /codon_start=1
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT174565.0
FT                   protein_id=mCP97484.0 isoform=CRA_a"
FT                   /protein_id="EDL29603.1"
FT                   /translation="MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRA
FT                   LELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDA
FT                   KRRAERILQTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWA
FT                   LDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEV
FT                   YQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMD
FT                   AEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKL
FT                   TEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICV
FT                   VPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEYS"
FT   CDS             <26906676..26907554
FT                   /codon_start=1
FT                   /gene="Gpt1"
FT                   /locus_tag="mCG_23646"
FT                   /product="glutamic pyruvic transaminase 1, soluble, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23646.1 transcript_id=mCT192649.0
FT                   protein_id=mCP113609.0 isoform=CRA_b"
FT                   /protein_id="EDL29604.1"
FT                   /translation="EERRRHPCRPEQHISVHRGQRCHRGRVAQGRAGQIGVALCVRLDG
FT                   AESGAAASAQGGGGGGVGCTTLVALTLGSLSGLQTMLKLLVAGEGRARTGVLIPIPQYP
FT                   LYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGKP
FT                   ISSAPCSFTLFTPPPPLAPPHWAPPSSPASSSRTCPCSPTPSAWAEHSWAWFSVARGRL
FT                   TFQSVMHLHTPGQVQTRECIEAVIRFAFEEGLFLMADEVHTGAHRVVSSSSAPSLNDTA
FT                   TPTGIPRQCIC"
FT   gene            26910537..26912645
FT                   /gene="Mfsd3"
FT                   /locus_tag="mCG_23614"
FT                   /note="gene_id=mCG23614.1"
FT   mRNA            join(26910537..26911423,26911717..26911864,
FT                   26911952..26912076,26912147..26912256,26912336..26912645)
FT                   /gene="Mfsd3"
FT                   /locus_tag="mCG_23614"
FT                   /product="major facilitator superfamily domain containing
FT                   3"
FT                   /note="gene_id=mCG23614.1 transcript_id=mCT22891.2 created
FT                   on 11-NOV-2002"
FT   CDS             join(26910742..26911423,26911717..26911864,
FT                   26911952..26912076,26912147..26912256,26912336..26912509)
FT                   /codon_start=1
FT                   /gene="Mfsd3"
FT                   /locus_tag="mCG_23614"
FT                   /product="major facilitator superfamily domain containing
FT                   3"
FT                   /note="gene_id=mCG23614.1 transcript_id=mCT22891.2
FT                   protein_id=mCP17837.1"
FT                   /protein_id="EDL29606.1"
FT                   /translation="MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKG
FT                   LYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGL
FT                   LLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSW
FT                   PLLFLLLAATYWLAAALAWAAPALGRLPWPQASEHTPHSSYLLQDLLAVPGTLWTAGFV
FT                   LTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARHWQPLK
FT                   LLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATF
FT                   TVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADSLGPHLCFAVFLVLSAL
FT                   PVLDLRLAPSNLT"
FT   gene            complement(26912633..>26919622)
FT                   /gene="Recql4"
FT                   /locus_tag="mCG_23650"
FT                   /note="gene_id=mCG23650.2"
FT   mRNA            complement(join(26912633..26912938,26913027..26913135,
FT                   26913316..26913469,26913549..26913729,26913807..26913976,
FT                   26914060..26914516,26914667..26914929,26915019..26915160,
FT                   26915232..26915411,26915490..26915678,26915756..26915839,
FT                   26916110..26916246,26916325..26916417,26917198..26917299,
FT                   26917400..26917507,26917608..26917734,26917875..26918024,
FT                   26918414..26918624,26918841..26918981,26919174..26919271,
FT                   26919351..26919384,26919466..>26919622))
FT                   /gene="Recql4"
FT                   /locus_tag="mCG_23650"
FT                   /product="RecQ protein-like 4, transcript variant
FT                   mCT192614"
FT                   /note="gene_id=mCG23650.2 transcript_id=mCT192614.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(26912633..26912938,26913027..26913135,
FT                   26913316..26913469,26913549..26913729,26913807..26913976,
FT                   26914060..26914189,26914264..26914516,26914667..26914929,
FT                   26915019..26915160,26915232..26915411,26915490..26915678,
FT                   26915756..26915839,26916110..26916246,26916325..26916417,
FT                   26917198..26917296,26917400..26917507,26917608..26917734,
FT                   26917875..26918624,26918841..26918981,26919174..26919271,
FT                   26919351..26919384,26919466..26919587))
FT                   /gene="Recql4"
FT                   /locus_tag="mCG_23650"
FT                   /product="RecQ protein-like 4, transcript variant mCT23597"
FT                   /note="gene_id=mCG23650.2 transcript_id=mCT23597.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(26912814..26912938,26913027..26913135,
FT                   26913316..26913469,26913549..26913729,26913807..26913976,
FT                   26914060..26914189,26914264..26914516,26914667..26914929,
FT                   26915019..26915160,26915232..26915411,26915490..26915678,
FT                   26915756..26915839,26916110..26916246,26916325..26916417,
FT                   26917198..26917296,26917400..26917507,26917608..26917734,
FT                   26917875..26918624,26918841..26918981,26919174..26919271,
FT                   26919351..26919384,26919466..26919549))
FT                   /codon_start=1
FT                   /gene="Recql4"
FT                   /locus_tag="mCG_23650"
FT                   /product="RecQ protein-like 4, isoform CRA_b"
FT                   /note="gene_id=mCG23650.2 transcript_id=mCT23597.2
FT                   protein_id=mCP17795.2 isoform=CRA_b"
FT                   /protein_id="EDL29608.1"
FT                   /translation="MERLATVRARLQEWERAFARLHGRRPAKGDVEAAPEETRALYREY
FT                   RNLKQAVRQADDRHRVLEQSLAEAAEEAQEPSCWGPHLSRAATQNTQSMPKQSLLSSVQ
FT                   DYGKRLKANLKNTTQTGPTQSRKLQLQKRSLSTVPAPRPPGSKTESPCPDEADDALPRV
FT                   PEPRPRLGQLQQLRSSLSRRLTSLDPGWLERCHNRVSDLLEVPGACGLDLSAEESQPQM
FT                   SGKVNIADPDIQSEVSVQSPEAIAQQPAQVLSQSPKSINSKGRKRKWNEKGEDFAQDQP
FT                   SSGAGPLSEGARATVHGQDPPGEPTQVNVPQPCNSSNQARTEKAKGTTHLHASPRPASL
FT                   DRGNYIRLNMKNKRFVRVGANRGRLLRKQVWKQKWKKKQAAFGGSGPRATDKDTCFRCG
FT                   QFGHWASQCSQPGPTLTVQEEGDRDDKQPISTLEEVAQRTGTASCHHSGEETQPAAPEL
FT                   QVPHCPTPMSPLYPPGPLGQVAETPAEVFQALERLGYRAFRPGQERAIMRILSGISTLL
FT                   VLPTGAGKSLCYQLPALLYAQRSPCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTK
FT                   KQRESVLKKVRAAQVHVLIVSPEALVGCGARGPGSLPQAAQLPPIAFACIDEVHCLSQW
FT                   SHNFRPCYLRVCKVLREHMGVRCFLGLTATATRSTARDVAQHLGIAGEFELSGSANIPA
FT                   NLHLSVSMDRDSDQALVTLLQGDRFRTLDSVIIYCTRRKDTERVAALLRTCLSMVGDSR
FT                   PRGCGPEAIAEAYHAGMSSQERRRVQQAFMRGHLRMVVATVAFGMGLDRPDVRAVLHLG
FT                   LPPSFESYVQAIGRAGRDGKPAHCHLFMHPQGEDLWELRRHAHADSTDFLAVKRLVQRV
FT                   FPPCTCSQRPVSKSSPEEVKEHSGQQTYPVLGQACLGHERALPVQSTVQALDMTEEAIE
FT                   TLLCYLELHPRHWLELLPWTYAQCHLHCLGGSAQLQALAHRCPPLAACQAKWPPKDTSQ
FT                   GRSSLEFGVVELADSMGWKLASVRQALHQLKWDPEPKKGAAQGTGVLVKFSELAFHLHS
FT                   RGDLTDEEKDQICDFLYNRVQAREHKALAHLHQMSKAFRSVAFPSCGPCLEQSNEEHSN
FT                   QVKTLVSYYFEEEEEEEETMTDTQGPKPGQTQLQDWEDQIRRDVRQLLSLRPEERFSGR
FT                   AVARIFHGIASPCYPAQVYGLDRRFWRKYLHLDFHALMHLATEELLLRGR"
FT   CDS             complement(join(26914208..26914516,26914667..26914929,
FT                   26915019..26915160,26915232..26915411,26915490..26915678,
FT                   26915756..26915839,26916110..26916246,26916325..26916417,
FT                   26917198..26917299,26917400..26917507,26917608..26917734,
FT                   26917875..26918024,26918414..>26918419))
FT                   /codon_start=1
FT                   /gene="Recql4"
FT                   /locus_tag="mCG_23650"
FT                   /product="RecQ protein-like 4, isoform CRA_a"
FT                   /note="gene_id=mCG23650.2 transcript_id=mCT192614.0
FT                   protein_id=mCP113594.0 isoform=CRA_a"
FT                   /protein_id="EDL29607.1"
FT                   /translation="TLARTEKAKGTTHLHASPRPASLDRGNYIRLNMKNKRFVRVGANR
FT                   GRLLRKQVWKQKWKKKQAAFGGSGPRATDKDTCFRCGQFGHWASQCSQPGPTLTVQEEG
FT                   DRDDKQPISTLEEVAQRTGTASCHHSAGEETQPAAPELQVPHCPTPMSPLYPPGPLGQV
FT                   AETPAEVFQALERLGYRAFRPGQERAIMRILSGISTLLVLPTGAGKSLCYQLPALLYAQ
FT                   RSPCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVHVLIVS
FT                   PEALVGCGARGPGSLPQAAQLPPIAFACIDEVHCLSQWSHNFRPCYLRVCKVLREHMGV
FT                   RCFLGLTATATRSTARDVAQHLGIAGEFELSGSANIPANLHLSVSMDRDSDQALVTLLQ
FT                   GDRFRTLDSVIIYCTRRKDTERVAALLRTCLSMVGDSRPRGCGPEAIAEAYHAGMSSQE
FT                   RRRVQQAFMRGHLRMVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAIGRAGRDGKP
FT                   AHCHLFMHPQGEDLWELRRHAHADSTDFLAVKRLVQRVFPPCTCSQRPVSKSSPEEVKE
FT                   HSGQQTYPVLGQACLGHERALPVQSTVQALDMTEEGKEPSRIWVTGRGWCHLS"
FT   gene            26919713..26926251
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /note="gene_id=mCG23618.2"
FT   mRNA            join(26919713..26919909,26920037..26920156,
FT                   26920495..26920603,26921940..26922293,26922474..26923058,
FT                   26923153..26926251)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT22896"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT22896.3 created
FT                   on 17-JUN-2003"
FT   mRNA            join(26919714..26919909,26921940..26922293,
FT                   26922474..26923058,26923153..26926251)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT175829"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175829.1 created
FT                   on 17-JUN-2003"
FT   mRNA            join(26919734..26920000,26921940..26922293,
FT                   26922889..26923058,26923153..26926251)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT175827"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175827.1 created
FT                   on 17-JUN-2003"
FT   mRNA            join(26919734..26920000,26920495..26920603,
FT                   26921940..>26922246)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT175828"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175828.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(<26919745..26920000,26921940..26923058,
FT                   26923153..26925721)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT192613"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT192613.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(26919747..26919806,26923361..26924241)
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, transcript
FT                   variant mCT175830"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175830.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(26919777..26919806,26923361..26923720)
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_d"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175830.1
FT                   protein_id=mCP98752.1 isoform=CRA_d"
FT                   /protein_id="EDL29612.1"
FT                   /translation="MSGGRGAGIRCQLADAQLLATLPTLTRCASLRYLGLYGNPLSMAG
FT                   LKELLRDSVVQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLL
FT                   LASGRAHVLWTTDIYGRLAADYFSL"
FT   CDS             join(26921965..26922293,26922474..26923058,
FT                   26923153..26923720)
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_c"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175829.1
FT                   protein_id=mCP98750.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q8VC16"
FT                   /db_xref="InterPro:IPR026292"
FT                   /db_xref="MGI:MGI:2445060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC16"
FT                   /protein_id="EDL29611.1"
FT                   /translation="MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTL
FT                   VLRELVHTWPFPLLSFQQLLQECAHCSRALLQERLSTESMQAVILGLTARIHTQETEAG
FT                   TQPLCRKHALRVLDMTGLLDDGVEQDPETMSMWDCTAAVARTCIAQQQGGTAEPGLSPV
FT                   PVEIRVDLRVNRASYTFLREALQSSVASPLRLCCRDLRAEDLPMRNTVALLQLLDAGCL
FT                   RRIDLRFNNLGLRGLSVIIPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMG
FT                   RFMCLRELSMGSSLLSGRLDQLLSTLQRPLESLELAFCALLPEDLRFLAQSSHAAHLKK
FT                   LDLSGNDLSGNQLTPFQGLLQAVATTLLHLELTECQLADAQLLATLPTLTRCASLRYLG
FT                   LYGNPLSMAGLKELLRDSVVQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFA
FT                   RVEAELHQLLLASGRAHVLWTTDIYGRLAADYFSL"
FT   CDS             join(26921965..26922293,26922474..26923058,
FT                   26923153..26923720)
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_c"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT22896.3
FT                   protein_id=mCP17827.3 isoform=CRA_c"
FT                   /db_xref="GOA:Q8VC16"
FT                   /db_xref="InterPro:IPR026292"
FT                   /db_xref="MGI:MGI:2445060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC16"
FT                   /protein_id="EDL29614.1"
FT                   /translation="MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTL
FT                   VLRELVHTWPFPLLSFQQLLQECAHCSRALLQERLSTESMQAVILGLTARIHTQETEAG
FT                   TQPLCRKHALRVLDMTGLLDDGVEQDPETMSMWDCTAAVARTCIAQQQGGTAEPGLSPV
FT                   PVEIRVDLRVNRASYTFLREALQSSVASPLRLCCRDLRAEDLPMRNTVALLQLLDAGCL
FT                   RRIDLRFNNLGLRGLSVIIPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMG
FT                   RFMCLRELSMGSSLLSGRLDQLLSTLQRPLESLELAFCALLPEDLRFLAQSSHAAHLKK
FT                   LDLSGNDLSGNQLTPFQGLLQAVATTLLHLELTECQLADAQLLATLPTLTRCASLRYLG
FT                   LYGNPLSMAGLKELLRDSVVQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFA
FT                   RVEAELHQLLLASGRAHVLWTTDIYGRLAADYFSL"
FT   CDS             26921965..>26922246
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_b"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175828.0
FT                   protein_id=mCP98749.1 isoform=CRA_b"
FT                   /protein_id="EDL29610.1"
FT                   /translation="MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTL
FT                   VLRELVHTWPFPLLSFQQLLQECAHCSRALLQERLSTESMQAVILGLTA"
FT   CDS             join(<26922415..26923058,26923153..26923720)
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_e"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT192613.0
FT                   protein_id=mCP113583.0 isoform=CRA_e"
FT                   /protein_id="EDL29613.1"
FT                   /translation="LGGMLAFLLHSLPLPIPAPRKHALRVLDMTGLLDDGVEQDPETMS
FT                   MWDCTAAVARTCIAQQQGGTAEPGLSPVPVEIRVDLRVNRASYTFLREALQSSVASPLR
FT                   LCCRDLRAEDLPMRNTVALLQLLDAGCLRRIDLRFNNLGLRGLSVIIPHVARFQHLASL
FT                   RLHYVHGDSRQPSVDGEDNFRYFLAQMGRFMCLRELSMGSSLLSGRLDQLLSTLQRPLE
FT                   SLELAFCALLPEDLRFLAQSSHAAHLKKLDLSGNDLSGNQLTPFQGLLQAVATTLLHLE
FT                   LTECQLADAQLLATLPTLTRCASLRYLGLYGNPLSMAGLKELLRDSVVQAELRTVVHPF
FT                   PVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTTDIYGRLAAD
FT                   YFSL"
FT   CDS             join(26922982..26923058,26923153..26923720)
FT                   /codon_start=1
FT                   /gene="Lrrc14"
FT                   /locus_tag="mCG_23618"
FT                   /product="leucine rich repeat containing 14, isoform CRA_a"
FT                   /note="gene_id=mCG23618.2 transcript_id=mCT175827.1
FT                   protein_id=mCP98751.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BXE4"
FT                   /db_xref="InterPro:IPR026292"
FT                   /db_xref="MGI:MGI:2445060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BXE4"
FT                   /protein_id="EDL29609.1"
FT                   /translation="MGRFMCLRELSMGSSLLSGRLDQLLSTLQRPLESLELAFCALLPE
FT                   DLRFLAQSSHAAHLKKLDLSGNDLSGNQLTPFQGLLQAVATTLLHLELTECQLADAQLL
FT                   ATLPTLTRCASLRYLGLYGNPLSMAGLKELLRDSVVQAELRTVVHPFPVDCYEGLPWPP
FT                   PASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTTDIYGRLAADYFSL"
FT   gene            complement(26924351..>26932914)
FT                   /locus_tag="mCG_134440"
FT                   /note="gene_id=mCG134440.0"
FT   mRNA            complement(join(26924351..26925379,26926996..26927164,
FT                   26927295..26927573,26927725..26927972,26928869..26928997,
FT                   26931199..26932056,26932244..26932292,26932728..>26932914))
FT                   /locus_tag="mCG_134440"
FT                   /product="mCG134440"
FT                   /note="gene_id=mCG134440.0 transcript_id=mCT135825.1
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(26924445..26925379,26926996..26927164,
FT                   26927295..26927573,26927725..26927972,26928869..>26928935))
FT                   /codon_start=1
FT                   /locus_tag="mCG_134440"
FT                   /product="mCG134440"
FT                   /note="gene_id=mCG134440.0 transcript_id=mCT135825.1
FT                   protein_id=mCP60397.1"
FT                   /protein_id="EDL29615.1"
FT                   /translation="WDCRASDEQEALSIGTGRGLGQGGASYPGPFPGEATASWWGSSEM
FT                   ALRAPTLLLLLLGLLLLPLLPGLPPRATGCPAACRCYSATVECGALRLRVVPPGIPPGT
FT                   QTLFLQDNSIAHLEQGSLAPLAALRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLR
FT                   GLRGGAFVGLVQLRVLYLAGNQLAKLLDFTFLHLPRLQELHLQENSIELLEDQALAGLS
FT                   SLALLDLSRNQLGTISKEALQPLSSLQVLRLTENPWRCDCALHWLGSWIKEGGRRLLSS
FT                   RDKKITCAEPPRLALQSLLEVSGGSLICIPPSVNVEPPEFTANLGEDLQVACQASGYPQ
FT                   PLVVWRKVPQPRDGKPQAQAQLEGGAPGLGGHGTRDTGSGMLFLTNITLAHAGKYECEA
FT                   ANAGGKARVPFHLLVNASRQQSQQLPDPQAPATRPVGHEPQHEAGSMAFRALGLATQTA
FT                   ITAAIALLALTALLLAAMICRRRRRRKKVPAPSGEGTLFVNDYSDGPCTFAQLEELRDD
FT                   HGHEMFVIDRSKPLFPEVLPEEAPEHNPPDGLKSGLRLPTRVAYEIHC"
FT   gene            complement(26932926..>27028539)
FT                   /gene="D15Wsu169e"
FT                   /locus_tag="mCG_134448"
FT                   /note="gene_id=mCG134448.2"
FT   mRNA            complement(join(26932926..26933994,26934052..26934249,
FT                   26934396..26934565,26934996..26935087,26935702..26935901,
FT                   26936476..26936549,26939436..26939528,26943955..26944516,
FT                   26945534..26946887,26950591..26950674,26961894..26962313,
FT                   26975860..26976026,26976315..26976487,27028187..27028360))
FT                   /gene="D15Wsu169e"
FT                   /locus_tag="mCG_134448"
FT                   /product="DNA segment, Chr 15, Wayne State University 169,
FT                   expressed, transcript variant mCT135833"
FT                   /note="gene_id=mCG134448.2 transcript_id=mCT135833.1
FT                   created on 15-NOV-2002"
FT   mRNA            complement(join(26933058..26934249,26934396..26934565,
FT                   26934996..26935087,26935702..26935901,26936476..26936549,
FT                   26943955..26944516,26945534..26946887,26950591..26950674,
FT                   26961894..26962313,26975860..26976026,27028380..>27028539))
FT                   /gene="D15Wsu169e"
FT                   /locus_tag="mCG_134448"
FT                   /product="DNA segment, Chr 15, Wayne State University 169,
FT                   expressed, transcript variant mCT192624"
FT                   /note="gene_id=mCG134448.2 transcript_id=mCT192624.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(26934055..26934249,26934396..26934565,
FT                   26934996..26935087,26935702..26935901,26936476..26936549,
FT                   26943955..26944516,26945534..26946887,26950591..26950674,
FT                   26961894..26962313,26975860..>26975975))
FT                   /codon_start=1
FT                   /gene="D15Wsu169e"
FT                   /locus_tag="mCG_134448"
FT                   /product="DNA segment, Chr 15, Wayne State University 169,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG134448.2 transcript_id=mCT192624.0
FT                   protein_id=mCP113563.0 isoform=CRA_b"
FT                   /protein_id="EDL29617.1"
FT                   /translation="QLFTSALRKQMAMSQAQDYECRSHHVDEQEPRIPGSSTRLEWVEI
FT                   IEPRTRERMYANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVW
FT                   HRPQNCDIIPLAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQELPVR
FT                   SGRATTLVTSKEDTSSCSPPGVLLEKDYEVYRDYSADGQLLHYRTSSLRWNSGNKERML
FT                   IKVADREPSFLTPQGNGYPADNQPGGHHRRPSGSQHSPNLQTFVPDTDGTVFFPERRPS
FT                   PFLRRAELSGNCSPLLIQPRKPSSDSQPSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDV
FT                   QFEANSPYQTGSPQRSPGRKPHPFLQTTKQTPTSPCQQLMRTKQKCPERFLSLEYSPVG
FT                   KEYVRQLVYVEQAGSSPKLRAGPRHKYAPNPGGGTYSLQPSPCLLRDQRLGVRSGDYST
FT                   MEGPESRPSQPPTPLPQAQEDAMSWSSQQDTMSSTGYSPGTRKRKNRKPSLCQVPSTSS
FT                   TDGAGGLLGEQPLTEERSPCRASLTPVKAEADLVRGTPEPFLAQARLAWEAQQAHFHMK
FT                   QRGSWDSQQDGSGYESDGAVPLPMPGPVVRAFSEDEALAQQDSKHWKRSTFDKLGFPQI
FT                   LLEKSVSVQTNLASPEPHLHPSQSEDLGACAQFESSRQNRSAMPSSSCVFPTFTLRKPS
FT                   SETDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFK
FT                   LIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWEL
FT                   MAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKGVAISTYAKYCYHKLQKAALTGAKKG
FT                   LKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGD
FT                   QTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYE
FT                   QCIAHYESPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAP
FT                   NCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL"
FT   CDS             complement(join(26934055..26934249,26934396..26934565,
FT                   26934996..26935087,26935702..26935901,26936476..26936549,
FT                   26939436..26939528,26943955..26944516,26945534..26946887,
FT                   26950591..26950674,26961894..26962313,26975860..26975945))
FT                   /codon_start=1
FT                   /gene="D15Wsu169e"
FT                   /locus_tag="mCG_134448"
FT                   /product="DNA segment, Chr 15, Wayne State University 169,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG134448.2 transcript_id=mCT135833.1
FT                   protein_id=mCP60694.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X932"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:107858"
FT                   /db_xref="UniProtKB/TrEMBL:G3X932"
FT                   /protein_id="EDL29616.1"
FT                   /translation="MAMSQAQDYECRSHHVDEQEPRIPGSSTRLEWVEIIEPRTRERMY
FT                   ANLVTGECVWDPPAGVRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIP
FT                   LAKLQTLKQNTESPRASADNSPGRGSRDGSTGSSLEPELEERTQELPVRSGRATTLVTS
FT                   KEDTSSCSPPGVLLEKDYEVYRDYSADGQLLHYRTSSLRWNSGNKERMLIKVADREPSF
FT                   LTPQGNGYPADNQPGGHHRRPSGSQHSPNLQTFVPDTDGTVFFPERRPSPFLRRAELSG
FT                   NCSPLLIQPRKPSSDSQPSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEANSPYQT
FT                   GSPQRSPGRKPHPFLQTTKQTPTSPCQQLMRTKQKCPERFLSLEYSPVGKEYVRQLVYV
FT                   EQAGSSPKLRAGPRHKYAPNPGGGTYSLQPSPCLLRDQRLGVRSGDYSTMEGPESRPSQ
FT                   PPTPLPQAQEDAMSWSSQQDTMSSTGYSPGTRKRKNRKPSLCQVPSTSSTDGAGGLLGE
FT                   QPLTEERSPCRASLTPVKAEADLVRGTPEPFLAQARLAWEAQQAHFHMKQRGSWDSQQD
FT                   GSGYESDGAVPLPMPGPVVRAFSEDEALAQQDSKHWKRSTFDKLGFPQILLEKSVSVQT
FT                   NLASPEPHLHPSQSEDLGACAQFESSRQNRSAMPSSSCVFPTFTLRKPSSETDIENWAS
FT                   KHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRR
FT                   AKADPLHVALEIATKGWSAQGLRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPP
FT                   TPKFHSYLEGYIYRHMDPVNDTKVTQHIKELLERNSKKKSKLRKKPKPYVEEPDGVAIS
FT                   TYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMSMQKERYP
FT                   DRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPA
FT                   SLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAVVHALPRINRMVLCYLIRFLQVFV
FT                   QPANVAITKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFMEG
FT                   VL"
FT   gene            complement(26947439..26981379)
FT                   /locus_tag="mCG_1051065"
FT                   /note="gene_id=mCG1051065.0"
FT   mRNA            complement(join(26947439..26947481,26951791..26951808,
FT                   26979377..26981379))
FT                   /locus_tag="mCG_1051065"
FT                   /product="mCG1051065"
FT                   /note="gene_id=mCG1051065.0 transcript_id=mCT194854.0
FT                   created on 27-JAN-2005"
FT   gap             26958458..26959434
FT                   /estimated_length=977
FT   CDS             complement(26980386..26980565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051065"
FT                   /product="mCG1051065"
FT                   /note="gene_id=mCG1051065.0 transcript_id=mCT194854.0
FT                   protein_id=mCP115883.0"
FT                   /protein_id="EDL29618.1"
FT                   /translation="MLNTCKNYLLTICISGAPMSGGSQPSVTPSPLSSCTHNVQIHMRA
FT                   LSLALSLSSIPHTI"
FT   gap             27042967..27042986
FT                   /estimated_length=20
FT   gene            complement(27061716..27128397)
FT                   /locus_tag="mCG_131131"
FT                   /note="gene_id=mCG131131.1"
FT   mRNA            complement(join(27061716..27065040,27121636..27122695,
FT                   27128128..27128397))
FT                   /locus_tag="mCG_131131"
FT                   /product="mCG131131"
FT                   /note="gene_id=mCG131131.1 transcript_id=mCT132460.1
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(27065034..27065040,27121636..27122695,
FT                   27128128..27128302))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131131"
FT                   /product="mCG131131"
FT                   /note="gene_id=mCG131131.1 transcript_id=mCT132460.1
FT                   protein_id=mCP60524.1"
FT                   /protein_id="EDL29619.1"
FT                   /translation="MYCPSNGRLLKMLSFQAKVTFEDVAVLLSQEEWARLGPAQRGLYR
FT                   HVMMETYGNVVSLVLTFSSCASECKAKEENQNTDLNVPPLISDEASATLTETPLRKVAE
FT                   ERYKTEPKVCPSPKPIGPQNAHGLNPSVPVARPQTAPSVERPYICIECGKCFGRSSHLL
FT                   QHQRIHTGEKPYVCHVCGKAFSQSSVLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHH
FT                   KIHTGEKPHECLECGKAFTQLSHLIQHQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVH
FT                   TGEKPHGCSECGKTFSVKRTLLQHQRVHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGE
FT                   KPYECSECGKTFSHRSTLMNHERIHTQEKPYACYECGKAFVQHSHLIQHQRVHTGEKPY
FT                   VCGECGHAFSARRF"
FT   gap             27068483..27068502
FT                   /estimated_length=20
FT   gene            27089627..27102722
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /note="gene_id=mCG142392.0"
FT   mRNA            join(27089627..27089722,27091108..27091151,
FT                   27091481..27091607,27098561..27098677,27100337..27102722)
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, transcript variant
FT                   mCT180374"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT180374.0
FT                   created on 10-FEB-2003"
FT   mRNA            join(27089716..27089966,27091108..27091151,
FT                   27091481..27091607,27098564..27099061)
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, transcript variant
FT                   mCT180375"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT180375.0
FT                   created on 10-FEB-2003"
FT   mRNA            join(<27091108..27091151,27091484..27091607,
FT                   27098561..27102722)
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, transcript variant
FT                   mCT192619"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT192619.0
FT                   created on 09-MAR-2004"
FT   CDS             join(27091149..27091151,27091481..27091607,
FT                   27098561..27098677,27100337..27102147)
FT                   /codon_start=1
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, isoform CRA_a"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT180374.0
FT                   protein_id=mCP103297.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TFZ4"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:99208"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TFZ4"
FT                   /protein_id="EDL29620.1"
FT                   /translation="MEAVTFGDVAVHFSREEWQCLDSGQRALYKEVMLENHSSVAGLAG
FT                   FLVFKPELISRLEQGQEPWVLDLQGAEGTEAPRICQTDSAIRTDRKQTCEYTSLLQRQI
FT                   PGFGDNLDSKVWSENCPRSLGLSVSGSLFQKHRLNSEAVMPKNSTKDAVQERKELQATD
FT                   VGYRPDDQRDHLSSKLIRRQSVPTGENRYPCEECGKAFRWRSRLNQHKLSHTGEKSYQC
FT                   NKCTKVFASSSRLIRHQRAHTGEKPFKCDQCGKRFVLASVLTQHQRIHTGERPFKCAEC
FT                   GKGFHLSAKLVQHQRIHTGEKPYRCEECGKTFGQSSSLVHHQRIHTGERPFICQECGKA
FT                   FCQRSQLSRHRRTHTGERPYSCQECGKAFCQRATLAQHQKMMHTAEKSQMPRASESPSL
FT                   IACQGNTTEEKPFKCEQCGKAFRWLSRLNQHQVVHSGEKPYQCNKCSKAFGCTSRLIRH
FT                   QRTHTGEKPFKCDECGKRFVQSSHLIQHQRIHTGEKPYVCDDCGRAFTQSSSLIYHQRI
FT                   HKGEKPYKCSQCGKAFSMSTQLTSHQRTHTGERPYTCNECGKTFRQNSTLFQHQIIHVR
FT                   VKPYECNECGKAFSRSSYLIEHQRIHTRAQGGHEFGDTPESPTVLNHKKVHTVKKLYQC
FT                   DDCDKVFRWRSYLIIHQRIHTGERPYKCNACGKAFHQIAKLTQHQKLHMR"
FT   CDS             join(27091149..27091151,27091481..27091607,
FT                   27098564..27098715)
FT                   /codon_start=1
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, isoform CRA_b"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT180375.0
FT                   protein_id=mCP103296.0 isoform=CRA_b"
FT                   /protein_id="EDL29621.1"
FT                   /translation="MEAVTFGDVAVHFSREEWQCLDSGQRALYKEVMLENHSSVAGLGF
FT                   LVFKPELISRLEQGQEPWVLDLQGAEGTEAPRICQTGEAQALSRRWSE"
FT   CDS             <27100201..27102147
FT                   /codon_start=1
FT                   /gene="Zfp7"
FT                   /locus_tag="mCG_142392"
FT                   /product="zinc finger protein 7, isoform CRA_c"
FT                   /note="gene_id=mCG142392.0 transcript_id=mCT192619.0
FT                   protein_id=mCP113570.0 isoform=CRA_c"
FT                   /protein_id="EDL29622.1"
FT                   /translation="IVRISLCISLLYFALGLFPTSLASSALLQTSDVRNIFFFYFVFIS
FT                   DSAIRTDRKQTCEYTSLLQRQIPGFGDNLDSKVWSENCPRSLGLSVSGSLFQKHRLNSE
FT                   AVMPKNSTKDAVQERKELQATDVGYRPDDQRDHLSSKLIRRQSVPTGENRYPCEECGKA
FT                   FRWRSRLNQHKLSHTGEKSYQCNKCTKVFASSSRLIRHQRAHTGEKPFKCDQCGKRFVL
FT                   ASVLTQHQRIHTGERPFKCAECGKGFHLSAKLVQHQRIHTGEKPYRCEECGKTFGQSSS
FT                   LVHHQRIHTGERPFICQECGKAFCQRSQLSRHRRTHTGERPYSCQECGKAFCQRATLAQ
FT                   HQKMMHTAEKSQMPRASESPSLIACQGNTTEEKPFKCEQCGKAFRWLSRLNQHQVVHSG
FT                   EKPYQCNKCSKAFGCTSRLIRHQRTHTGEKPFKCDECGKRFVQSSHLIQHQRIHTGEKP
FT                   YVCDDCGRAFTQSSSLIYHQRIHKGEKPYKCSQCGKAFSMSTQLTSHQRTHTGERPYTC
FT                   NECGKTFRQNSTLFQHQIIHVRVKPYECNECGKAFSRSSYLIEHQRIHTRAQGGHEFGD
FT                   TPESPTVLNHKKVHTVKKLYQCDDCDKVFRWRSYLIIHQRIHTGERPYKCNACGKAFHQ
FT                   IAKLTQHQKLHMR"
FT   gap             27106175..27106268
FT                   /estimated_length=94
FT   gene            <27110408..27111791
FT                   /gene="Commd5"
FT                   /locus_tag="mCG_23622"
FT                   /note="gene_id=mCG23622.2"
FT   mRNA            join(<27110408..27110509,27110846..>27111573)
FT                   /gene="Commd5"
FT                   /locus_tag="mCG_23622"
FT                   /product="COMM domain containing 5, transcript variant
FT                   mCT23569"
FT                   /note="gene_id=mCG23622.2 transcript_id=mCT23569.1 created
FT                   on 18-OCT-2002"
FT   mRNA            join(<27110429..27110486,27110846..27111791)
FT                   /gene="Commd5"
FT                   /locus_tag="mCG_23622"
FT                   /product="COMM domain containing 5, transcript variant
FT                   mCT174563"
FT                   /note="gene_id=mCG23622.2 transcript_id=mCT174563.0 created
FT                   on 18-OCT-2002"
FT   CDS             <27110860..27111573
FT                   /codon_start=1
FT                   /gene="Commd5"
FT                   /locus_tag="mCG_23622"
FT                   /product="COMM domain containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG23622.2 transcript_id=mCT174563.0
FT                   protein_id=mCP97482.0 isoform=CRA_a"
FT                   /protein_id="EDL29623.1"
FT                   /translation="YLLSGLVKKGKGRMSALGAAAPYLHHPTDSHSGRVSFLGSQPSAE
FT                   VTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVQHLGASANLSEERLAVLLAGTHT
FT                   LLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQGSSLP
FT                   RVSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLK
FT                   EMAELERKCERKLQD"
FT   CDS             <27110860..27111573
FT                   /codon_start=1
FT                   /gene="Commd5"
FT                   /locus_tag="mCG_23622"
FT                   /product="COMM domain containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG23622.2 transcript_id=mCT23569.1
FT                   protein_id=mCP17787.0 isoform=CRA_a"
FT                   /protein_id="EDL29624.1"
FT                   /translation="YLLSGLVKKGKGRMSALGAAAPYLHHPTDSHSGRVSFLGSQPSAE
FT                   VTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVQHLGASANLSEERLAVLLAGTHT
FT                   LLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQGSSLP
FT                   RVSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLK
FT                   EMAELERKCERKLQD"
FT   gene            27114580..27116812
FT                   /locus_tag="mCG_131128"
FT                   /note="gene_id=mCG131128.1"
FT   mRNA            join(27114580..27114603,27114797..27114944,
FT                   27115033..27115174,27115312..27115447,27116378..27116465,
FT                   27116615..27116812)
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, transcript variant mCT172315"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT172315.0
FT                   created on 28-FEB-2003"
FT   mRNA            join(27114580..27114603,27114797..27114944,
FT                   27115033..27115174,27115312..27115530,27116350..27116465,
FT                   27116615..27116806)
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, transcript variant mCT132458"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT132458.1
FT                   created on 28-FEB-2003"
FT   mRNA            join(27114802..27114944,27115033..27115174,
FT                   27115312..27115526,27116350..27116465,27116615..27116778)
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, transcript variant mCT180725"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT180725.0
FT                   created on 28-FEB-2003"
FT   CDS             join(27114807..27114944,27115033..27115174,
FT                   27115312..27115530,27116350..27116465,27116615..27116773)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, isoform CRA_a"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT132458.1
FT                   protein_id=mCP60504.1 isoform=CRA_a"
FT                   /protein_id="EDL29625.1"
FT                   /translation="MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIV
FT                   KDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPV
FT                   GTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANR
FT                   AVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKP
FT                   STIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN"
FT   CDS             join(27114807..27114944,27115033..27115174,
FT                   27115312..27115447,27116378..27116465,27116615..27116773)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, isoform CRA_b"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT172315.0
FT                   protein_id=mCP95234.0 isoform=CRA_b"
FT                   /protein_id="EDL29626.1"
FT                   /translation="MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIV
FT                   KDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPV
FT                   GTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHKPILKAGRAYHKYKAKRNCWPRVR
FT                   GVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN"
FT   CDS             join(27114807..27114944,27115033..27115174,
FT                   27115312..27115526,27116350..27116391)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131128"
FT                   /product="mCG131128, isoform CRA_c"
FT                   /note="gene_id=mCG131128.1 transcript_id=mCT180725.0
FT                   protein_id=mCP103647.0 isoform=CRA_c"
FT                   /protein_id="EDL29627.1"
FT                   /translation="MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIV
FT                   KDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPV
FT                   GTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANR
FT                   AVVLWLVGAELTSLS"
FT   gene            27158776..27161550
FT                   /gene="1110038F14Rik"
FT                   /locus_tag="mCG_23644"
FT                   /note="gene_id=mCG23644.1"
FT   mRNA            join(27158776..27159032,27159117..27159491,
FT                   27159556..27159640,27160032..27160178,27160737..27161550)
FT                   /gene="1110038F14Rik"
FT                   /locus_tag="mCG_23644"
FT                   /product="RIKEN cDNA 1110038F14"
FT                   /note="gene_id=mCG23644.1 transcript_id=mCT23593.1 created
FT                   on 19-AUG-2002"
FT   CDS             join(27159027..27159032,27159117..27159491,
FT                   27159556..27159640,27160032..27160178,27160737..27160876)
FT                   /codon_start=1
FT                   /gene="1110038F14Rik"
FT                   /locus_tag="mCG_23644"
FT                   /product="RIKEN cDNA 1110038F14"
FT                   /note="gene_id=mCG23644.1 transcript_id=mCT23593.1
FT                   protein_id=mCP17871.2"
FT                   /protein_id="EDL29628.1"
FT                   /translation="MAEPGRPAREAPAASSRKTHRAPRRPRPSRSASGASEPPLRSSVQ
FT                   PACDSAAGTHPVGNTVAMKQKKKKTPNRVSGTNGSEKPSEKPAPDEAPPSAEAQARMVL
FT                   PASFLGANPPASVGELCGIKALKAEQLARELAWCVEQLELGLKTQRPTPKQKEQAVGAI
FT                   RTLRSEKTPLPRKRQLMRSLFGDYRAQMDAEWREALRALKAATHSAQVQLVSEATRKKS
FT                   GRVCRPRPAERAKTTPDLTSEEFRFNFF"
FT   gap             27164442..27164461
FT                   /estimated_length=20
FT   gap             27173723..27173893
FT                   /estimated_length=171
FT   gap             27211691..27211828
FT                   /estimated_length=138
FT   gene            complement(27219057..27254271)
FT                   /gene="Mb"
FT                   /locus_tag="mCG_23631"
FT                   /note="gene_id=mCG23631.2"
FT   mRNA            complement(join(27219057..27219643,27221147..27221369,
FT                   27226060..27226162,27243412..27243498,27254137..27254270))
FT                   /gene="Mb"
FT                   /locus_tag="mCG_23631"
FT                   /product="myoglobin, transcript variant mCT23578"
FT                   /note="gene_id=mCG23631.2 transcript_id=mCT23578.1 created
FT                   on 19-DEC-2002"
FT   mRNA            complement(join(27219060..27219643,27221147..27221369,
FT                   27226060..27226162,27254137..27254271))
FT                   /gene="Mb"
FT                   /locus_tag="mCG_23631"
FT                   /product="myoglobin, transcript variant mCT175831"
FT                   /note="gene_id=mCG23631.2 transcript_id=mCT175831.0 created
FT                   on 19-DEC-2002"
FT   CDS             complement(join(27219497..27219643,27221147..27221369,
FT                   27226060..27226154))
FT                   /codon_start=1
FT                   /gene="Mb"
FT                   /locus_tag="mCG_23631"
FT                   /product="myoglobin, isoform CRA_a"
FT                   /note="gene_id=mCG23631.2 transcript_id=mCT175831.0
FT                   protein_id=mCP98753.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UVB1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR002335"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="MGI:MGI:96922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVB1"
FT                   /protein_id="EDL29629.1"
FT                   /translation="MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFD
FT                   KFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKY
FT                   LEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG"
FT   CDS             complement(join(27219497..27219643,27221147..27221369,
FT                   27226060..27226154))
FT                   /codon_start=1
FT                   /gene="Mb"
FT                   /locus_tag="mCG_23631"
FT                   /product="myoglobin, isoform CRA_a"
FT                   /note="gene_id=mCG23631.2 transcript_id=mCT23578.1
FT                   protein_id=mCP17812.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UVB1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR002335"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="MGI:MGI:96922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVB1"
FT                   /protein_id="EDL29630.1"
FT                   /translation="MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFD
FT                   KFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKY
FT                   LEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG"
FT   gap             27241301..27241344
FT                   /estimated_length=44
FT   gap             27242563..27242883
FT                   /estimated_length=321
FT   gene            27248916..27260719
FT                   /locus_tag="mCG_23648"
FT                   /note="gene_id=mCG23648.1"
FT   mRNA            join(27248916..27248982,27249307..27249400,
FT                   27254217..27255017,27259464..27260719)
FT                   /locus_tag="mCG_23648"
FT                   /product="mCG23648"
FT                   /note="gene_id=mCG23648.1 transcript_id=mCT23596.2 created
FT                   on 18-OCT-2002"
FT   gap             27250438..27251984
FT                   /estimated_length=1547
FT   CDS             join(27254574..27255017,27259464..27259556)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23648"
FT                   /product="mCG23648"
FT                   /note="gene_id=mCG23648.1 transcript_id=mCT23596.2
FT                   protein_id=mCP17805.2"
FT                   /protein_id="EDL29631.1"
FT                   /translation="MPNSDQELEGVKGEKTTFVTAAGDLVYKCGNAWDNIKKHLRALQL
FT                   TRTQPHVTSAAKKLMTAGHVSARSGRQVQKAFGGTALAMTKNALRMGRAAAALSLGQDI
FT                   YTLWEDWKDLKAANPTELAEELRARAAERERVLAEHTCRYRKLQRLSKEAARSSLKGNK
FT                   VTQPPSSSTERARLW"
FT   gap             27260879..27260987
FT                   /estimated_length=109
FT   gap             27269594..27269613
FT                   /estimated_length=20
FT   gap             27272624..27272643
FT                   /estimated_length=20
FT   gap             27276694..27276806
FT                   /estimated_length=113
FT   gene            complement(27287353..27510182)
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /note="gene_id=mCG131133.1"
FT   mRNA            complement(join(27287353..27287742,27289114..27289186,
FT                   27289603..27289691,27301476..27301608,27302776..27302868,
FT                   27302975..27303028,27306403..27306463,27309095..27309187,
FT                   27317123..27317176,27320439..27320585,27336234..27336458,
FT                   27434907..27434957,27509941..27510182))
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, transcript variant
FT                   mCT172317"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT172317.0
FT                   created on 19-AUG-2002"
FT   mRNA            complement(join(27287353..27287742,27289114..27289186,
FT                   27289603..27289691,27297987..27298026,27301476..27301608,
FT                   27302776..27302868,27302975..27303028,27306403..27306463,
FT                   27309095..27309187,27317123..27317176,27320439..27320585,
FT                   27336234..27336458,27357048..27357273))
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, transcript variant
FT                   mCT172316"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT172316.0
FT                   created on 19-AUG-2002"
FT   mRNA            complement(join(27287353..27287742,27289114..27289186,
FT                   27289603..27289691,27295348..27295390,27297987..27298026,
FT                   27301476..27301608,27302776..27302868,27302975..27303028,
FT                   27306403..27306463,27309095..27309187,27317123..27317176,
FT                   27320439..27320585,27336234..27336458,27357048..27357157))
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, transcript variant
FT                   mCT132462"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT132462.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(27287688..27287742,27289114..27289186,
FT                   27289603..27289691,27301476..27301608,27302776..27302868,
FT                   27302975..27303028,27306403..27306463,27309095..27309187,
FT                   27317123..27317176,27320439..27320585,27336234..27336458,
FT                   27434907..27434957,27509941..27510120))
FT                   /codon_start=1
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT172317.0
FT                   protein_id=mCP95235.0 isoform=CRA_b"
FT                   /protein_id="EDL29633.1"
FT                   /translation="MAEGGQAQQQPPQLGPGAAARGMKRESEVELPVPGAGADGPEPGL
FT                   SKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQEPTTTPDAMVQPFTTIPFPPPPQN
FT                   GIPTEYGVPHTQDYAGQTSEHNLTLYGSTQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQ
FT                   QSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFG
FT                   FVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAV
FT                   YGPELYAASSFQADVSLGNEAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHL
FT                   RGRGRTVYGAVRAVPPTAIPAYPGVDMQPTDMHSLLLQPQPQLLQPLQPLTATVTAGCT
FT                   QLTPTMPSPLPPAMELALWRVCTEVATADLPPTEVT"
FT   CDS             complement(join(27287698..27287742,27289114..27289186,
FT                   27289603..27289691,27297987..27298026,27301476..27301608,
FT                   27302776..27302868,27302975..27303028,27306403..27306463,
FT                   27309095..27309187,27317123..27317176,27320439..27320585,
FT                   27336234..27336458,27357048..27357074))
FT                   /codon_start=1
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT172316.0
FT                   protein_id=mCP95236.0 isoform=CRA_a"
FT                   /protein_id="EDL29632.1"
FT                   /translation="MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVP
FT                   HTQDYAGQTSEHNLTLYGSTQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQQSQTQSSEN
FT                   SESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSAD
FT                   ADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAAS
FT                   SFQADVSLGNEAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYG
FT                   AVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGY
FT                   GRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY"
FT   gene            <27287979..27299850
FT                   /locus_tag="mCG_145464"
FT                   /note="gene_id=mCG145464.0"
FT   mRNA            join(<27287979..27288398,27294091..27294253,
FT                   27299389..27299850)
FT                   /locus_tag="mCG_145464"
FT                   /product="mCG145464"
FT                   /note="gene_id=mCG145464.0 transcript_id=mCT184888.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(27295364..27295390,27297987..27298026,
FT                   27301476..27301608,27302776..27302868,27302975..27303028,
FT                   27306403..27306463,27309095..27309187,27317123..27317176,
FT                   27320439..27320585,27336234..27336458,27357048..27357074))
FT                   /codon_start=1
FT                   /gene="Rbm9"
FT                   /locus_tag="mCG_131133"
FT                   /product="RNA binding motif protein 9, isoform CRA_c"
FT                   /note="gene_id=mCG131133.1 transcript_id=mCT132462.1
FT                   protein_id=mCP60534.1 isoform=CRA_c"
FT                   /protein_id="EDL29634.1"
FT                   /translation="MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVP
FT                   HTQDYAGQTSEHNLTLYGSTQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQQSQTQSSEN
FT                   SESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSAD
FT                   ADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAAS
FT                   SFQADVSLGNEAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYG
FT                   AVRAVPPTAIPAYPGVVYQDGFYGADLYNSVTGTNH"
FT   CDS             <27299517..27299828
FT                   /codon_start=1
FT                   /locus_tag="mCG_145464"
FT                   /product="mCG145464"
FT                   /note="gene_id=mCG145464.0 transcript_id=mCT184888.0
FT                   protein_id=mCP105332.0"
FT                   /protein_id="EDL29635.1"
FT                   /translation="LKAEEWAQRLRGVTLHQCQCGHGQRLQHILLQRLLPLETWIYFIV
FT                   SQIIYCEYSLDSTRVLIIPEPNVVRAQRLTSDSRREILGYSPGNTGLIPCHLPCKQMV"
FT   gap             27458477..27458571
FT                   /estimated_length=95
FT   gap             27518315..27519016
FT                   /estimated_length=702
FT   gap             27526109..27526471
FT                   /estimated_length=363
FT   gap             27536564..27536583
FT                   /estimated_length=20
FT   gap             27555869..27555888
FT                   /estimated_length=20
FT   gap             27560163..27560182
FT                   /estimated_length=20
FT   gap             27587333..27587352
FT                   /estimated_length=20
FT   gene            complement(27592657..27603561)
FT                   /locus_tag="mCG_23624"
FT                   /note="gene_id=mCG23624.2"
FT   mRNA            complement(join(27592657..27594456,27597198..27597302,
FT                   27597846..27597972,27600669..27600756,27600846..27600945,
FT                   27603377..27603560))
FT                   /locus_tag="mCG_23624"
FT                   /product="mCG23624, transcript variant mCT23572"
FT                   /note="gene_id=mCG23624.2 transcript_id=mCT23572.2 created
FT                   on 18-OCT-2002"
FT   mRNA            complement(join(27592663..27594456,27597198..27597302,
FT                   27597846..27597972,27600669..27600756,27603377..27603561))
FT                   /locus_tag="mCG_23624"
FT                   /product="mCG23624, transcript variant mCT174564"
FT                   /note="gene_id=mCG23624.2 transcript_id=mCT174564.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(27593445..27594456,27597198..27597302,
FT                   27597846..27597972,27600669..27600681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23624"
FT                   /product="mCG23624, isoform CRA_a"
FT                   /note="gene_id=mCG23624.2 transcript_id=mCT174564.0
FT                   protein_id=mCP97483.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RT54"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:1923011"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT54"
FT                   /protein_id="EDL29636.1"
FT                   /translation="MDTPDRECFVESVVNYLLDTWSTEDLRLLLTEEETWKHFVAEVDL
FT                   SREEEAALQESLAEIFADPDGEDEDELQNDLQDKNERKEEDSLSEDLGESVADTDVEDE
FT                   DGDAEDEDSDTEDEDRDIEDENSNREDEDSDTEDEDSDTEGEDSNTEDEEEIQNDLWHK
FT                   ERFLDAYPQVKLELEEIIRKLHALADKVDKVHRDCTISRVVASSSSAVSGVLIILGLSL
FT                   APVTAGVSLALSATGLGLGAAAAVTSVSTSIVEKVSVVSAEDEASKLVPTNKDTMKGMK
FT                   EVLDQSGPRLLSLSTDTIQRLQGIQKCINAIPLAKANTRLANNAKRLMTTGKISARNTK
FT                   QVQKAFGGTALAMTKGARIMGAATAGFFLLQDVISLVEDSKHLHEGAKSQTAAELRKQA
FT                   QDLEQKLQELKEVHDSLTK"
FT   CDS             complement(join(27593445..27594456,27597198..27597302,
FT                   27597846..27597972,27600669..27600681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23624"
FT                   /product="mCG23624, isoform CRA_a"
FT                   /note="gene_id=mCG23624.2 transcript_id=mCT23572.2
FT                   protein_id=mCP17788.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RT54"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:1923011"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT54"
FT                   /protein_id="EDL29637.1"
FT                   /translation="MDTPDRECFVESVVNYLLDTWSTEDLRLLLTEEETWKHFVAEVDL
FT                   SREEEAALQESLAEIFADPDGEDEDELQNDLQDKNERKEEDSLSEDLGESVADTDVEDE
FT                   DGDAEDEDSDTEDEDRDIEDENSNREDEDSDTEDEDSDTEGEDSNTEDEEEIQNDLWHK
FT                   ERFLDAYPQVKLELEEIIRKLHALADKVDKVHRDCTISRVVASSSSAVSGVLIILGLSL
FT                   APVTAGVSLALSATGLGLGAAAAVTSVSTSIVEKVSVVSAEDEASKLVPTNKDTMKGMK
FT                   EVLDQSGPRLLSLSTDTIQRLQGIQKCINAIPLAKANTRLANNAKRLMTTGKISARNTK
FT                   QVQKAFGGTALAMTKGARIMGAATAGFFLLQDVISLVEDSKHLHEGAKSQTAAELRKQA
FT                   QDLEQKLQELKEVHDSLTK"
FT   gap             27594995..27595061
FT                   /estimated_length=67
FT   gene            complement(27608212..>27610163)
FT                   /locus_tag="mCG_131140"
FT                   /note="gene_id=mCG131140.1"
FT   mRNA            complement(join(27608212..27609479,27610010..>27610163))
FT                   /locus_tag="mCG_131140"
FT                   /product="mCG131140"
FT                   /note="gene_id=mCG131140.1 transcript_id=mCT132469.1
FT                   created on 15-NOV-2002"
FT   CDS             complement(join(27608656..27609479,27610010..>27610163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131140"
FT                   /product="mCG131140"
FT                   /note="gene_id=mCG131140.1 transcript_id=mCT132469.1
FT                   protein_id=mCP60325.1"
FT                   /protein_id="EDL29638.1"
FT                   /translation="REQTHHPGSHWVSQNMASSGYLYSLVAEDGVWQAFVSKAKLSRSV
FT                   LWDAQHALRELTALLAIADRGRLQKGLKGREKFLKVFPRLKAELVEHISQLHALADHAE
FT                   KLHRGCTISNVVADSFSAASDILSLLGLFLAPVTAEGSLVLSATGLGLGVAATVTDVAT
FT                   SIVEETSRVLDEVEAAPTGTHVLGEAGTSVDRIASKVPQATRDITRDLEALEQHMNALR
FT                   LVRANPRLEEDARILATTGSISAQRAMQVRASLKGTPLAMSNEARIQRATAAGAALWSD
FT                   VDSLVKESKHLYEGSASESAEALRKLARELEEKLEGLMEFYKTI"
FT   gap             27609482..27609834
FT                   /estimated_length=353
FT   gap             27613619..27615622
FT                   /estimated_length=2004
FT   gap             27620662..27620681
FT                   /estimated_length=20
FT   gap             27621840..27656555
FT                   /estimated_length=34716
FT   gene            27678416..27717684
FT                   /gene="9030421J09Rik"
FT                   /locus_tag="mCG_1051066"
FT                   /note="gene_id=mCG1051066.0"
FT   mRNA            join(27678416..27678503,27682588..27682668,
FT                   27686212..27686338,27689702..27691464,27716983..27717041,
FT                   27717105..27717684)
FT                   /gene="9030421J09Rik"
FT                   /locus_tag="mCG_1051066"
FT                   /product="RIKEN cDNA 9030421J09"
FT                   /note="gene_id=mCG1051066.0 transcript_id=mCT194855.0
FT                   created on 27-JAN-2005"
FT   CDS             join(27682632..27682668,27686212..27686338,
FT                   27689702..27690494)
FT                   /codon_start=1
FT                   /gene="9030421J09Rik"
FT                   /locus_tag="mCG_1051066"
FT                   /product="RIKEN cDNA 9030421J09"
FT                   /note="gene_id=mCG1051066.0 transcript_id=mCT194855.0
FT                   protein_id=mCP115884.0"
FT                   /db_xref="GOA:Q8CCA5"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:3036238"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CCA5"
FT                   /protein_id="EDL29639.1"
FT                   /translation="MDWNEILEDIRKVERRIVEKFIEDLTENFLRTDLRSLITEDGAWN
FT                   GFLETAELSSEEKAALRDALKESSAQKPSGENDRPERKPQKEQILREVPQLKKKLEVHI
FT                   SKLRELADKLDLVHKCCTISNVVSLTLSAASGVLKLLDFVLSQIYGMPRRALSATSEGL
FT                   GMASDMINITTTIVGESFRQSYESEARRLVGASINILYEIINITPMITVKLYYTVKDLV
FT                   EAFKTLTGQIRAIRTAISNSDLGTQARNPASTGRSSGQGVPQMISRARIREIGLTVPFL
FT                   EQDLRDLAQQFEVLKDGAKTESGGALRDLAHKLEENL"
FT   gap             27691469..27706544
FT                   /estimated_length=15076
FT   gene            complement(27723630..27732043)
FT                   /locus_tag="mCG_131135"
FT                   /note="gene_id=mCG131135.0"
FT   mRNA            complement(join(27723630..27724411,27725234..27725277,
FT                   27727582..27727686,27728717..27728843,27729136..27729238,
FT                   27731967..27732043))
FT                   /locus_tag="mCG_131135"
FT                   /product="mCG131135, transcript variant mCT132464"
FT                   /note="gene_id=mCG131135.0 transcript_id=mCT132464.0
FT                   created on 26-FEB-2003"
FT   mRNA            complement(join(27723639..27725277,27727582..27727686,
FT                   27728717..27728843,27729136..27729238,27731967..27732043))
FT                   /locus_tag="mCG_131135"
FT                   /product="mCG131135, transcript variant mCT180726"
FT                   /note="gene_id=mCG131135.0 transcript_id=mCT180726.0
FT                   created on 26-FEB-2003"
FT   CDS             complement(join(27724224..27724411,27725234..27725277,
FT                   27727582..27727686,27728717..27728843,27729136..27729148))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131135"
FT                   /product="mCG131135, isoform CRA_a"
FT                   /note="gene_id=mCG131135.0 transcript_id=mCT132464.0
FT                   protein_id=mCP60596.1 isoform=CRA_a"
FT                   /protein_id="EDL29640.1"
FT                   /translation="MSTPERKRFIPTVAQHLLDRKSLEVLQLLLTEEETWKQFVAEVDL
FT                   SREEEAALRESLAEIFADPDGEDEDELQIDLQDKNERKEEDALSEALTETIALHLLCSS
FT                   DDWGGSVLDRAMNTWEPLTYPFTAVPAKGRGHIKIQEARTEMGQSHDHLPDSSS"
FT   CDS             complement(join(27724413..27725277,27727582..27727686,
FT                   27728717..27728843,27729136..27729148))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131135"
FT                   /product="mCG131135, isoform CRA_b"
FT                   /note="gene_id=mCG131135.0 transcript_id=mCT180726.0
FT                   protein_id=mCP103648.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C6E1"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:1920912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C6E1"
FT                   /protein_id="EDL29641.1"
FT                   /translation="MSTPERKRFIPTVAQHLLDRKSLEVLQLLLTEEETWKQFVAEVDL
FT                   SREEEAALRESLAEIFADPDGEDEDELQIDLQDKNERKEEDALSEALTETIADTDAEDE
FT                   EEIQNDLWHKERFLDAYPWVKLEIEESIRKLHALADKVDKVHRDCTISRVVASSSSAVS
FT                   GVLTILGLALAPVTAGVSLALSATGLGLGAAATVTSVSTSIVEKVSVVSAEAKARNLVP
FT                   TNKDTMKGIIEVLDQSGPRLISGSTNTIQNIQGIQKCINAIQLSKANTRLANDARRLMT
FT                   TGKTSTQTTKQVQKAFGGTTLAMTKGVRIMGAATTGFFLLLDVISLVEDSKHLHEGAKS
FT                   QTAAELQQQAWNLELKLQELKEVHNSLTQ"
FT   gap             27734392..27737238
FT                   /estimated_length=2847
FT   gap             27743419..27743438
FT                   /estimated_length=20
FT   gap             27746193..27746737
FT                   /estimated_length=545
FT   gene            complement(27749047..>27752653)
FT                   /locus_tag="mCG_144784"
FT                   /note="gene_id=mCG144784.0"
FT   mRNA            complement(join(27749047..27749333,27749704..27749859,
FT                   27749928..27749970,27752617..>27752653))
FT                   /locus_tag="mCG_144784"
FT                   /product="mCG144784"
FT                   /note="gene_id=mCG144784.0 transcript_id=mCT184208.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(27749196..27749333,27749704..27749859,
FT                   27749928..>27749936))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144784"
FT                   /product="mCG144784"
FT                   /note="gene_id=mCG144784.0 transcript_id=mCT184208.0
FT                   protein_id=mCP105325.0"
FT                   /protein_id="EDL29642.1"
FT                   /translation="KKEVSELMSTKNEEQNEDQSEGVVIPHIQDHHCLAILAFCFFFPL
FT                   GYLAYRSSCKTRTYIEQKEYEKAKATSRCTFAFVLSSIAGGSIIFFCLFSRLFFI"
FT   gap             27759464..27759483
FT                   /estimated_length=20
FT   gap             27766943..27767281
FT                   /estimated_length=339
FT   gap             27768666..27771388
FT                   /estimated_length=2723
FT   gap             27783275..27783294
FT                   /estimated_length=20
FT   gene            complement(<27785231..27792410)
FT                   /gene="9130218O11Rik"
FT                   /locus_tag="mCG_131136"
FT                   /note="gene_id=mCG131136.0"
FT   mRNA            complement(join(<27785231..27786071,27788949..27789075,
FT                   27792336..27792410))
FT                   /gene="9130218O11Rik"
FT                   /locus_tag="mCG_131136"
FT                   /product="RIKEN cDNA 9130218O11"
FT                   /note="gene_id=mCG131136.0 transcript_id=mCT132465.0
FT                   created on 15-NOV-2002"
FT   CDS             complement(join(27785231..27786071,27788949..27789075,
FT                   27792336..27792372))
FT                   /codon_start=1
FT                   /gene="9130218O11Rik"
FT                   /locus_tag="mCG_131136"
FT                   /product="RIKEN cDNA 9130218O11"
FT                   /note="gene_id=mCG131136.0 transcript_id=mCT132465.0
FT                   protein_id=mCP60297.1"
FT                   /db_xref="GOA:G3X9K7"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:3043522"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9K7"
FT                   /protein_id="EDL29643.1"
FT                   /translation="MARAWCSTDLKQGVARSVDGVADIVTEKFLKTDLRSLITEDGAWK
FT                   AFEEAAELSSEEGAILRDALKESLAQEPSDENDGPERKQQNERFLREFPELKKKLEDHI
FT                   RKLRDLADHLDQVHKDCTISNVVSTFASAISGAMGLLALGLVPFTEGVSLLLSAASVGL
FT                   GETASVTGLTTTVVEESMRLSDESEASRLVRASMNVFEEIVKIMSKITFKLLFTAVGLV
FT                   PAVKILRDHIRAMRRARIIIFPREEARNLTSSERSSVQGVLPMTRGARLRAVGFTSLFL
FT                   AWDVYDFVKQSKDLYNGAKTESAGALRELAHKLEEKLQVFEQIYKALQSDLPH"
FT   gap             27792672..27816411
FT                   /estimated_length=23740
FT   gene            <27818115..>27825786
FT                   /locus_tag="mCG_1032535"
FT                   /note="gene_id=mCG1032535.1"
FT   mRNA            join(<27818115..27818192,27820893..27820995,
FT                   27821288..27821414,27822440..27822544,27824922..>27825786)
FT                   /locus_tag="mCG_1032535"
FT                   /product="mCG1032535"
FT                   /note="gene_id=mCG1032535.1 transcript_id=mCT150239.1
FT                   created on 20-NOV-2002"
FT   CDS             join(<27820962..27820995,27821288..27821414,
FT                   27822440..27822544,27824922..27825786)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032535"
FT                   /product="mCG1032535"
FT                   /note="gene_id=mCG1032535.1 transcript_id=mCT150239.1
FT                   protein_id=mCP60369.1"
FT                   /protein_id="EDL29644.1"
FT                   /translation="HLDLAAVISTPERKRFIPTVAQHLLDRKSLEVLQLLLTEEETWKQ
FT                   FVAEVDLSREEEAAFRESLAEIFADPDGEDEDELQNDLQDKNERKEEDALSEALTETIA
FT                   DTDAEDEEEIQNDPWHKERFLDAYPRVKLELEGSIRKLHALADKVDKVHRDCTISRVMV
FT                   SSSSAVSGVLTILGLSLAPVTAGVSLALSATGLGLGAAATVTSVSTSIVEKVSVVSAEA
FT                   KASKLVPTNKDTMKGIIEVLDQSGPRLISVSTNTIQSIQGIQKCINAIQLAKANPRLAN
FT                   DAKRLMTTGKTSTQTTKQVKEAFGGTTLAMTKGVRIMGAATTGFFLLLDVISLLEDSKH
FT                   LHEGAKSQTAAELQQQAWNLEQKLRELKEVHDSLTK"
FT   gene            complement(27833122..27839776)
FT                   /locus_tag="mCG_148010"
FT                   /note="gene_id=mCG148010.0"
FT   mRNA            complement(join(27833122..27834868,27839691..27839776))
FT                   /locus_tag="mCG_148010"
FT                   /product="mCG148010"
FT                   /note="gene_id=mCG148010.0 transcript_id=mCT188273.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(27834028..27834492)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148010"
FT                   /product="mCG148010"
FT                   /note="gene_id=mCG148010.0 transcript_id=mCT188273.0
FT                   protein_id=mCP108974.0"
FT                   /protein_id="EDL29645.1"
FT                   /translation="MTLSYESEARNLIGASMNVLEEILSIMPKITCKFYNTVADLVKAF
FT                   KTLKGQIQTIRRARSISRRGAQARNLTSTGRSSGQGVSQMTRGARIRAGVFTSVFLGWD
FT                   VYDLVNQATDLHDGGETESGGALRDLARKLEENLQKFEQKYNALQSDLPQ"
FT   gap             27842263..27855494
FT                   /estimated_length=13232
FT   gap             27868056..27869460
FT                   /estimated_length=1405
FT   gap             27871428..27871447
FT                   /estimated_length=20
FT   gap             27872727..27872746
FT                   /estimated_length=20
FT   gap             27878780..27880829
FT                   /estimated_length=2050
FT   gap             27888554..27903147
FT                   /estimated_length=14594
FT   gene            <27910983..27918294
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /note="gene_id=mCG13344.3"
FT   mRNA            join(<27910983..27911061,27916378..27916503,
FT                   27917002..27918294)
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, transcript variant
FT                   mCT192597"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT192597.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<27910985..27911061,27916378..27916503,
FT                   27917002..27917851)
FT                   /codon_start=1
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, isoform CRA_c"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT192597.0
FT                   protein_id=mCP113557.0 isoform=CRA_c"
FT                   /protein_id="EDL29648.1"
FT                   /translation="EAAFLVTQRCSCQLHLRSQGHLGPVREQTHHPGSHWVSQNMASSG
FT                   YLYSLVAEDGAWQAFVSKAKLSRERAVALHKALRELTALLAIADRGRLQKGLKGREKFL
FT                   KVFPRLKAELVEHISQLHALADHAEKLHRGCTISNVVADSFSAASDILSLLGLFLAPVT
FT                   AEGSLVLSATGLGLGVAATVTDVATSIVEETSRVLDEVEAALTGTHVLGEAGTSVARIV
FT                   NKIPQATRDITRDLEALEQHMNALRLVRANPRLEEDARILATTGSISAQRAMQVRARLE
FT                   GTPLAMSNEARIQRAATAGAALWSDVDSLVKESKHLYEGSASESAEALRKLARELEEKL
FT                   EGLMEFYKTI"
FT   mRNA            join(<27910999..27911159,27916378..27916503,
FT                   27917002..27918294)
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, transcript variant
FT                   mCT12759"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT12759.2 created
FT                   on 18-OCT-2002"
FT   mRNA            join(<27911032..27911159,27915539..27915709,
FT                   27916378..27916503,27917002..27918292)
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, transcript variant
FT                   mCT174542"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT174542.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(<27911143..27911159,27916378..27916503,
FT                   27917002..27917851)
FT                   /codon_start=1
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, isoform CRA_a"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT12759.2
FT                   protein_id=mCP10077.2 isoform=CRA_a"
FT                   /protein_id="EDL29646.1"
FT                   /translation="GSTQEREQTHHPGSHWVSQNMASSGYLYSLVAEDGAWQAFVSKAK
FT                   LSRERAVALHKALRELTALLAIADRGRLQKGLKGREKFLKVFPRLKAELVEHISQLHAL
FT                   ADHAEKLHRGCTISNVVADSFSAASDILSLLGLFLAPVTAEGSLVLSATGLGLGVAATV
FT                   TDVATSIVEETSRVLDEVEAALTGTHVLGEAGTSVARIVNKIPQATRDITRDLEALEQH
FT                   MNALRLVRANPRLEEDARILATTGSISAQRAMQVRARLEGTPLAMSNEARIQRAATAGA
FT                   ALWSDVDSLVKESKHLYEGSASESAEALRKLARELEEKLEGLMEFYKTI"
FT   CDS             join(<27915696..27915709,27916378..27916503,
FT                   27917002..27917851)
FT                   /codon_start=1
FT                   /gene="2310016F22Rik"
FT                   /locus_tag="mCG_13344"
FT                   /product="RIKEN cDNA 2310016F22, isoform CRA_b"
FT                   /note="gene_id=mCG13344.3 transcript_id=mCT174542.0
FT                   protein_id=mCP97461.0 isoform=CRA_b"
FT                   /protein_id="EDL29647.1"
FT                   /translation="CPYGREQTHHPGSHWVSQNMASSGYLYSLVAEDGAWQAFVSKAKL
FT                   SRERAVALHKALRELTALLAIADRGRLQKGLKGREKFLKVFPRLKAELVEHISQLHALA
FT                   DHAEKLHRGCTISNVVADSFSAASDILSLLGLFLAPVTAEGSLVLSATGLGLGVAATVT
FT                   DVATSIVEETSRVLDEVEAALTGTHVLGEAGTSVARIVNKIPQATRDITRDLEALEQHM
FT                   NALRLVRANPRLEEDARILATTGSISAQRAMQVRARLEGTPLAMSNEARIQRAATAGAA
FT                   LWSDVDSLVKESKHLYEGSASESAEALRKLARELEEKLEGLMEFYKTI"
FT   gene            complement(<27931268..27937186)
FT                   /locus_tag="mCG_13357"
FT                   /note="gene_id=mCG13357.2"
FT   mRNA            complement(join(<27931268..27932129,27934712..27934838,
FT                   27935157..27935221,27937101..27937186))
FT                   /locus_tag="mCG_13357"
FT                   /product="mCG13357"
FT                   /note="gene_id=mCG13357.2 transcript_id=mCT12271.1 created
FT                   on 19-NOV-2002"
FT   CDS             complement(join(27931268..27932129,27934712..27934838,
FT                   27935157..27935187))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13357"
FT                   /product="mCG13357"
FT                   /note="gene_id=mCG13357.2 transcript_id=mCT12271.1
FT                   protein_id=mCP10045.1"
FT                   /db_xref="GOA:A2VDH7"
FT                   /db_xref="InterPro:IPR008405"
FT                   /db_xref="MGI:MGI:2444921"
FT                   /db_xref="UniProtKB/TrEMBL:A2VDH7"
FT                   /protein_id="EDL29649.1"
FT                   /translation="MDPSDCEDAPGDRTFIEEAAEYLQHTSGREDLRLLLTEDGAWEAF
FT                   VAEAELSRADADTLRDALHALTANLAVEDQERLQRDLQDMERFMDAFPQVKLELEGHIG
FT                   KLRTLADKVDKVHRDCTISKLVAGSTSTVSGILTLLGLTLVPVTAGISLVLLATGMGLG
FT                   AAAAVTSVSSGIVDYTSRSLAKTEASHLVSTGMAKVKMVADAVVHSGPQVLSLSENCCR
FT                   VLRCIEQSIYAIKLTKANPALAASAMGSTSAQSGKHVKKAFKGTALAISRRARIMGIAT
FT                   AGVSLVGDVISLVKQSKNLHKGTKAKSAEELRQQARELEEKLEALIQMYEGLQAGSRR"
FT   gene            complement(27942501..>27995121)
FT                   /gene="Myh9"
FT                   /locus_tag="mCG_131134"
FT                   /note="gene_id=mCG131134.0"
FT   mRNA            complement(join(27942501..27943930,27944866..27945038,
FT                   27945136..27945244,27945706..27945914,27946214..27946337,
FT                   27946419..27946507,27947614..27947742,27948628..27948789,
FT                   27949045..27949257,27949365..27949577,27950706..27950954,
FT                   27951115..27951267,27951419..27951523,27951681..27951887,
FT                   27953039..27953183,27953738..27953950,27955186..27955357,
FT                   27955849..27955972,27956471..27956608,27956988..27957194,
FT                   27957717..27957848,27958805..27958913,27959682..27959842,
FT                   27961904..27961973,27963025..27963146,27963236..27963429,
FT                   27965303..27965417,27967007..27967180,27968401..27968574,
FT                   27969424..27969576,27970830..27970948,27971779..27971874,
FT                   27972615..27972758,27972959..27973057,27973627..27973690,
FT                   27974165..27974257,27977872..27977965,27978912..27978939,
FT                   27989779..27989935,27994789..>27995121))
FT                   /gene="Myh9"
FT                   /locus_tag="mCG_131134"
FT                   /product="myosin, heavy polypeptide 9, non-muscle"
FT                   /note="gene_id=mCG131134.0 transcript_id=mCT132463.1
FT                   created on 03-JAN-2003"
FT   CDS             complement(join(27943813..27943930,27944866..27945038,
FT                   27945136..27945244,27945706..27945914,27946214..27946337,
FT                   27946419..27946507,27947614..27947742,27948628..27948789,
FT                   27949045..27949257,27949365..27949577,27950706..27950954,
FT                   27951115..27951267,27951419..27951523,27951681..27951887,
FT                   27953039..27953183,27953738..27953950,27955186..27955357,
FT                   27955849..27955972,27956471..27956608,27956988..27957194,
FT                   27957717..27957848,27958805..27958913,27959682..27959842,
FT                   27961904..27961973,27963025..27963146,27963236..27963429,
FT                   27965303..27965417,27967007..27967180,27968401..27968574,
FT                   27969424..27969576,27970830..27970948,27971779..27971874,
FT                   27972615..27972758,27972959..27973057,27973627..27973690,
FT                   27974165..27974257,27977872..27977965,27978912..27978939,
FT                   27989779..27989935,27994789..27995121))
FT                   /codon_start=1
FT                   /gene="Myh9"
FT                   /locus_tag="mCG_131134"
FT                   /product="myosin, heavy polypeptide 9, non-muscle"
FT                   /note="gene_id=mCG131134.0 transcript_id=mCT132463.1
FT                   protein_id=mCP60547.1"
FT                   /protein_id="EDL29650.1"
FT                   /translation="MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSSKNGFEPAS
FT                   LKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKER
FT                   YYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQ
FT                   DREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFG
FT                   NAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLL
FT                   SGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLL
FT                   RVISGVLQLGNIAFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRD
FT                   YVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEI
FT                   FDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEK
FT                   PAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGK
FT                   VDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGA
FT                   FKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRC
FT                   NGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNL
FT                   YRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVL
FT                   QRNCAAYLRLRNWQWWRLFTKVKPLLNSIRHEDELLAKEAELTKVREKHLAAENRLTEM
FT                   ETMQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEER
FT                   CQYLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIIMEDQNCK
FT                   LAKEKKLLEDRVAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEK
FT                   TRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIR
FT                   ELETQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKRE
FT                   QEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEELADQLEQTKRVKATLEKAKQTLENE
FT                   RGELANEVKALLQGKGDSEHKRKKVEAQLQELQVKFSEGERVRTELADKVTKLQVELDS
FT                   VTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFRE
FT                   QLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQRLE
FT                   EKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKTISAKYA
FT                   EERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSV
FT                   HELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQ
FT                   SEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLKDLEAHIDTANKNREEAIK
FT                   QLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKR
FT                   QAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKAN
FT                   LQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESAVKSKYKASIAALEAK
FT                   IAQLEEQLDNETKERQAASKQVRRTEKKLKDVLLQVEDERRNAEQFKDQADKASTRLKQ
FT                   LKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVTRR
FT                   IVRKGTGDCSDEEVDGKADGADAKAAE"
FT   gene            complement(28089756..>28103703)
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /note="gene_id=mCG13339.3"
FT   mRNA            complement(join(28089756..28089802,28089882..28090565,
FT                   28099250..28099373,28102399..28102661,28103615..>28103665))
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, transcript variant mCT12745"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT12745.1 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(28089759..28090565,28099250..28099373,
FT                   28102399..28102661,28103615..>28103703))
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, transcript variant mCT192635"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT192635.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(28089778..28090558,28099246..28099355,
FT                   28102501..28102661,28103615..28103694))
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, transcript variant mCT172319"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT172319.0 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(28089897..28090057,28090548..28090565,
FT                   28099250..28099373,28102399..28102661,28103615..28103686))
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, transcript variant mCT172320"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT172320.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(28090004..28090057,28090548..28090565,
FT                   28099250..28099373,28102399..28102661))
FT                   /codon_start=1
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, isoform CRA_c"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT172320.0
FT                   protein_id=mCP95238.0 isoform=CRA_c"
FT                   /protein_id="EDL29654.1"
FT                   /translation="MAQRLLLGRFLTSVISRKPPQGVWASLTSKTLQTPQYNAGGLTVM
FT                   PSPARTVHTTRVCLTTFNVQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMV
FT                   AKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTPQPPCISLWHISSPASA"
FT   CDS             complement(join(28090452..28090565,28099250..28099373,
FT                   28102399..28102661,28103615..>28103662))
FT                   /codon_start=1
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, isoform CRA_a"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT12745.1
FT                   protein_id=mCP10040.1 isoform=CRA_a"
FT                   /protein_id="EDL29651.1"
FT                   /translation="RAGRLGSASLCSHCREMAQRLLLGRFLTSVISRKPPQGVWASLTS
FT                   KTLQTPQYNAGGLTVMPSPARTVHTTRVCLTTFNVQDGPDFQDRVVNSETPVVVDFHAQ
FT                   WCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDK
FT                   FVGIKDEDQLEAFLKKLIG"
FT   CDS             complement(join(28090452..28090565,28099250..28099373,
FT                   28102399..28102661,28103615..>28103662))
FT                   /codon_start=1
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, isoform CRA_a"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT192635.0
FT                   protein_id=mCP113556.0 isoform=CRA_a"
FT                   /protein_id="EDL29653.1"
FT                   /translation="RAGRLGSASLCSHCREMAQRLLLGRFLTSVISRKPPQGVWASLTS
FT                   KTLQTPQYNAGGLTVMPSPARTVHTTRVCLTTFNVQDGPDFQDRVVNSETPVVVDFHAQ
FT                   WCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDK
FT                   FVGIKDEDQLEAFLKKLIG"
FT   CDS             complement(join(28090452..28090558,28099246..28099355,
FT                   28102501..28102661))
FT                   /codon_start=1
FT                   /gene="Txn2"
FT                   /locus_tag="mCG_13339"
FT                   /product="thioredoxin 2, isoform CRA_b"
FT                   /note="gene_id=mCG13339.3 transcript_id=mCT172319.0
FT                   protein_id=mCP95239.0 isoform=CRA_b"
FT                   /protein_id="EDL29652.1"
FT                   /translation="MAQRLLLGRFLTSVISRKPPQGVWASLTSKTLQTPQYNAGGLTVM
FT                   PSPARTVHTILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVAVPTVLAIKNGDVV
FT                   DKFVGIKDEDQLEAFLKKLIG"
FT   gene            complement(28115231..28120596)
FT                   /locus_tag="mCG_147994"
FT                   /note="gene_id=mCG147994.0"
FT   mRNA            complement(join(28115231..28118099,28120286..28120596))
FT                   /locus_tag="mCG_147994"
FT                   /product="mCG147994"
FT                   /note="gene_id=mCG147994.0 transcript_id=mCT188257.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(28117867..28118099,28120286..28120448))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147994"
FT                   /product="mCG147994"
FT                   /note="gene_id=mCG147994.0 transcript_id=mCT188257.0
FT                   protein_id=mCP108958.0"
FT                   /db_xref="GOA:Q3TBC9"
FT                   /db_xref="MGI:MGI:106315"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBC9"
FT                   /protein_id="EDL29655.1"
FT                   /translation="MRFRPAQWPLPRPTAIHHIVEDFLTDWTAPVGHILPLRRFLENCL
FT                   DTDLRSFYAESCFLFTLTRQRLPPFCQQGYLRMQGLSSTKSLWQHGVESRLLQDYTAME
FT                   NSNRWLGDHSTAPEPLTQSLDSNKEEL"
FT   gene            complement(28127460..28131391)
FT                   /locus_tag="mCG_147995"
FT                   /note="gene_id=mCG147995.0"
FT   mRNA            complement(join(28127460..28128241,28130296..28131391))
FT                   /locus_tag="mCG_147995"
FT                   /product="mCG147995"
FT                   /note="gene_id=mCG147995.0 transcript_id=mCT188258.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(28127986..28128241,28130296..28130795))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147995"
FT                   /product="mCG147995"
FT                   /note="gene_id=mCG147995.0 transcript_id=mCT188258.0
FT                   protein_id=mCP108959.0"
FT                   /protein_id="EDL29656.1"
FT                   /translation="MGPSGLLVALALHLAVCSRPHRDYCVLGAGPAGLQMAAFLHRAGR
FT                   DYEVFERESAPGSFFTRYPRHRKLISINKRHTGKANAEFNLRHDWNSLLSDDPHLLFRH
FT                   YSQAYFPDASDMVRYLGDFARRLGLHVLYNTNITHVTLDKDPQAWNGHYFILTDQKGQV
FT                   YQCSVLLVATGLAVPKLVDFPGSEYVEGYESVSVDPEDFVGQNVLILGHGNSAFETAEN
FT                   ILGVTNFVHMLSRSRVRLSWATHYVGDVR"
FT   gene            complement(<28133708..28145500)
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /note="gene_id=mCG13340.2"
FT   mRNA            complement(join(28133708..28133829,28134219..28134502,
FT                   28134661..28134803,28136321..28136450,28136553..28136638,
FT                   28137147..28137277,28137885..28137931,28138745..28138859,
FT                   28139610..28139722,28140845..28140917,28141389..28141474,
FT                   28142010..28142146,28142883..28142928,28143164..28143296,
FT                   28145390..28145500))
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), transcript variant mCT172322"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT172322.0 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(28133708..28133829,28134219..28134502,
FT                   28134661..28134803,28136321..28136450,28136553..28136638,
FT                   28137147..28137277,28137885..28138032,28138727..28138859,
FT                   28139610..28139722,28140845..28140917,28141389..28141474,
FT                   28142010..28142146,28142883..28142928,28143164..28143296,
FT                   28145390..>28145476))
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), transcript variant mCT12747"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT12747.0 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(<28133708..28133754,28137991..28138032,
FT                   28138727..28138859,28139610..28139722,28140845..28140917,
FT                   28141389..28141474,28142010..28142146,28142883..28142928,
FT                   28143164..28143296,28145390..28145463))
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), transcript variant mCT172321"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT172321.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(<28133708..28133754,28137991..28138032,
FT                   28138727..28138859,28139610..28139722,28140845..28140917,
FT                   28141389..28141474,28142010..28142146,28142883..28142928,
FT                   28143164..28143286))
FT                   /codon_start=1
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), isoform CRA_a"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT172321.0
FT                   protein_id=mCP95241.0 isoform=CRA_a"
FT                   /protein_id="EDL29657.1"
FT                   /translation="MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADW
FT                   TGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRN
FT                   LRRDKDRRNMVQFNLQTLPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVE
FT                   VRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKR
FT                   IFHTVTTTDDPVIRKLAKTQGNVFATDAILLFSSRGNKISFPLVS"
FT   CDS             complement(join(28133816..28133829,28134219..28134502,
FT                   28134661..28134803,28136321..28136450,28136553..28136638,
FT                   28137147..28137277,28137885..28138032,28138727..28138859,
FT                   28139610..28139722,28140845..28140917,28141389..28141474,
FT                   28142010..28142146,28142883..28142928,28143164..>28143289))
FT                   /codon_start=1
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), isoform CRA_c"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT12747.0
FT                   protein_id=mCP10042.0 isoform=CRA_c"
FT                   /protein_id="EDL29659.1"
FT                   /translation="KMAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVAD
FT                   WTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQR
FT                   NLRRDKDRRNMVQFNLQTLPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSV
FT                   EVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIK
FT                   RIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDK
FT                   RDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGRERYNFPN
FT                   PNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNE
FT                   WDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHV
FT                   KDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQV
FT                   IRVYSLPDGTFSSEEDEEDEEEEEEEEEEEET"
FT   CDS             complement(join(28137920..28137931,28138745..28138859,
FT                   28139610..28139722,28140845..28140917,28141389..28141474,
FT                   28142010..28142146,28142883..28142928,28143164..28143286))
FT                   /codon_start=1
FT                   /gene="Eif3s7"
FT                   /locus_tag="mCG_13340"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 7 (zeta), isoform CRA_b"
FT                   /note="gene_id=mCG13340.2 transcript_id=mCT172322.0
FT                   protein_id=mCP95240.0 isoform=CRA_b"
FT                   /protein_id="EDL29658.1"
FT                   /translation="MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADW
FT                   TGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRN
FT                   LRRDKDRRNMVQFNLQTLPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVE
FT                   VRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKR
FT                   IFHTVTTTDSRL"
FT   gene            complement(28169543..>28296493)
FT                   /gene="Cacng2"
FT                   /locus_tag="mCG_123783"
FT                   /note="gene_id=mCG123783.2"
FT   mRNA            complement(join(28169543..28170396,28171563..28171703,
FT                   28188013..28188096,28295146..>28296493))
FT                   /gene="Cacng2"
FT                   /locus_tag="mCG_123783"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   2, transcript variant mCT192594"
FT                   /note="gene_id=mCG123783.2 transcript_id=mCT192594.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(28169668..28170396,28171563..28171703,
FT                   28188013..28188103,28295141..28295745))
FT                   /gene="Cacng2"
FT                   /locus_tag="mCG_123783"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   2, transcript variant mCT125006"
FT                   /note="gene_id=mCG123783.2 transcript_id=mCT125006.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(28169861..28170396,28171563..28171703,
FT                   28188013..28188096,28295146..>28295362))
FT                   /codon_start=1
FT                   /gene="Cacng2"
FT                   /locus_tag="mCG_123783"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG123783.2 transcript_id=mCT192594.0
FT                   protein_id=mCP113555.0 isoform=CRA_a"
FT                   /protein_id="EDL29660.1"
FT                   /translation="RIMGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTK
FT                   SVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVR
FT                   ASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANA
FT                   GDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQA
FT                   SAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLK
FT                   AATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV"
FT   CDS             complement(join(28169861..28170396,28171563..28171703,
FT                   28188013..28188103,28295141..28295356))
FT                   /codon_start=1
FT                   /gene="Cacng2"
FT                   /locus_tag="mCG_123783"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG123783.2 transcript_id=mCT125006.1
FT                   protein_id=mCP60589.1 isoform=CRA_b"
FT                   /protein_id="EDL29661.1"
FT                   /translation="MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSV
FT                   SENETSKKNEEVMTHSGLWRTCCLEGILAGNFKGLCKQIDHFPEDADYEADTAEYFLRA
FT                   VRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISA
FT                   NAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYL
FT                   QASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDP
FT                   LKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV"
FT   gap             28283390..28284698
FT                   /estimated_length=1309
FT   gene            28296169..28320613
FT                   /locus_tag="mCG_148006"
FT                   /note="gene_id=mCG148006.0"
FT   mRNA            join(28296169..28296885,28319204..28320613)
FT                   /locus_tag="mCG_148006"
FT                   /product="mCG148006"
FT                   /note="gene_id=mCG148006.0 transcript_id=mCT188269.0
FT                   created on 13-JAN-2004"
FT   CDS             join(28296637..28296885,28319204..28319224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148006"
FT                   /product="mCG148006"
FT                   /note="gene_id=mCG148006.0 transcript_id=mCT188269.0
FT                   protein_id=mCP108970.0"
FT                   /protein_id="EDL29662.1"
FT                   /translation="MSAGRGLLELGGRRSWRSLSLSLSLSLSLSLSLLFPPPLVFLPVQ
FT                   PPSHSISTCPELQIQSSHHSQIPTKLQSAASPGREPGWNSRHPR"
FT   gene            complement(28335837..28350489)
FT                   /gene="Rabl4"
FT                   /locus_tag="mCG_13338"
FT                   /note="gene_id=mCG13338.1"
FT   mRNA            complement(join(28335837..28336086,28340566..28340675,
FT                   28341523..28341640,28342351..28342410,28343446..28343505,
FT                   28344299..28344378,28350152..28350489))
FT                   /gene="Rabl4"
FT                   /locus_tag="mCG_13338"
FT                   /product="RAB, member of RAS oncogene family-like 4"
FT                   /note="gene_id=mCG13338.1 transcript_id=mCT12746.2 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(28335988..28336086,28340566..28340675,
FT                   28341523..28341640,28342351..28342410,28343446..28343505,
FT                   28344299..28344378,28350152..28350185))
FT                   /codon_start=1
FT                   /gene="Rabl4"
FT                   /locus_tag="mCG_13338"
FT                   /product="RAB, member of RAS oncogene family-like 4"
FT                   /note="gene_id=mCG13338.1 transcript_id=mCT12746.2
FT                   protein_id=mCP10031.1"
FT                   /protein_id="EDL29663.1"
FT                   /translation="MVKLAAKCILAGDPAVGKTALVQMFRSDGTHFQKNYTLTTGVDLV
FT                   VKTVPVLDTNDSVELFIFDSAGKELFSEMLDKLWENPNVLCLVYDVTNEQSFISCTKWL
FT                   EKVRSQTSGISLPGVLVGTKTDLAGRQTVDSAQAQVWALSQGLEFFETSVKEMDNYEAP
FT                   FHCLAKQFYQLYREKVDIFHTLV"
FT   gene            complement(28367515..28382783)
FT                   /gene="Pvalb"
FT                   /locus_tag="mCG_13345"
FT                   /note="gene_id=mCG13345.2"
FT   mRNA            complement(join(28367515..28368082,28377624..28377733,
FT                   28378919..28379051,28380483..28380550,28382735..28382783))
FT                   /gene="Pvalb"
FT                   /locus_tag="mCG_13345"
FT                   /product="parvalbumin, transcript variant mCT12531"
FT                   /note="gene_id=mCG13345.2 transcript_id=mCT12531.2 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(28367515..28368037,28377628..28377733,
FT                   28378919..28379051,28380483..28380550,28382735..28382775))
FT                   /gene="Pvalb"
FT                   /locus_tag="mCG_13345"
FT                   /product="parvalbumin, transcript variant mCT172325"
FT                   /note="gene_id=mCG13345.2 transcript_id=mCT172325.0 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(28367918..28368037,28377628..28377733,
FT                   28378919..28379051,28380483..28380543))
FT                   /codon_start=1
FT                   /gene="Pvalb"
FT                   /locus_tag="mCG_13345"
FT                   /product="parvalbumin, isoform CRA_b"
FT                   /note="gene_id=mCG13345.2 transcript_id=mCT172325.0
FT                   protein_id=mCP95244.0 isoform=CRA_b"
FT                   /protein_id="EDL29665.1"
FT                   /translation="MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVK
FT                   KVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVGSPT
FT                   SPSPTPHLSPSRGPPEFLFSLFVLFFTPPSSMALG"
FT   CDS             complement(join(28368054..28368082,28377624..28377733,
FT                   28378919..28379051,28380483..28380543))
FT                   /codon_start=1
FT                   /gene="Pvalb"
FT                   /locus_tag="mCG_13345"
FT                   /product="parvalbumin, isoform CRA_a"
FT                   /note="gene_id=mCG13345.2 transcript_id=mCT12531.2
FT                   protein_id=mCP10078.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q545M7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008080"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:97821"
FT                   /db_xref="UniProtKB/TrEMBL:Q545M7"
FT                   /protein_id="EDL29664.1"
FT                   /translation="MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVK
FT                   KVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFS
FT                   TLVAES"
FT   gene            28421197..28438964
FT                   /gene="Ncf4"
FT                   /locus_tag="mCG_13347"
FT                   /note="gene_id=mCG13347.2"
FT   mRNA            join(28421197..28421249,28421428..28421461,
FT                   28426772..28426856,28427252..28427405,28429687..28429757,
FT                   28431177..28431251,28431842..28431899,28432321..28432419,
FT                   28437014..28437144,28437362..28437427,28438586..28438964)
FT                   /gene="Ncf4"
FT                   /locus_tag="mCG_13347"
FT                   /product="neutrophil cytosolic factor 4, transcript variant
FT                   mCT172326"
FT                   /note="gene_id=mCG13347.2 transcript_id=mCT172326.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(28421208..28421461,28426772..28426856,
FT                   28427252..28427405,28429687..28429757,28431177..28431304,
FT                   28431842..28431899,28432321..28432419,28437014..28437144,
FT                   28437362..28437427,28438586..28438964)
FT                   /gene="Ncf4"
FT                   /locus_tag="mCG_13347"
FT                   /product="neutrophil cytosolic factor 4, transcript variant
FT                   mCT12533"
FT                   /note="gene_id=mCG13347.2 transcript_id=mCT12533.1 created
FT                   on 20-AUG-2002"
FT   CDS             join(28421430..28421461,28426772..28426856,
FT                   28427252..28427405,28429687..28429757,28431177..28431304,
FT                   28431842..28431899,28432321..28432419,28437014..28437144,
FT                   28437362..28437427,28438586..28438781)
FT                   /codon_start=1
FT                   /gene="Ncf4"
FT                   /locus_tag="mCG_13347"
FT                   /product="neutrophil cytosolic factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG13347.2 transcript_id=mCT12533.1
FT                   protein_id=mCP10093.2 isoform=CRA_a"
FT                   /db_xref="GOA:P97369"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000919"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="MGI:MGI:109186"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97369"
FT                   /protein_id="EDL29666.1"
FT                   /translation="MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEV
FT                   KTKGGSKYLIYRRYRQFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAET
FT                   RIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVSPQ
FT                   GAIMDRMEAPR