
ID   CH466543; SV 2; linear; genomic DNA; CON; MUS; 33498426 BP.
AC   CH466543;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
DE   Mus musculus 232000009749938 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
RN   [1]
RP   1-33498426
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-33498426
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-33498426
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 1fe0d5e2f9580697326ec36e6883cc61.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000215.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001741; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025724; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025789; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030509; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030532; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030541; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030543; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030562; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030605; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030606; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030615; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038943; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042659; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043831; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051451; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061549; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063801; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091006; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032348; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032352; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032357; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032358; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032359; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032364; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032371; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032379; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032384; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032387; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032393; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032397; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032399; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032402; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032404; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032410; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032412; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032414; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032418; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032430; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032444; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032450; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032461; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032462; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032471; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032472; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032473; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032474; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032478; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032479; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032481; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032483; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032489; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032492; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032493; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032494; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032500; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032504; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032507; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032508; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032513; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032514; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032890; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032327; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032331; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032336; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032337; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032338; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032343; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032350; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032358; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032363; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032366; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032372; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032376; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032378; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032383; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032389; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032391; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032393; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032397; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032409; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032422; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032440; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032442; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032445; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032448; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032451; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032452; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032453; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032456; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032463; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032464; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032466; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032467; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032468; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032474; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032478; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032481; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032482; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032487; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032488; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032873; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032245; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032263; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032268; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032272; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032273; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032274; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032286; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032294; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032297; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032299; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032302; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032308; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032312; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032314; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032317; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032319; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032325; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032327; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032329; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032333; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032345; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032350; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032358; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032364; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032376; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032377; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032379; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032382; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032383; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032384; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032385; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032388; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032389; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032390; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032393; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032399; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032400; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032403; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032404; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032410; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032414; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032417; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032418; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032423; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032424; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032805; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032321; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032339; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032343; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032344; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032348; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032350; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032355; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032362; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032370; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032373; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032375; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032384; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032388; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032390; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032393; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032395; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032403; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032405; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032409; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032421; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032434; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032440; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032451; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032452; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032455; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032458; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032459; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032460; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032461; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032464; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032465; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032466; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032469; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032474; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032475; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032478; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032479; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032485; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032489; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032492; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032493; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032498; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032878; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032034; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032052; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032056; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032057; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032061; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032062; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032063; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032068; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032075; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032083; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032088; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032091; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032097; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032103; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032106; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032108; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032114; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032141; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032148; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032154; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032166; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032168; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032171; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032173; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032174; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032178; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032181; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032183; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032189; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032190; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032192; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032193; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032204; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032207; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032208; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032213; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032214; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032814; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032835; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032836; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032840; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032841; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032842; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032847; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032862; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032867; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032880; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032882; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032885; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032887; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032893; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032895; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032897; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032913; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032917; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032925; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032931; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032944; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032946; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032950; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032952; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032955; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032956; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032957; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032958; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032961; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032963; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032967; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032972; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032973; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032975; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032976; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032977; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032983; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032987; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032990; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032991; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032996; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032997; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031363; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031381; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031384; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031385; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031389; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031390; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031391; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031403; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031411; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031414; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031416; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031419; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031425; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031429; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031431; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031434; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031436; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031444; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031446; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031450; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031462; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031467; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031475; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031481; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031491; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031492; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031493; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031498; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031499; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031500; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031501; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031504; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031505; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031509; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031516; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031517; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031520; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031521; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031527; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031531; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031534; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031535; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031540; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031541; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032000; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032018; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032022; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032027; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032029; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032034; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032041; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032049; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032052; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032054; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032057; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032063; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032067; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032074; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032080; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032082; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032084; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032088; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032100; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032105; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032113; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032119; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032130; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032131; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032132; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032134; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032137; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032138; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032139; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032140; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032143; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032144; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032145; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032149; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032155; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032156; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032159; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032160; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032161; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032167; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032171; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032175; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032180; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032181; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032561; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032174; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032177; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032178; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032183; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032184; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032204; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032207; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032209; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032212; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032218; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032222; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032224; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032229; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032235; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032237; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032239; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032255; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032260; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032268; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032274; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032285; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032287; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032290; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032292; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032293; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032296; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032297; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032299; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032301; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032308; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032309; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032311; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032312; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032313; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032323; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032326; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032327; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032332; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032110; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032128; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032132; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032137; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032138; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032139; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032144; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032151; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032159; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032162; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032167; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032173; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032177; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032182; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032184; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032190; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032192; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032210; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032214; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032222; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032228; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032239; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032244; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032245; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032248; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032249; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032250; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032251; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032254; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032255; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032259; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032264; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032265; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032267; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032268; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032269; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032279; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032282; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032283; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032289; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032666; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032236; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032254; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032258; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032259; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032263; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032265; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032270; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032277; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032285; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032288; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032293; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032299; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032305; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032308; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032310; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032316; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032318; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032320; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032336; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032355; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032366; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032368; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032376; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032379; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032380; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032381; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032382; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032386; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032390; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032391; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032397; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032398; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032401; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032402; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032412; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032415; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032416; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032421; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032422; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032807; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032147; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032165; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032169; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032170; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032174; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032175; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032176; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032181; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032188; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032196; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032199; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032201; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032204; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032210; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032214; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032216; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032219; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032227; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032229; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032235; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032247; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032251; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032259; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032278; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032281; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032282; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032283; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032287; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032288; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032301; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032302; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032303; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032309; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032313; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032316; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032322; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032323; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032698; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032831; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032849; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032853; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032854; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032858; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032859; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032860; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032865; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032883; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032885; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032894; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032898; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032900; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032905; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032911; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032913; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032919; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032931; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032937; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032951; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032964; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032968; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032973; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032976; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032977; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032978; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032979; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032982; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032983; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032984; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032986; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032988; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032994; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032995; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032997; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032998; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032999; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033009; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033012; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033013; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033018; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033019; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031083; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031101; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031104; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031105; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031109; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031110; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031111; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031136; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031139; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031145; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031149; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031154; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031156; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031162; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031164; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031166; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031170; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031182; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031187; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031195; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031201; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031213; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031214; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031217; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031218; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031219; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031220; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031223; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031224; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031228; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031235; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031237; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031238; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031239; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031245; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031249; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031252; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031253; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031258; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031259; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031624; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031481; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031499; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031502; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031503; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031507; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031508; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031509; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031514; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031521; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031529; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031532; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031534; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031537; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031543; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031547; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031549; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031552; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031554; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031560; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031562; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031564; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031568; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031580; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031584; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031592; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031598; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031616; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031617; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031618; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031621; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031622; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031626; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031633; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031634; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031636; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031637; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031638; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031644; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031648; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031651; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031652; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031657; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032029; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098346; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171213; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191035; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206084; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207871; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208698; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084199; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084299; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084313; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084318; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084342; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084344; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084352; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084382; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084416; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084466; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084490; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084506; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084554; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084567; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084579; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084590; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084647; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084662; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084696; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084763; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084773; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084805; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084823; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084857; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084858; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084864; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084867; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084869; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084870; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084871; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084874; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084875; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084881; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084888; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084896; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084900; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084906; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084907; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084937; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084953; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084978; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084981; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086046; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084275; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084375; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084389; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084418; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084428; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084458; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084492; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084540; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084556; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084645; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084651; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084662; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084686; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084719; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084734; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084768; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084835; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084844; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084876; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084894; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084929; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084931; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084936; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084937; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084938; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084941; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084943; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084946; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084954; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084962; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084966; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084971; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084972; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0085002; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0085014; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0085020; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0085045; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0085048; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0086128; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084224; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084324; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084338; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084343; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084367; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084369; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084440; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084488; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084504; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084528; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084574; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084587; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084594; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084600; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084611; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084635; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084669; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084684; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084718; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084786; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084827; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084845; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084880; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084883; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084886; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084888; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084893; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084894; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084895; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084898; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084905; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084913; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084918; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084924; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084943; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084953; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084965; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084969; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084994; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084997; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0086066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084248; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084347; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084361; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084366; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084390; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084392; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084400; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084429; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084510; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084526; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084534; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084550; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084609; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084616; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084622; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084633; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084657; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084690; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084705; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084739; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084806; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084816; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084848; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084866; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084900; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084901; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084902; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084904; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084907; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084909; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084910; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084911; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084914; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084915; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084916; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084919; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084925; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084933; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084944; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084945; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084974; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084986; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085017; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085020; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083821; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083919; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083933; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083938; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083962; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083964; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083999; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084033; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084081; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084097; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084105; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084121; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084168; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084181; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084188; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084205; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084229; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084278; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084312; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084379; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084390; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084421; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084439; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084473; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084476; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084479; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084481; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084482; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084483; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084487; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084488; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084490; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084493; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084500; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084508; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084518; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084537; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084547; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084559; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084563; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084588; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084591; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085652; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084744; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084843; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084856; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084861; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084885; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084887; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084895; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084925; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084959; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085009; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085025; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085033; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085096; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085109; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085116; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085124; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085134; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085158; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085192; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085208; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085242; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085314; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085346; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085364; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085398; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085400; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085402; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085406; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085408; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085411; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085413; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085415; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085418; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085419; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085420; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085424; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085430; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085439; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085445; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085450; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085451; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085471; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085481; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085492; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085498; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085522; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085525; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084335; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084437; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084455; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084479; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084481; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084489; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084556; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084603; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084627; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084642; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084688; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084701; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084707; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084714; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084774; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084823; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084932; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084951; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084985; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084986; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084987; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084992; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084994; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084995; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084996; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084999; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085000; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085004; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085013; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085021; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085031; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085032; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085048; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085059; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085071; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085076; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085101; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085105; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086170; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083762; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083861; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083875; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083880; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083904; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083906; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083914; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083944; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083978; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084026; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084042; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084050; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084113; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084126; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084133; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084139; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084150; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084174; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084207; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084222; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084253; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084317; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084355; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084373; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084408; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084409; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084410; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084412; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084415; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084417; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084418; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084419; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084422; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084424; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084428; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084436; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084444; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084449; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084454; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084455; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084474; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084484; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084496; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084502; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084525; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0084528; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0085591; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083946; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084044; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084057; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084062; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084087; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084089; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084097; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084127; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084161; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084209; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084249; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084296; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084309; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084316; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084322; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084333; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084390; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084405; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084439; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084507; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084516; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084548; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084566; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084600; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084602; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084605; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084607; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084608; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084609; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084613; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084614; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084618; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084634; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084640; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084646; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084665; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084675; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084687; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084691; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084716; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0084719; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0085787; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083803; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083903; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083917; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083921; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083945; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083947; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083955; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083984; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084018; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084068; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084084; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084092; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084108; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084155; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084168; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084175; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084181; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084192; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084216; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084249; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084264; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084296; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084363; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084404; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084422; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084461; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084465; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084467; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084468; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084469; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084472; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084473; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084474; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084477; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084483; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084491; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084500; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084501; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084519; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084541; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084547; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084573; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0084576; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0085631; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083964; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084082; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084106; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084108; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084116; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084145; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084179; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084229; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084245; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084253; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084269; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084316; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084329; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084342; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084353; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084377; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084459; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084527; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084537; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084569; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084587; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084622; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084624; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084632; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084637; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084638; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084639; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084642; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084643; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084648; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084657; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084665; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084669; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084674; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084675; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084704; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084722; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0084750; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0085827; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083848; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083947; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083961; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083966; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083990; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083992; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084000; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084030; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084063; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084113; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084129; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084137; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084153; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084200; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084213; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084219; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084225; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084260; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084293; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084308; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084342; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084410; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084450; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084468; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084504; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084507; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084509; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084511; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084515; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084519; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084536; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084545; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084546; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084565; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084576; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084588; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084592; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084617; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084620; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085672; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085020; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085120; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085139; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085163; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085165; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085203; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085237; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085287; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085303; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085311; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085327; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085374; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085387; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085393; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085399; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085410; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085434; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085468; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085517; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085584; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085595; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085627; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085645; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085681; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085685; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085688; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085690; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085693; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085696; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085697; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085700; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085701; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085704; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085707; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085714; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085722; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085731; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085732; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085751; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085773; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085777; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085802; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085805; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083750; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083851; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083864; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083869; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083894; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083896; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083904; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083936; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084037; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084045; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084060; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084107; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084120; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084132; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084143; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084167; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084200; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084215; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084249; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084318; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084327; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084359; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084378; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084414; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084415; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084418; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084420; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084421; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084422; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084425; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084426; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084430; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084438; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084446; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084450; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084456; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084457; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084475; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084487; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084499; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084505; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084530; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084533; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085580; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082875; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082974; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082987; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082992; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083017; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083019; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083057; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083091; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083139; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083155; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083163; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083178; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083224; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083237; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083243; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083249; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083260; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083284; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083317; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083332; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083366; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083433; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083439; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083471; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083524; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083529; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083531; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083532; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083533; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083536; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083537; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083538; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083541; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083550; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083558; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083562; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083567; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083568; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083587; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083597; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083609; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083614; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083639; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083642; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084695; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   On Sep 6, 2005 this sequence version replaced gi:70980437.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..33498426
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    6873..10725
FT                   /estimated_length=3853
FT                   /gap_type="unknown"
FT   assembly_gap    28478..28954
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    54834..54853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    72922..72941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    76046..77611
FT                   /estimated_length=1566
FT                   /gap_type="unknown"
FT   assembly_gap    86046..86126
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    111436..115808
FT                   /estimated_length=4373
FT                   /gap_type="unknown"
FT   gene            complement(116685..117795)
FT                   /pseudo
FT                   /locus_tag="mCG_1028267"
FT                   /note="gene_id=mCG1028267.1"
FT   mRNA            complement(116685..117795)
FT                   /pseudo
FT                   /locus_tag="mCG_1028267"
FT                   /note="gene_id=mCG1028267.1 transcript_id=mCT145971.1
FT                   created on 25-NOV-2002"
FT   assembly_gap    118910..118929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    119975..119994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    132640..132659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    135760..136108
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    181476..181495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    200164..202510
FT                   /estimated_length=2347
FT                   /gap_type="unknown"
FT   assembly_gap    203815..204222
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    233376..233395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    274577..276539
FT                   /estimated_length=1963
FT                   /gap_type="unknown"
FT   assembly_gap    281555..281625
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    291653..291672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    308484..308503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    339531..339550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    340702..340721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    341761..341780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    343422..343650
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    348652..348671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    357320..357498
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    370601..370620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    373316..373335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    397810..397829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403518..403537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    408847..408866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    410049..410068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    411469..411488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    413065..413084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    419694..420184
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    431128..431147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    440154..440890
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    442214..442233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    443668..443687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    445230..445249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    471484..471503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    472643..472662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    475114..475133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    484398..484945
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    499334..499936
FT                   /estimated_length=603
FT                   /gap_type="unknown"
FT   assembly_gap    501012..501031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    503163..503330
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    506232..506251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    514689..514753
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    526308..526680
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    534245..534264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    539687..539706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(550377..667973)
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /note="gene_id=mCG11830.2"
FT   mRNA            complement(join(550377..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,614040..614084,
FT                   667510..667649,667824..667920))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT173467"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173467.0 created
FT                   on 13-SEP-2002"
FT   mRNA            complement(join(550620..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,607328..607372,
FT                   667510..667649,667824..667928))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT12092"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT12092.1 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(550909..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,607328..607372,
FT                   667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_c"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT12092.1
FT                   protein_id=mCP17333.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q53YJ9"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YJ9"
FT                   /protein_id="EDL07273.1"
FT   CDS             complement(join(550909..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,614040..614084,
FT                   667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_a"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173467.0
FT                   protein_id=mCP96386.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q53YJ9"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YJ9"
FT                   /protein_id="EDL07271.1"
FT   assembly_gap    575023..575042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    588058..588077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(593251..593471,600227..600336,
FT                   607328..607372,667510..667649,667824..667973))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT173468"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173468.0 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(593384..593471,600227..600336,
FT                   607328..607372,667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_b"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173468.0
FT                   protein_id=mCP96387.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CC01"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CC01"
FT                   /protein_id="EDL07272.1"
FT   assembly_gap    604631..604650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    606597..606616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    609162..609181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    610450..610469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    613307..613326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    619336..619355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    624481..624500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    659703..659722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    688162..688332
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    695984..700340
FT                   /estimated_length=4357
FT                   /gap_type="unknown"
FT   assembly_gap    728344..733151
FT                   /estimated_length=4808
FT                   /gap_type="unknown"
FT   assembly_gap    749572..749591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    764324..764630
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    765675..765694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    768533..768552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    794656..794675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(804350..893710)
FT                   /locus_tag="mCG_67596"
FT                   /note="gene_id=mCG67596.1"
FT   mRNA            complement(join(804350..804719,807545..807718,
FT                   809689..809743,864078..864253,866575..866720,
FT                   876036..876152,877500..877720,881975..882078,
FT                   892361..892570,892744..893710))
FT                   /locus_tag="mCG_67596"
FT                   /product="mCG67596"
FT                   /note="gene_id=mCG67596.1 transcript_id=mCT67779.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(807662..807718,809689..809743,
FT                   864078..864229))
FT                   /codon_start=1
FT                   /locus_tag="mCG_67596"
FT                   /product="mCG67596"
FT                   /note="gene_id=mCG67596.1 transcript_id=mCT67779.1
FT                   protein_id=mCP38088.2"
FT                   /protein_id="EDL07270.1"
FT   assembly_gap    821242..821261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    822592..822611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    823955..823974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    826003..826022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    833954..833973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    835496..835515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    846890..847219
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    852550..856925
FT                   /estimated_length=4376
FT                   /gap_type="unknown"
FT   assembly_gap    858976..858995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    862109..862128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    867241..867260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    868588..868607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    869738..872501
FT                   /estimated_length=2764
FT                   /gap_type="unknown"
FT   assembly_gap    873640..873659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    891363..891382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            893953..1211138
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /note="gene_id=mCG11831.2"
FT   mRNA            join(893953..894108,1063413..1063542,1104412..1104505,
FT                   1105618..1105772,1140199..1140381,1151828..1152049,
FT                   1179930..1180031,1181570..1181697,1182321..1182415,
FT                   1186171..1186298,1188306..1188455,1206675..1206789,
FT                   1206969..1207053,1209363..1210097,1210201..1211138)
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /product="OTU domain containing 7A"
FT                   /note="gene_id=mCG11831.2 transcript_id=mCT12093.3 created
FT                   on 19-MAR-2004"
FT   assembly_gap    896747..896766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    953352..953371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    977762..977781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    979520..979539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    981744..981763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    993006..993025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    994253..994272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    995754..999154
FT                   /estimated_length=3401
FT                   /gap_type="unknown"
FT   assembly_gap    1009897..1010223
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    1011659..1011678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1025953..1025980
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1050276..1050295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1052292..1052595
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    1053903..1053967
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    1060383..1060821
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    1075680..1075699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1077275..1077294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1080542..1080812
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    1083506..1083525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1085230..1085249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1086569..1086588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1087599..1087618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1088786..1088805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1090933..1090952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1092282..1093559
FT                   /estimated_length=1278
FT                   /gap_type="unknown"
FT   assembly_gap    1098439..1098458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1105622..1105772,1140199..1140381,1151828..1152049,
FT                   1179930..1180031,1181570..1181697,1182321..1182415,
FT                   1186171..1186298,1188306..1188455,1206675..1206789,
FT                   1206969..1207053,1209363..1210097,1210201..1210842)
FT                   /codon_start=1
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /product="OTU domain containing 7A"
FT                   /note="gene_id=mCG11831.2 transcript_id=mCT12093.3
FT                   protein_id=mCP17344.3"
FT                   /protein_id="EDL07269.1"
FT   assembly_gap    1116103..1116122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1117863..1118437
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    1119966..1120132
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    1121333..1121951
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    1155923..1155942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1172173..1172192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1173605..1173624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1174950..1174969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1177031..1177050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1210098..1210200
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1217845..1217864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1220088..1220208
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1227472..1227491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1252412..1252431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1336488..1384445)
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /note="gene_id=mCG123556.1"
FT   mRNA            complement(join(1336488..1336888,1381826..>1381897))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT173469"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173469.0
FT                   created on 13-SEP-2002"
FT   mRNA            complement(join(1336491..1336888,1369700..>1369901))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT173470"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173470.0
FT                   created on 13-SEP-2002"
FT   mRNA            complement(join(<1336599..1336888,1383563..1384445))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT124789"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT124789.0
FT                   created on 13-SEP-2002"
FT   CDS             complement(join(1336599..1336888,1383563..1384142))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_a"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT124789.0
FT                   protein_id=mCP89016.1 isoform=CRA_a"
FT                   /protein_id="EDL07265.1"
FT                   TISPASSP"
FT   CDS             complement(join(1336599..1336888,1381826..>1381871))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_b"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173469.0
FT                   protein_id=mCP96389.0 isoform=CRA_b"
FT                   /protein_id="EDL07266.1"
FT                   ISPASSP"
FT   CDS             complement(join(1336599..1336888,1369700..>1369790))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_c"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173470.0
FT                   protein_id=mCP96388.0 isoform=CRA_c"
FT                   /protein_id="EDL07267.1"
FT   gene            <1361894..1365576
FT                   /locus_tag="mCG_145072"
FT                   /note="gene_id=mCG145072.0"
FT   mRNA            join(<1361894..1362132,1364277..1364465,1364990..1365576)
FT                   /locus_tag="mCG_145072"
FT                   /product="mCG145072"
FT                   /note="gene_id=mCG145072.0 transcript_id=mCT184496.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1362069..1362132,1364277..1364465,1364990..1365108)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145072"
FT                   /product="mCG145072"
FT                   /note="gene_id=mCG145072.0 transcript_id=mCT184496.0
FT                   protein_id=mCP106151.0"
FT                   /protein_id="EDL07268.1"
FT   assembly_gap    1373772..1373791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1377532..1377761
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            <1407846..1413338
FT                   /locus_tag="mCG_1028452"
FT                   /note="gene_id=mCG1028452.0"
FT   mRNA            join(<1407846..1407929,1411895..1411978,1413110..1413338)
FT                   /locus_tag="mCG_1028452"
FT                   /product="mCG1028452"
FT                   /note="gene_id=mCG1028452.0 transcript_id=mCT146156.0
FT                   created on 25-NOV-2002"
FT   CDS             join(<1407910..1407929,1411895..1411978,1413110..1413290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028452"
FT                   /product="mCG1028452"
FT                   /note="gene_id=mCG1028452.0 transcript_id=mCT146156.0
FT                   protein_id=mCP88924.0"
FT                   /protein_id="EDL07264.1"
FT   assembly_gap    1420643..1420758
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    1431545..1431610
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    1437612..1437779
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1448978..1448997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1453623..1466682
FT                   /locus_tag="mCG_123560"
FT                   /note="gene_id=mCG123560.0"
FT   mRNA            join(<1453623..1453704,1457503..1457635,1464586..1464710,
FT                   1466561..1466682)
FT                   /locus_tag="mCG_123560"
FT                   /product="mCG123560"
FT                   /note="gene_id=mCG123560.0 transcript_id=mCT124793.1
FT                   created on 25-NOV-2002"
FT   CDS             join(<1457571..1457635,1464586..1464710,1466561..1466601)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123560"
FT                   /product="mCG123560"
FT                   /note="gene_id=mCG123560.0 transcript_id=mCT124793.1
FT                   protein_id=mCP88766.1"
FT                   /protein_id="EDL07263.1"
FT   assembly_gap    1476896..1477373
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    1481872..1481891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1484906..1484925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1501382..1501401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1508539..1508558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1516982..1517001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1518218..1518788
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    1526196..1528328
FT                   /estimated_length=2133
FT                   /gap_type="unknown"
FT   assembly_gap    1530234..1530253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1532585..1532604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1533690..1538807
FT                   /estimated_length=5118
FT                   /gap_type="unknown"
FT   assembly_gap    1544965..1544984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1550892..1550911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1552902..1552921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1554492..1554511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1566145..1566194
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    1572197..1577780
FT                   /estimated_length=5584
FT                   /gap_type="unknown"
FT   assembly_gap    1584450..1584469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1600268..1600378
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1618521..1618676
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    1622100..1622615
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    1624438..1624764
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    1631726..1635915
FT                   /estimated_length=4190
FT                   /gap_type="unknown"
FT   assembly_gap    1637213..1639475
FT                   /estimated_length=2263
FT                   /gap_type="unknown"
FT   assembly_gap    1640657..1640676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1641881..1641900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1642874..>1718161
FT                   /locus_tag="mCG_11829"
FT                   /note="gene_id=mCG11829.2"
FT   mRNA            join(1642874..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1673946,1674741..1674770,
FT                   1676823..1677115,1680166..1680394,1681146..1681192,
FT                   1685863..1686055,1687834..1687962,1690592..1690843,
FT                   1693596..1693770,1696150..1696261,1697539..1697741,
FT                   1698363..1698495,1717563..>1718161)
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, transcript variant mCT173466"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT173466.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(1642874..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1674863)
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, transcript variant mCT12233"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT12233.1 created
FT                   on 13-SEP-2002"
FT   CDS             join(1642925..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1673946,1674741..1674770,
FT                   1676823..1677115,1680166..1680394,1681146..1681192,
FT                   1685863..1686055,1687834..1687962,1690592..1690843,
FT                   1693596..1693770,1696150..1696261,1697539..1697741,
FT                   1698363..1698495,1717563..>1718161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, isoform CRA_b"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT173466.0
FT                   protein_id=mCP96385.0 isoform=CRA_b"
FT                   /protein_id="EDL07262.1"
FT   CDS             join(1642925..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1674090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, isoform CRA_a"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT12233.1
FT                   protein_id=mCP17336.2 isoform=CRA_a"
FT                   /protein_id="EDL07261.1"
FT                   TDITPPLP"
FT   assembly_gap    1645208..1645227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1647991..1653232
FT                   /estimated_length=5242
FT                   /gap_type="unknown"
FT   assembly_gap    1656166..1656283
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    1683188..1684295
FT                   /estimated_length=1108
FT                   /gap_type="unknown"
FT   assembly_gap    1684949..1685386
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    1719641..1719660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1722610..1722629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1724767..1724786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1740919..1793694
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /note="gene_id=mCG11825.2"
FT   mRNA            join(1740919..1741061,1741559..1741619,1750687..1750823,
FT                   1752767..1752839,1753430..1753572,1761026..1761116,
FT                   1766966..1767146,1770969..1771056,1771137..1771225,
FT                   1772293..1772423,1773443..1773512,1774041..1774111,
FT                   1779531..1779700,1786185..1786355,1789585..1789767,
FT                   1790306..1793694)
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /product="expressed sequence BB128963"
FT                   /note="gene_id=mCG11825.2 transcript_id=mCT12230.2 created
FT                   on 15-JAN-2003"
FT   CDS             join(1741002..1741061,1741559..1741619,1750687..1750823,
FT                   1752767..1752839,1753430..1753572,1761026..1761116,
FT                   1766966..1767146,1770969..1771056,1771137..1771225,
FT                   1772293..1772423,1773443..1773512,1774041..1774111,
FT                   1779531..1779700,1786185..1786355,1789585..1789767,
FT                   1790306..1790902)
FT                   /codon_start=1
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /product="expressed sequence BB128963"
FT                   /note="gene_id=mCG11825.2 transcript_id=mCT12230.2
FT                   protein_id=mCP17337.2"
FT                   /protein_id="EDL07260.1"
FT                   FLSGAKIWLSTETLANED"
FT   assembly_gap    1742696..1742715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1790423..1830139)
FT                   /locus_tag="mCG_11826"
FT                   /note="gene_id=mCG11826.2"
FT   mRNA            complement(join(1790423..1790806,1798230..1799399,
FT                   1801510..1801638,1801980..1802174,1802698..1802801,
FT                   1803457..1803567,1809671..1809821,1810466..1810630,
FT                   1813691..1813753,1818036..1818155,1819228..1819336,
FT                   1822592..1822825,1825082..1825283,1827581..1827721,
FT                   1828320..1829813,1829994..1830139))
FT                   /locus_tag="mCG_11826"
FT                   /product="mCG11826"
FT                   /note="gene_id=mCG11826.2 transcript_id=mCT12231.2 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(1799262..1799399,1801510..1801638,
FT                   1801980..1802174,1802698..1802801,1803457..1803567,
FT                   1809671..1809821,1810466..1810630,1813691..1813753,
FT                   1818036..1818155,1819228..1819336,1822592..1822825,
FT                   1825082..1825283,1827581..1827721,1828320..1829415))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11826"
FT                   /product="mCG11826"
FT                   /note="gene_id=mCG11826.2 transcript_id=mCT12231.2
FT                   protein_id=mCP17338.2"
FT                   /protein_id="EDL07259.1"
FT   assembly_gap    1805345..1805364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1806456..1806475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807892..1807911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1820220..1821619
FT                   /estimated_length=1400
FT                   /gap_type="unknown"
FT   assembly_gap    1823013..1824044
FT                   /estimated_length=1032
FT                   /gap_type="unknown"
FT   gene            complement(1832594..1848063)
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /note="gene_id=mCG123989.0"
FT   mRNA            complement(join(1832594..1832855,1833219..1833446,
FT                   1834785..1834892,1836978..1837088,1838925..1839062,
FT                   1840309..1840376,1841689..1841830,1843455..1843623,
FT                   1844872..1845029,1845453..1846137,1847931..1848063))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT125226"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT125226.1
FT                   created on 18-OCT-2002"
FT   mRNA            complement(join(1832628..1832855,1833219..1833356,
FT                   1839002..1839062,1840309..1840376,1841689..>1841757))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT174585"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174585.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(1832706..1832855,1833219..1833446,
FT                   1834785..1834892,1836978..1837088,1838925..1839062,
FT                   1840309..1840376,1841689..1841830,1843455..1843623,
FT                   1844872..1845029,1845453..1846137,1847931..1848019))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_a"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT125226.1
FT                   protein_id=mCP88984.1 isoform=CRA_a"
FT                   /protein_id="EDL07256.1"
FT   CDS             complement(join(1832706..1832855,1833219..1833356,
FT                   1839002..>1839046))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_b"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174585.0
FT                   protein_id=mCP97505.0 isoform=CRA_b"
FT                   /protein_id="EDL07257.1"
FT                   VHKLKL"
FT   mRNA            complement(join(1844019..1846137,1847931..1848062))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT174586"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174586.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(1845351..1846137,1847931..1848019))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_c"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174586.0
FT                   protein_id=mCP97504.0 isoform=CRA_c"
FT                   /protein_id="EDL07258.1"
FT                   NVPQTSFEPK"
FT   gene            1848462..1869310
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /note="gene_id=mCG11820.2"
FT   mRNA            join(1848462..1848660,1855980..1856155,1869030..1869303)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT174583"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174583.0 created
FT                   on 18-OCT-2002"
FT   mRNA            join(1848463..1848660,1855980..1856317,1869030..1869310)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT12224"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT12224.1 created
FT                   on 18-OCT-2002"
FT   mRNA            join(1848570..1848660,1854504..1854724,1855980..1856317,
FT                   1869030..1869063)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT174582"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174582.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(1848615..1848660,1855980..1856317,1869030..1869182)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_a"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT12224.1
FT                   protein_id=mCP17342.1 isoform=CRA_a"
FT                   /protein_id="EDL07253.1"
FT                   HPKDCGGVLVELEQA"
FT   CDS             join(1848615..1848660,1855980..1856155,1869030..1869182)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_c"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174583.0
FT                   protein_id=mCP97502.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="MGI:MGI:1920974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RQ27"
FT                   /protein_id="EDL07255.1"
FT   CDS             join(1848615..1848660,1854504..1854556)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_b"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174582.0
FT                   protein_id=mCP97501.0 isoform=CRA_b"
FT                   /protein_id="EDL07254.1"
FT                   /translation="MRRVVKAAALAAGATGKSPSLRKLKAGAQGRN"
FT   assembly_gap    1860378..1860397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1862316..1862739
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    1879269..1879541
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    1881385..1881630
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    1885439..1885458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1894339..1894358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1924580..1927563
FT                   /estimated_length=2984
FT                   /gap_type="unknown"
FT   assembly_gap    1936555..1936574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1941050..1941117
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    1957222..1957241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1966932..1970942
FT                   /estimated_length=4011
FT                   /gap_type="unknown"
FT   assembly_gap    1972176..1972716
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    1974594..1974613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1978123..1978142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1986358..1986860
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    2015933..2016028
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    2066708..2066727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2076576..2076595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2077637..2077656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2080428..2080447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2082570..2082589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2086631..2086650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2101859..2101878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2108114..2108338
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    2114512..2114531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2115984..2116003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2116278..2176321
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /note="gene_id=mCG11822.2"
FT   mRNA            join(2116278..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2158619..2158694,2176270..2176321)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT176331"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176331.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2116278..2116887,2175447..2175612)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT176332"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176332.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2116278..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2156393..2156428,2158619..2158705,
FT                   2161438..2161623,2165058..2165237,2166214..2166426,
FT                   2167503..2167622,2171787..2171927,2174814..2175113)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT12226"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT12226.2 created
FT                   on 03-JAN-2003"
FT   CDS             join(2116323..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2158619..2158694,2176270..2176319)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_b"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176331.0
FT                   protein_id=mCP99253.0 isoform=CRA_b"
FT                   /protein_id="EDL07251.1"
FT   CDS             join(2116323..2116887,2175447..2175457)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_c"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176332.0
FT                   protein_id=mCP99254.0 isoform=CRA_c"
FT                   /protein_id="EDL07252.1"
FT   CDS             join(2116323..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2156393..2156428,2158619..2158705,
FT                   2161438..2161623,2165058..2165237,2166214..2166426,
FT                   2167503..2167622,2171787..2171927,2174814..2174885)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_a"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT12226.2
FT                   protein_id=mCP17331.2 isoform=CRA_a"
FT                   /protein_id="EDL07250.1"
FT   assembly_gap    2117916..2118175
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    2119316..2123011
FT                   /estimated_length=3696
FT                   /gap_type="unknown"
FT   assembly_gap    2128678..2128778
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2129498..2130311
FT                   /estimated_length=814
FT                   /gap_type="unknown"
FT   assembly_gap    2133512..2133627
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2144893..2144952
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2162504..2162636
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    2169221..2169632
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    2174519..2174725
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   gene            complement(2177839..2243720)
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /note="gene_id=mCG11818.2"
FT   mRNA            complement(join(2177839..2181156,2183496..2183723,
FT                   2189368..2189443,2197421..2197556,2198430..2198590,
FT                   2208454..2208561,2243672..2243720))
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, transcript variant
FT                   mCT12222"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT12222.2 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(2179008..2181156,2183496..2183723,
FT                   2189368..2189443,2195133..2195370))
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, transcript variant
FT                   mCT182206"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT182206.0 created
FT                   on 27-MAY-2003"
FT   CDS             complement(join(2180840..2181156,2183496..2183723,
FT                   2189368..2189443,2197421..2197556,2198430..2198590,
FT                   2208454..2208495))
FT                   /codon_start=1
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, isoform CRA_a"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT12222.2
FT                   protein_id=mCP17339.2 isoform=CRA_a"
FT                   /protein_id="EDL07248.1"
FT   CDS             complement(join(2180840..2181156,2183496..2183598))
FT                   /codon_start=1
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, isoform CRA_b"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT182206.0
FT                   protein_id=mCP105107.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR030431"
FT                   /db_xref="MGI:MGI:1917888"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVD7"
FT                   /protein_id="EDL07249.1"
FT   assembly_gap    2202902..2202921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2212466..2212485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2233047..2233066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2235057..2235076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2236121..2236140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2243731..2244427
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    2247951..2247970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2249326..2249345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2250405..2250424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2259834..2259853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2261820..2261839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2277735..2277997
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    2280773..2282538
FT                   /estimated_length=1766
FT                   /gap_type="unknown"
FT   assembly_gap    2284084..2284103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2285908..2286043
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(2296221..2297618)
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /note="gene_id=mCG11827.2"
FT   mRNA            complement(2296221..2297618)
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /product="necdin-like 2"
FT                   /note="gene_id=mCG11827.2 transcript_id=mCT12228.2 created
FT                   on 13-SEP-2002"
FT   CDS             complement(2296654..2297493)
FT                   /codon_start=1
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /product="necdin-like 2"
FT                   /note="gene_id=mCG11827.2 transcript_id=mCT12228.2
FT                   protein_id=mCP17334.1"
FT                   /protein_id="EDL07247.1"
FT   assembly_gap    2303879..2303976
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2316143..2316162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2321799..2323053
FT                   /estimated_length=1255
FT                   /gap_type="unknown"
FT   assembly_gap    2355881..2356294
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    2371199..2372783
FT                   /estimated_length=1585
FT                   /gap_type="unknown"
FT   assembly_gap    2379494..2379635
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    2380274..2381197
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   assembly_gap    2399649..2399668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2401390..2401409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2402788..2402807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2412957..2413504
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    2414857..2415059
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    2416480..2416955
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    2418203..2418222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2423629..2423648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2427051..2427070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2428762..2428913
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2431829..2432545
FT                   /estimated_length=717
FT                   /gap_type="unknown"
FT   assembly_gap    2435238..2435274
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2462610..2463283
FT                   /estimated_length=674
FT                   /gap_type="unknown"
FT   assembly_gap    2470373..2470392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2498037..2498056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2504647..2505719
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   assembly_gap    2517926..2517945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2542613..2542632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2546199..2546218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2559882..2560058
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    2562258..2562277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2563759..2563778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2573437..2573456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2575512..2575531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2577914..2577933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2582340..2582567
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    2591684..2591703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2605932..2607194
FT                   /pseudo
FT                   /locus_tag="mCG_64192"
FT                   /note="gene_id=mCG64192.2"
FT   mRNA            2605932..2607194
FT                   /pseudo
FT                   /locus_tag="mCG_64192"
FT                   /note="gene_id=mCG64192.2 transcript_id=mCT64375.2 created
FT                   on 25-NOV-2002"
FT   assembly_gap    2623676..2623940
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    2626264..2626283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2628088..2628263
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    2629304..2631558
FT                   /estimated_length=2255
FT                   /gap_type="unknown"
FT   assembly_gap    2635703..2635722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2644423..2645037)
FT                   /locus_tag="mCG_147209"
FT                   /note="gene_id=mCG147209.0"
FT   mRNA            complement(join(<2644423..2644701,2644862..2645037))
FT                   /locus_tag="mCG_147209"
FT                   /product="mCG147209"
FT                   /note="gene_id=mCG147209.0 transcript_id=mCT187472.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<2644423..2644586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147209"
FT                   /product="mCG147209"
FT                   /note="gene_id=mCG147209.0 transcript_id=mCT187472.0
FT                   protein_id=mCP109616.0"
FT                   /protein_id="EDL07246.1"
FT                   SLPIKPDLKG"
FT   assembly_gap    2647566..2647585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2648884..2648903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2651737..2651935
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    2680846..2681420
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    2682561..2683346
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    2684338..2684645
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    2687171..2687230
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2689233..2689252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2690940..2690959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2698792..2698811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2708932..2710841
FT                   /estimated_length=1910
FT                   /gap_type="unknown"
FT   gene            complement(2721155..2797074)
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /note="gene_id=mCG19683.1"
FT   mRNA            complement(join(2721155..2722654,2724716..2724799,
FT                   2726062..2726279,2727740..2728214,2731172..2731338,
FT                   2735814..2736041,2737144..2737241,2737365..2738234,
FT                   2738903..2739142,2739469..2739819,2742807..2742907,
FT                   2743184..2743394,2744070..2744152,2747103..2747198,
FT                   2747317..2747501,2747778..2747997,2748812..2748920,
FT                   2752098..2752248,2754760..2754865,2755462..2755601,
FT                   2761867..2762014,2762332..2762500,2762878..2762981,
FT                   2765976..2766252,2768443..2768545,2769441..2769565,
FT                   2780441..2780499,2796751..2797074))
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /product="tight junction protein 1"
FT                   /note="gene_id=mCG19683.1 transcript_id=mCT21104.2 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(2722560..2722654,2724716..2724799,
FT                   2726062..2726279,2727740..2728214,2731172..2731338,
FT                   2735814..2736041,2737144..2737241,2737365..2738234,
FT                   2738903..2739142,2739469..2739819,2742807..2742907,
FT                   2743184..2743394,2744070..2744152,2747103..2747198,
FT                   2747317..2747501,2747778..2747997,2748812..2748920,
FT                   2752098..2752248,2754760..2754865,2755462..2755601,
FT                   2761867..2762014,2762332..2762500,2762878..2762981,
FT                   2765976..2766252,2768443..2768545,2769441..2769565,
FT                   2780441..2780499,2796751..2796763))
FT                   /codon_start=1
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /product="tight junction protein 1"
FT                   /note="gene_id=mCG19683.1 transcript_id=mCT21104.2
FT                   protein_id=mCP16516.2"
FT                   /protein_id="EDL07245.1"
FT   assembly_gap    2750469..2750488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2781320..2781342
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    2784223..2784426
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    2796480..2796750
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    2818732..2818751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2823516..2823535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2829476..2829495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2831062..2833073
FT                   /estimated_length=2012
FT                   /gap_type="unknown"
FT   assembly_gap    2836856..2840465
FT                   /estimated_length=3610
FT                   /gap_type="unknown"
FT   assembly_gap    2843604..2843623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2851267..2851734
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    2884718..2885880
FT                   /estimated_length=1163
FT                   /gap_type="unknown"
FT   assembly_gap    2888380..2888399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2893737..>2902980)
FT                   /locus_tag="mCG_145071"
FT                   /note="gene_id=mCG145071.0"
FT   mRNA            complement(join(2893737..2894652,2895395..2895869,
FT                   2897667..2899420,2901868..>2902980))
FT                   /locus_tag="mCG_145071"
FT                   /product="mCG145071"
FT                   /note="gene_id=mCG145071.0 transcript_id=mCT184495.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2894818..2894837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2895876..2895895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2897309..2897328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(2897844..>2898182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145071"
FT                   /product="mCG145071"
FT                   /note="gene_id=mCG145071.0 transcript_id=mCT184495.0
FT                   protein_id=mCP106150.0"
FT                   /protein_id="EDL07244.1"
FT                   YKWFGECK"
FT   assembly_gap    2899424..2899681
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    2900402..2901356
FT                   /estimated_length=955
FT                   /gap_type="unknown"
FT   assembly_gap    2915074..2915110
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2948021..2948050
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2950721..2950854
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2952112..2952479
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    2956748..2957445
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   assembly_gap    2958693..2958712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2959770..2959789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2963661..2964472
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    2965451..2966140
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    2981754..2981838
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2988133..2988408
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   gene            complement(<3002786..3056882)
FT                   /locus_tag="mCG_64442"
FT                   /note="gene_id=mCG64442.2"
FT   mRNA            complement(join(<3002786..3002960,3051923..3052055,
FT                   3056481..3056882))
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, transcript variant mCT64625"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT64625.2 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(<3002786..3002960,3051923..3052055,
FT                   3056481..3056823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, isoform CRA_b"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT64625.2
FT                   protein_id=mCP37319.2 isoform=CRA_b"
FT                   /protein_id="EDL07241.1"
FT   gene            3002797..3039913
FT                   /locus_tag="mCG_1028441"
FT                   /note="gene_id=mCG1028441.2"
FT   mRNA            join(3002797..3002982,3028874..3029350)
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, transcript variant mCT146145"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT146145.2
FT                   created on 10-JUN-2003"
FT   mRNA            join(3002837..3002982,3028874..3029051,3030071..3030301,
FT                   3030459..3030715,3031026..3031133,3031483..3031630,
FT                   3031901..3031981,3037442..3039913)
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, transcript variant mCT176330"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT176330.1
FT                   created on 10-JUN-2003"
FT   assembly_gap    3003942..3004326
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3024558..3025010,3025714..>3025991))
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, transcript variant mCT176338"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT176338.0 created
FT                   on 25-NOV-2002"
FT   CDS             complement(3025720..>3025965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, isoform CRA_a"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT176338.0
FT                   protein_id=mCP99260.0 isoform=CRA_a"
FT                   /protein_id="EDL07240.1"
FT   assembly_gap    3028651..3028670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3028980..3029051,3030071..3030196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, isoform CRA_b"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT176330.1
FT                   protein_id=mCP99252.1 isoform=CRA_b"
FT                   /protein_id="EDL07243.1"
FT   CDS             3028980..3029081
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, isoform CRA_a"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT146145.2
FT                   protein_id=mCP88649.2 isoform=CRA_a"
FT                   /protein_id="EDL07242.1"
FT   assembly_gap    3035747..3035766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3052913..3052932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3063417..3063735
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            3065998..3112915
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /note="gene_id=mCG123165.1"
FT   mRNA            join(3065998..3066315,3067354..3067422,3068575..3068765,
FT                   3076656..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3104715)
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, transcript
FT                   variant mCT185126"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT185126.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(3066017..3066315,3067354..3067422,3068575..3068765,
FT                   3076656..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103804,
FT                   3104709..3104786,3104964..3105064,3107340..3107444,
FT                   3109781..3109853,3110870..3110984,3111998..3112915)
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, transcript
FT                   variant mCT124395"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT124395.2
FT                   created on 04-JUN-2003"
FT   assembly_gap    3070778..3073448
FT                   /estimated_length=2671
FT                   /gap_type="unknown"
FT   assembly_gap    3075580..3075873
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   CDS             join(3076695..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103804,
FT                   3104709..3104786,3104964..3105064,3107340..3107444,
FT                   3109781..3109853,3110870..3110984,3111998..3112146)
FT                   /codon_start=1
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT124395.2
FT                   protein_id=mCP88685.2 isoform=CRA_b"
FT                   /protein_id="EDL07239.1"
FT   CDS             join(3076695..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103843)
FT                   /codon_start=1
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT185126.0
FT                   protein_id=mCP106384.0 isoform=CRA_a"
FT                   /protein_id="EDL07238.1"
FT   assembly_gap    3111653..3111672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3111996..3123505
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /note="gene_id=mCG145687.0"
FT   mRNA            join(3111996..3112117,3113889..3114396,3114678..3114770,
FT                   3115970..3116154,3119257..3119431,3120688..3120763,
FT                   3123190..3123505)
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, transcript variant
FT                   mCT174584"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT174584.0
FT                   created on 23-JUN-2003"
FT   mRNA            join(3114283..3114396,3115970..3116154,3119257..3119431,
FT                   3120688..3120763,3123190..3123497)
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, transcript variant
FT                   mCT186474"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT186474.0
FT                   created on 23-JUN-2003"
FT   CDS             join(3114306..3114396,3114678..3114770,3115970..3116154,
FT                   3119257..3119431,3120688..3120763,3123190..3123355)
FT                   /codon_start=1
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT174584.0
FT                   protein_id=mCP97503.1 isoform=CRA_a"
FT                   /protein_id="EDL07236.1"
FT   CDS             join(3114306..3114396,3115970..3116154,3119257..3119431,
FT                   3120688..3120763,3123190..3123355)
FT                   /codon_start=1
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT186474.0
FT                   protein_id=mCP107178.0 isoform=CRA_b"
FT                   /protein_id="EDL07237.1"
FT                   PADGSLYI"
FT   assembly_gap    3129212..3129379
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    3131739..3131758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3135353..3135372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3136398..3138105
FT                   /estimated_length=1708
FT                   /gap_type="unknown"
FT   assembly_gap    3140003..3140022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3141216..3141235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3143611..3143630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3145092..3145111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3147927..3148480
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    3149595..3149614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3150749..3150768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3176354..3176529
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    3204317..3204712
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    3209530..3209549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3210677..3210696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3212960..3212979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3214012..3214031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3215041..3215634
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    3216690..3222835
FT                   /estimated_length=6146
FT                   /gap_type="unknown"
FT   assembly_gap    3224378..3224397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3225964..3226609
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    3230236..3232453
FT                   /estimated_length=2218
FT                   /gap_type="unknown"
FT   assembly_gap    3234513..3235795
FT                   /estimated_length=1283
FT                   /gap_type="unknown"
FT   gene            <3237152..3245369
FT                   /locus_tag="mCG_1028439"
FT                   /note="gene_id=mCG1028439.0"
FT   mRNA            join(<3237152..3237433,3244970..3245369)
FT                   /locus_tag="mCG_1028439"
FT                   /product="mCG1028439"
FT                   /note="gene_id=mCG1028439.0 transcript_id=mCT146143.0
FT                   created on 18-OCT-2002"
FT   CDS             <3237152..3237400
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028439"
FT                   /product="mCG1028439"
FT                   /note="gene_id=mCG1028439.0 transcript_id=mCT146143.0
FT                   protein_id=mCP88635.0"
FT                   /protein_id="EDL07235.1"
FT   assembly_gap    3238625..3238644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3239732..3239751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3242369..3242388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3244431..3244450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3246662..3249990
FT                   /estimated_length=3329
FT                   /gap_type="unknown"
FT   assembly_gap    3272880..3272899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3290083..3290102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3297747..3297766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3300227..3493302
FT                   /locus_tag="mCG_19967"
FT                   /note="gene_id=mCG19967.2"
FT   mRNA            join(3300227..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407597,3410376..3410479,3411955..3412072,
FT                   3421568..3421756,3425150..3425286,3466639..3466818,
FT                   3473209..3473311,3475185..3475381,3476616..3476703,
FT                   3480447..3480550,3486431..3486560,3490473..3490585,
FT                   3491822..3493302)
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, transcript variant mCT18030"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT18030.2 created
FT                   on 27-MAY-2003"
FT   CDS             join(3300262..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407597,3410376..3410479,3411955..3412072,
FT                   3421568..3421756,3425150..3425286,3466639..3466818,
FT                   3473209..3473311,3475185..3475381,3476616..3476703,
FT                   3480447..3480550,3486431..3486560,3490473..3490585,
FT                   3491822..3491919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, isoform CRA_a"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT18030.2
FT                   protein_id=mCP16502.2 isoform=CRA_a"
FT                   /protein_id="EDL07233.1"
FT                   LLAG"
FT   mRNA            join(<3300304..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407560,3411955..3412072,3421568..3421756,
FT                   3425150..3425286,3466639..3466818,3473209..3473311,
FT                   3475185..3475381,3476616..3476703,3480447..3480550,
FT                   3486431..3486560,3490473..3490585,3491822..3492183)
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, transcript variant mCT189937"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT189937.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3300304..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407560,3411955..3412072,3421568..3421756,
FT                   3425150..3425286,3466639..3466818,3473209..3473311,
FT                   3475185..3475381,3476616..3476703,3480447..3480550,
FT                   3486431..3486560,3490473..3490585,3491822..3491919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, isoform CRA_b"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT189937.0
FT                   protein_id=mCP110922.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q62030"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR010909"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR032778"
FT                   /db_xref="InterPro:IPR032815"
FT                   /db_xref="MGI:MGI:102897"
FT                   /db_xref="UniProtKB/TrEMBL:Q62030"
FT                   /protein_id="EDL07234.1"
FT                   AG"
FT   assembly_gap    3316534..3316553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3408304..3408323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3419776..3419795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3470202..3470592
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    3498487..3498635
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            3503341..3517760
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /note="gene_id=mCG19965.2"
FT   mRNA            join(3503341..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..3513651,3517498..3517653)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT18026"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT18026.2 created
FT                   on 17-SEP-2002"
FT   mRNA            join(3503487..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513576..3513651,
FT                   3517498..3517760)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT173476"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173476.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(3503504..3503636,3505064..3505205,3506773..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..>3513651)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT173477"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173477.0 created
FT                   on 12-SEP-2002"
FT   CDS             join(3503555..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..3513651,3517498..3517560)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT18026.2
FT                   protein_id=mCP16521.2 isoform=CRA_c"
FT                   /protein_id="EDL07232.1"
FT                   NGS"
FT   CDS             join(3503555..3503636,3505064..3505205,3506773..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..>3513651)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173477.0
FT                   protein_id=mCP96395.0 isoform=CRA_b"
FT                   /protein_id="EDL07231.1"
FT                   PTDKKKGGPSAGDVEAIK"
FT   CDS             join(3503555..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513576..3513581)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173476.0
FT                   protein_id=mCP96396.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E883"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1916231"
FT                   /db_xref="UniProtKB/TrEMBL:G5E883"
FT                   /protein_id="EDL07230.1"
FT   assembly_gap    3514081..3516276
FT                   /estimated_length=2196
FT                   /gap_type="unknown"
FT   gene            3522846..3532726
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /note="gene_id=mCG19973.1"
FT   mRNA            join(3522846..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530589,3532085..3532726)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT18135"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT18135.2 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522852..3522969,3523512..3523650,3532413..3532673)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT173118"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT173118.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522857..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530787)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT177765"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177765.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522887..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530586,3532085..3532718)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT177764"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177764.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(3522894..3522969,3523512..3523650,3532413..3532446)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_a"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT173118.0
FT                   protein_id=mCP96037.0 isoform=CRA_a"
FT                   /protein_id="EDL07226.1"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530589,3532085..3532164)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_c"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT18135.2
FT                   protein_id=mCP16507.2 isoform=CRA_c"
FT                   /protein_id="EDL07228.1"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530586,3532085..3532164)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_b"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177764.0
FT                   protein_id=mCP100686.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0U1RP62"
FT                   /db_xref="InterPro:IPR009703"
FT                   /db_xref="MGI:MGI:95994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RP62"
FT                   /protein_id="EDL07227.1"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530609)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_d"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177765.0
FT                   protein_id=mCP100687.0 isoform=CRA_d"
FT                   /protein_id="EDL07229.1"
FT                   KNLAM"
FT   assembly_gap    3523801..3525541
FT                   /estimated_length=1741
FT                   /gap_type="unknown"
FT   assembly_gap    3549472..3549510
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    3552651..3552768
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    3553040..3553219
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            <3553329..3626899
FT                   /locus_tag="mCG_19971"
FT                   /note="gene_id=mCG19971.2"
FT   mRNA            join(<3553329..3553645,3568677..3569172,3623449..3623646,
FT                   3623965..3626899)
FT                   /locus_tag="mCG_19971"
FT                   /product="mCG19971"
FT                   /note="gene_id=mCG19971.2 transcript_id=mCT18032.2 created
FT                   on 20-NOV-2002"
FT   CDS             join(3553329..3553645,3568677..3569172,3623449..3623646,
FT                   3623965..3625554)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19971"
FT                   /product="mCG19971"
FT                   /note="gene_id=mCG19971.2 transcript_id=mCT18032.2
FT                   protein_id=mCP16511.2"
FT                   /protein_id="EDL07225.1"
FT   assembly_gap    3590898..3590917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3612209..3612979
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   assembly_gap    3614478..3614497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3615929..3615948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3620331..3620350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3622469..3622488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623677..3623696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3639857..3639876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3641073..3641092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3642196..3642215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3643739..3643758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3646758..3694389
FT                   /locus_tag="mCG_123064"
FT                   /note="gene_id=mCG123064.1"
FT   mRNA            join(<3646758..3647042,3647210..3647678,3694329..3694389)
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, transcript variant mCT176333"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT176333.0
FT                   created on 20-NOV-2002"
FT   mRNA            join(<3646758..3647042,3647210..3647392,3693937..3693983,
FT                   3694089..3694387)
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, transcript variant mCT124292"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT124292.1
FT                   created on 20-NOV-2002"
FT   CDS             join(<3646876..3647042,3647210..3647231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, isoform CRA_a"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT124292.1
FT                   protein_id=mCP89074.1 isoform=CRA_a"
FT                   /protein_id="EDL07223.1"
FT                   MPKDIQLAAGPIHGERA"
FT   CDS             join(<3646876..3647042,3647210..3647231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, isoform CRA_a"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT176333.0
FT                   protein_id=mCP99255.0 isoform=CRA_a"
FT                   /protein_id="EDL07224.1"
FT                   MPKDIQLAAGPIHGERA"
FT   assembly_gap    3649261..3651283
FT                   /estimated_length=2023
FT                   /gap_type="unknown"
FT   assembly_gap    3662460..3662479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3677341..3677360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3679148..3679167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3685830..3685849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3687106..3687125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3693823..3693842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<3694697..>3777583)
FT                   /locus_tag="mCG_141689"
FT                   /note="gene_id=mCG141689.0"
FT   mRNA            complement(join(<3694697..3694984,3720118..3720234,
FT                   3721184..3721301,3725385..3725550,3729567..3729770,
FT                   3733327..3733493,3733999..3734248,3736373..3736512,
FT                   3736906..3737092,3739761..3739900,3740307..3740470,
FT                   3743357..3743528,3745549..3745825,3747193..3747352,
FT                   3747723..3747843,3748838..3749010,3750367..3750484,
FT                   3751561..3751733,3752568..3752732,3755107..3755312,
FT                   3755726..3755838,3756434..3756563,3761201..3761277,
FT                   3769234..3769460,3770740..3770813,3772921..3772997,
FT                   3774728..3774840,3777455..>3777583))
FT                   /locus_tag="mCG_141689"
FT                   /product="mCG141689"
FT                   /note="gene_id=mCG141689.0 transcript_id=mCT176335.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(3694697..3694984,3720118..3720234,
FT                   3721184..3721301,3725385..3725550,3729567..3729770,
FT                   3733327..3733493,3733999..3734248,3736373..3736512,
FT                   3736906..3737092,3739761..3739900,3740307..3740470,
FT                   3743357..3743528,3745549..3745825,3747193..3747352,
FT                   3747723..3747843,3748838..3749010,3750367..3750484,
FT                   3751561..3751733,3752568..3752732,3755107..3755312,
FT                   3755726..3755838,3756434..3756563,3761201..3761277,
FT                   3769234..3769460,3770740..3770813,3772921..3772997,
FT                   3774728..3774840,3777455..3777583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141689"
FT                   /product="mCG141689"
FT                   /note="gene_id=mCG141689.0 transcript_id=mCT176335.0
FT                   protein_id=mCP99257.0"
FT                   /protein_id="EDL07222.1"
FT   assembly_gap    3695923..3700045
FT                   /estimated_length=4123
FT                   /gap_type="unknown"
FT   assembly_gap    3701289..3701308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3710175..3710194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3711317..3712039
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    3713337..3718870
FT                   /estimated_length=5534
FT                   /gap_type="unknown"
FT   assembly_gap    3724237..3725367
FT                   /estimated_length=1131
FT                   /gap_type="unknown"
FT   assembly_gap    3726884..3728107
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   assembly_gap    3729371..3729488
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    3732412..3732599
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3737918..3737937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3738967..3738986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3751341..3751360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3761854..3767801
FT                   /estimated_length=5948
FT                   /gap_type="unknown"
FT   assembly_gap    3771953..3771972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3778751..3782230
FT                   /estimated_length=3480
FT                   /gap_type="unknown"
FT   assembly_gap    3785120..3785139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<3792275..3850573)
FT                   /locus_tag="mCG_1028437"
FT                   /note="gene_id=mCG1028437.1"
FT   mRNA            complement(join(<3792275..3792300,3792957..3793128,
FT                   3803131..3803294,3843731..3843945,3850465..3850573))
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, transcript variant mCT173107"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT173107.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(<3792275..3792300,3792957..3793128,
FT                   3803131..3803294,3843731..3843827))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, isoform CRA_b"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT173107.0
FT                   protein_id=mCP96026.0 isoform=CRA_b"
FT                   /protein_id="EDL07221.1"
FT   assembly_gap    3794787..3794806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3801870..3802375,3803131..3803294,
FT                   3803382..3803636))
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, transcript variant mCT146141"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT146141.1
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(3802328..3802375,3803131..3803294,
FT                   3803382..3803481))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, isoform CRA_a"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT146141.1
FT                   protein_id=mCP88622.1 isoform=CRA_a"
FT                   /protein_id="EDL07220.1"
FT   assembly_gap    3820844..3820863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3822464..3822483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3823857..3824110
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    3825436..3825455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3853139..3889616)
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /note="gene_id=mCG123072.1"
FT   mRNA            complement(join(3853139..3855005,3860936..3861010,
FT                   3862326..3862483,3864219..3864383,3868222..3868406,
FT                   3870049..3870151,3871247..3871360,3873641..3873769,
FT                   3874497..3874558,3875040..3875169,3881243..3881383,
FT                   3884351..3884455,3889460..3889616))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173110"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173110.0
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(3854933..3855005,3860936..3861010,
FT                   3862326..3862483,3864219..3864383,3868222..3868406,
FT                   3870049..3870151,3871247..3871360,3873641..3873769,
FT                   3874497..3874558,3875040..3875169,3881243..3881383,
FT                   3884351..3884455,3889460..3889558))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173110.0
FT                   protein_id=mCP96029.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UIA4"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:1861722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UIA4"
FT                   /protein_id="EDL07219.1"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3889460..3889616))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT124300"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT124300.1
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3888576..3888737))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173111"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173111.1
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3887672..3887849))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173112"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173112.1
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3889460..3889558))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT124300.1
FT                   protein_id=mCP88619.2 isoform=CRA_a"
FT                   /protein_id="EDL07216.1"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3887672..3887806))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173112.1
FT                   protein_id=mCP96031.1 isoform=CRA_c"
FT                   /protein_id="EDL07218.1"
FT                   ETTTCSII"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875157))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173111.1
FT                   protein_id=mCP96030.1 isoform=CRA_b"
FT                   /protein_id="EDL07217.1"
FT   assembly_gap    3893692..3893711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3933374..3933393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3952926..3952945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3976148..3977404
FT                   /estimated_length=1257
FT                   /gap_type="unknown"
FT   assembly_gap    3979413..3979626
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3980679..3980698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3998840..3998859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4003130..4003149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4009987..4011772
FT                   /estimated_length=1786
FT                   /gap_type="unknown"
FT   assembly_gap    4015931..4015950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017803..4017996
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    4020888..4021140
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    4034245..4034338
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    4040543..4040562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4060938..4060957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4100065..4100084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4101645..4147368)
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /note="gene_id=mCG2185.3"
FT   mRNA            complement(join(4101645..4104997,4116722..4117327,
FT                   4136934..4137195,4139559..4139662,4145738..4145812,
FT                   4146677..4146774,4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT1799"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT1799.3 created on
FT                   10-JUN-2004"
FT   mRNA            complement(join(4101645..4104997,4116722..4117327,
FT                   4136011..4136099,4136934..4137195,4139559..4139662,
FT                   4145738..4145812,4146677..4146774,4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT194449"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT194449.0 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(4104858..4104997,4116722..4117327,
FT                   4136934..4137144))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT1799.3
FT                   protein_id=mCP16501.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q91ZU0"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91ZU0"
FT                   /protein_id="EDL07214.1"
FT   CDS             complement(join(4104858..4104997,4116722..4117327,
FT                   4136011..4136044))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT194449.0
FT                   protein_id=mCP115478.0 isoform=CRA_c"
FT                   /db_xref="GOA:C0H5Y0"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/TrEMBL:C0H5Y0"
FT                   /protein_id="EDL07215.1"
FT   assembly_gap    4129499..4129518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4134877..4136099,4136934..4137195,
FT                   4139559..4139662,4145738..4145812,4146677..4146774,
FT                   4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT173119"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT173119.1 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(4136041..4136099,4136934..4137144))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT173119.1
FT                   protein_id=mCP96038.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQC5"
FT                   /protein_id="EDL07213.1"
FT   assembly_gap    4144782..4144801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4147737..4175659
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /note="gene_id=mCG2192.2"
FT   mRNA            join(4147737..4147876,4168963..>4169280)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174605"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174605.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(<4147800..4147876,4153850..4153980,4168963..4169476,
FT                   4169562..4169651,4170218..4170826)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT189935"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT189935.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4147808..4147876,4153850..4153980,4168963..4169476,
FT                   4169562..4169651,4170218..4170359,4171154..4171670,
FT                   4172791..4172962,4174707..4175659)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT1793"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT1793.2 created on
FT                   17-JUN-2003"
FT   mRNA            join(4147814..4147876,4153850..4153980,4163411..4163463,
FT                   4164603..4164639,4168963..>4169336)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174603"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174603.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4147822..4147876,4153850..4153980,4165409..4165552,
FT                   4168963..>4169318)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174604"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174604.0 created
FT                   on 17-JUN-2003"
FT   assembly_gap    4165965..4165984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4167998..4168017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<4168973..4169476,4169562..4169651,4170218..4170535)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_f"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT189935.0
FT                   protein_id=mCP110926.0 isoform=CRA_f"
FT                   /protein_id="EDL07212.1"
FT   CDS             4169042..>4169336
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174603.0
FT                   protein_id=mCP97522.0 isoform=CRA_a"
FT                   /protein_id="EDL07207.1"
FT   CDS             4169042..>4169318
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174604.0
FT                   protein_id=mCP97525.0 isoform=CRA_b"
FT                   /protein_id="EDL07208.1"
FT   CDS             4169042..>4169280
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174605.0
FT                   protein_id=mCP97523.0 isoform=CRA_c"
FT                   /protein_id="EDL07209.1"
FT   mRNA            join(4169057..4169440,4174942..>4175007)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174606"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174606.0 created
FT                   on 17-JUN-2003"
FT   CDS             join(4169066..4169440,4174942..>4175007)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174606.0
FT                   protein_id=mCP97524.0 isoform=CRA_d"
FT                   /protein_id="EDL07210.1"
FT   CDS             join(4171274..4171670,4172791..4172962,4174707..4175445)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT1793.2
FT                   protein_id=mCP16522.3 isoform=CRA_e"
FT                   /protein_id="EDL07211.1"
FT   assembly_gap    4183283..4183302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4200883..4200985
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    4206242..4206944
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    4251928..4252018
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    4274520..4274539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4281552..4281680
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    4292516..4293588
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   gene            4300720..4500893
FT                   /locus_tag="mCG_141698"
FT                   /note="gene_id=mCG141698.0"
FT   mRNA            join(4300720..4300859,4301196..4301566,4310659..4310824,
FT                   4349619..4349788,4370008..4370091,4370746..4370903,
FT                   4377274..4377317,4430302..4430407,4473847..4473987,
FT                   4475729..4475879,4500568..4500893)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176379"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176379.0
FT                   created on 20-NOV-2002"
FT   CDS             join(4300784..4300859,4301196..4301566,4310659..4310824,
FT                   4349619..4349788,4370008..4370091,4370746..4370903,
FT                   4377274..4377317,4430302..4430407,4473847..4473987,
FT                   4475729..4475879,4500568..4500780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_c"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176379.0
FT                   protein_id=mCP99300.0 isoform=CRA_c"
FT                   /db_xref="GOA:B2RUI7"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:3588195"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUI7"
FT                   /protein_id="EDL07206.1"
FT   assembly_gap    4318096..4318358
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    4337921..4339214
FT                   /estimated_length=1294
FT                   /gap_type="unknown"
FT   mRNA            join(<4377272..4377317,4430302..4430407,4430703..4431047)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176378"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176378.0
FT                   created on 20-NOV-2002"
FT   assembly_gap    4416891..4416910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <4430825..4431040
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_b"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176378.0
FT                   protein_id=mCP99301.0 isoform=CRA_b"
FT                   /protein_id="EDL07205.1"
FT   assembly_gap    4431568..4431587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4433711..4433730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4435122..4435141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4437210..4438672
FT                   /estimated_length=1463
FT                   /gap_type="unknown"
FT   assembly_gap    4448620..4448753
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    4450126..4450641
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    4453690..4453709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4455135..4455754
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   mRNA            join(<4457543..4457622,4467850..>4468292)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176377"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176377.0
FT                   created on 20-NOV-2002"
FT   assembly_gap    4458078..4458097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4460339..4466541
FT                   /estimated_length=6203
FT                   /gap_type="unknown"
FT   CDS             <4468065..>4468292
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_a"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176377.0
FT                   protein_id=mCP99299.0 isoform=CRA_a"
FT                   /protein_id="EDL07204.1"
FT   assembly_gap    4468911..4468930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4476525..4477848
FT                   /estimated_length=1324
FT                   /gap_type="unknown"
FT   assembly_gap    4489423..4489442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4501364..4503095
FT                   /estimated_length=1732
FT                   /gap_type="unknown"
FT   assembly_gap    4519572..4519591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4520423..4554351
FT                   /locus_tag="mCG_2186"
FT                   /note="gene_id=mCG2186.2"
FT   mRNA            join(<4520423..4520522,4521485..4521612,4525941..4526061,
FT                   4544384..4544541,4549128..4549287,4549635..4549760,
FT                   4551885..4551995,4552067..4552202,4553687..4554351)
FT                   /locus_tag="mCG_2186"
FT                   /product="mCG2186"
FT                   /note="gene_id=mCG2186.2 transcript_id=mCT1794.2 created on
FT                   20-NOV-2002"
FT   CDS             join(4520423..4520522,4521485..4521612,4525941..4526061,
FT                   4544384..4544541,4549128..4549287,4549635..4549760,
FT                   4551885..4551995,4552067..4552202,4553687..4553699)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2186"
FT                   /product="mCG2186"
FT                   /note="gene_id=mCG2186.2 transcript_id=mCT1794.2
FT                   protein_id=mCP16503.2"
FT                   /protein_id="EDL07203.1"
FT                   SHPCQSRVSN"
FT   assembly_gap    4541738..4541757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4546133..4546152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4571602..4571621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4584903..4585079
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    4587851..4589693
FT                   /estimated_length=1843
FT                   /gap_type="unknown"
FT   assembly_gap    4591462..4591481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4593084..4593343
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    4595445..4595464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4627316..4627335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4628498..4628517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4629643..4629662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4653904..4654436
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    4656500..4656720
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    4667684..4667874
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(4670449..>4688830)
FT                   /locus_tag="mCG_144579"
FT                   /note="gene_id=mCG144579.0"
FT   mRNA            complement(join(4670449..4671769,4685869..4686551,
FT                   4688615..>4688830))
FT                   /locus_tag="mCG_144579"
FT                   /product="mCG144579"
FT                   /note="gene_id=mCG144579.0 transcript_id=mCT184003.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(4670797..>4671042)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144579"
FT                   /product="mCG144579"
FT                   /note="gene_id=mCG144579.0 transcript_id=mCT184003.0
FT                   protein_id=mCP106148.0"
FT                   /protein_id="EDL07202.1"
FT   gene            4688914..4771514
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /note="gene_id=mCG2184.2"
FT   mRNA            join(4688914..4689000,4689980..4690262,4708112..4708200,
FT                   4771314..4771514)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT174602"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174602.0 created
FT                   on 18-OCT-2002"
FT   mRNA            join(4688914..4689000,4689980..4690262,4692235..4693049)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT1804"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT1804.1 created on
FT                   18-OCT-2002"
FT   mRNA            join(4689980..4690262,4690747..4690772,4691397..4694827)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT174601"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174601.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(4689990..4690262,4708112..4708126)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174602.0
FT                   protein_id=mCP97521.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1922349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A140LIK8"
FT                   /protein_id="EDL07199.1"
FT   CDS             join(4689990..4690262,4692235..4692843)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_c"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT1804.1
FT                   protein_id=mCP16500.2 isoform=CRA_c"
FT                   /protein_id="EDL07200.1"
FT                   DSQVSPTTQAGA"
FT   CDS             join(4689990..4690262,4690747..4690758)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174601.0
FT                   protein_id=mCP97520.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1922349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A140LI06"
FT                   /protein_id="EDL07198.1"
FT   assembly_gap    4694904..4694923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4698484..>4814039)
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /note="gene_id=mCG2191.2"
FT   mRNA            complement(join(4698484..4698675,4701204..4701628,
FT                   4702924..4703050,4706807..4706933,4711014..4711037,
FT                   4718150..4718337,4731183..4731242,4732263..4732482,
FT                   4734589..4734720,4761126..4761329,4780976..4781166,
FT                   4813986..>4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT189932"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189932.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4698484..4698675,4701204..4701628,
FT                   4702924..4703050,4706807..4706933,4711014..4711037,
FT                   4718150..4718337,4731183..4731242,4732263..4732482,
FT                   4734589..4734720,4761126..4761329,4780976..4781166,
FT                   4813966..4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT1800"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT1800.1 created on
FT                   04-JUN-2003"
FT   mRNA            complement(join(4700233..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..4781166,4813986..>4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT189933"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189933.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4700233..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734387..>4735035))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT185138"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185138.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(4700547..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734589..4734720,4759345..4759491,
FT                   4761126..4761329,4780976..4781166,4813986..4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT185139"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185139.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..>4781035))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_d"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189932.0
FT                   protein_id=mCP110924.0 isoform=CRA_d"
FT                   /protein_id="EDL07196.1"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..>4781035))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_d"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189933.0
FT                   protein_id=mCP110925.0 isoform=CRA_d"
FT                   /protein_id="EDL07197.1"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..4781029))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_a"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT1800.1
FT                   protein_id=mCP16517.1 isoform=CRA_a"
FT                   /protein_id="EDL07193.1"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734387..>4734524))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_b"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185138.0
FT                   protein_id=mCP106396.0 isoform=CRA_b"
FT                   /protein_id="EDL07194.1"
FT                   RMDTWVT"
FT   assembly_gap    4705817..4706516
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    4720735..4721231
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   gene            complement(4735226..4738597)
FT                   /locus_tag="mCG_147199"
FT                   /note="gene_id=mCG147199.0"
FT   mRNA            complement(join(4735226..4735956,4735995..4738597))
FT                   /locus_tag="mCG_147199"
FT                   /product="mCG147199"
FT                   /note="gene_id=mCG147199.0 transcript_id=mCT187462.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4735967..4735986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(4736783..4736989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147199"
FT                   /product="mCG147199"
FT                   /note="gene_id=mCG147199.0 transcript_id=mCT187462.0
FT                   protein_id=mCP109606.0"
FT                   /protein_id="EDL07201.1"
FT   assembly_gap    4743968..4746250
FT                   /estimated_length=2283
FT                   /gap_type="unknown"
FT   CDS             complement(join(4759447..4759491,4761126..4761329,
FT                   4780976..4781029))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_c"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185139.0
FT                   protein_id=mCP106397.0 isoform=CRA_c"
FT                   /db_xref="GOA:S4R2H4"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="MGI:MGI:99532"
FT                   /db_xref="UniProtKB/TrEMBL:S4R2H4"
FT                   /protein_id="EDL07195.1"
FT   assembly_gap    4768555..4768574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4787838..4788291
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    4810689..4810708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4836523..4837358
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   assembly_gap    4847908..4848019
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    4864284..4864303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4890368..>4905307)
FT                   /locus_tag="mCG_1028426"
FT                   /note="gene_id=mCG1028426.0"
FT   mRNA            complement(join(4890368..4890542,4890802..4890950,
FT                   4905212..>4905307))
FT                   /locus_tag="mCG_1028426"
FT                   /product="mCG1028426"
FT                   /note="gene_id=mCG1028426.0 transcript_id=mCT146130.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(4890391..4890542,4890802..4890950,
FT                   4905212..>4905306))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028426"
FT                   /product="mCG1028426"
FT                   /note="gene_id=mCG1028426.0 transcript_id=mCT146130.1
FT                   protein_id=mCP88896.1"
FT                   /protein_id="EDL07192.1"
FT   assembly_gap    4891341..4891482
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    4935414..4935433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4946691..4947510
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    4950809..4950828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4956114..4956133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957955..4957974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4972143..5104758)
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /note="gene_id=mCG13837.2"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5076492..5076629,5077573..5077610,5100571..5100807,
FT                   5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185127"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185127.0 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT179038"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT179038.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT17542"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT17542.3 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003849,5018250..5018456,
FT                   5076561..5076629,5077573..5077610,5081068..5081094,
FT                   5086795..5086835,5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185129"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185129.0 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5038101..5038161,5076492..5076629,5077573..5077610,
FT                   5086795..5086835,5100571..5100809,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174589"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174589.2 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5076492..5076629,5077573..5077610,
FT                   5078451..>5078526))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174587"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174587.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5065600..>5065795))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174588"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174588.1 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_d"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT17542.3
FT                   protein_id=mCP6643.2 isoform=CRA_d"
FT                   /protein_id="EDL07187.1"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5076492..>5076514))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_a"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174587.1
FT                   protein_id=mCP97506.1 isoform=CRA_a"
FT                   /protein_id="EDL07184.1"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5065600..>5065617))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_b"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174588.1
FT                   protein_id=mCP97507.1 isoform=CRA_b"
FT                   /protein_id="EDL07185.1"
FT   CDS             complement(join(5003806..5003849,5018250..5018456,
FT                   5076561..5076629,5077573..5077610,5081068..5081094,
FT                   5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_h"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185129.0
FT                   protein_id=mCP106386.0 isoform=CRA_h"
FT                   /protein_id="EDL07191.1"
FT   CDS             complement(join(5018291..5018361,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_e"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT179038.1
FT                   protein_id=mCP101960.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1915689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1S3"
FT                   /protein_id="EDL07188.1"
FT   assembly_gap    5034598..5034617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(5038154..5038161,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_c"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174589.2
FT                   protein_id=mCP97508.1 isoform=CRA_c"
FT                   /protein_id="EDL07186.1"
FT   assembly_gap    5044200..5044219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5045223..5045479
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5052913..5054245,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100807,
FT                   5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185128"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185128.0 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(5054166..5054245,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_g"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185128.0
FT                   protein_id=mCP106385.0 isoform=CRA_g"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1915689"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D7Y1"
FT                   /protein_id="EDL07190.1"
FT   assembly_gap    5057372..5057391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(5077593..5077610,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_f"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185127.0
FT                   protein_id=mCP106387.0 isoform=CRA_f"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1915689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WQI4"
FT                   /protein_id="EDL07189.1"
FT                   LYMKRNSLTTLVPSLK"
FT   assembly_gap    5090719..5090738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5098182..5098201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5106808..5106827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5107969..5107988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5108626..5224530
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /note="gene_id=mCG13838.3"
FT   mRNA            join(5108626..5109062,5123583..5123782,5131964..5132089,
FT                   5140791..5140968,5159940..5160045,5171030..5171157,
FT                   5173060..5173209,5213303..5213430,5222661..5224530)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT185298"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185298.0 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108658..5109062,5113173..5113221,5129130..5129253,
FT                   5131606..>5131727)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT185296"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185296.0 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108666..5109062,5129130..5129253,5131606..5131757,
FT                   5131964..5132089,5140791..5140968,5159940..5160045,
FT                   5171030..5171157,5173060..5173209,5186867..5186949,
FT                   5187661..5188210)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT17543"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT17543.2 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108739..5109062,5123583..5123782,5129130..5129253,
FT                   5131606..>5131706)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT173114"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT173114.0 created
FT                   on 15-JUL-2003"
FT   assembly_gap    5124106..5124125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5125251..5125936
FT                   /estimated_length=686
FT                   /gap_type="unknown"
FT   CDS             join(5131630..5131757,5131964..5132089,5140791..5140968,
FT                   5159940..5160045,5171030..5171157,5173060..5173209,
FT                   5186867..5186949,5187661..5187775)
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT17543.2
FT                   protein_id=mCP6644.2 isoform=CRA_d"
FT                   /protein_id="EDL07178.1"
FT   CDS             5131630..>5131727
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185296.0
FT                   protein_id=mCP106554.0 isoform=CRA_c"
FT                   /protein_id="EDL07177.1"
FT   CDS             5131630..>5131706
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT173114.0
FT                   protein_id=mCP96033.1 isoform=CRA_b"
FT                   /protein_id="EDL07176.1"
FT                   /translation="MQRKPRRSWPTPSRVPVTTKQISSSV"
FT   CDS             join(5132016..5132089,5140791..5140968,5159940..5160045,
FT                   5171030..5171157,5173060..5173209,5213303..5213371)
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185298.0
FT                   protein_id=mCP106555.0 isoform=CRA_a"
FT                   /protein_id="EDL07175.1"
FT                   RQTLTCRWLPPS"
FT   assembly_gap    5136014..5136132
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5138447..5138963
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    5178234..5178504
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    5188555..5189007
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   gene            complement(5192184..5193207)
FT                   /locus_tag="mCG_147202"
FT                   /note="gene_id=mCG147202.0"
FT   mRNA            complement(5192184..5193207)
FT                   /locus_tag="mCG_147202"
FT                   /product="mCG147202"
FT                   /note="gene_id=mCG147202.0 transcript_id=mCT187465.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5192807..5193130)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147202"
FT                   /product="mCG147202"
FT                   /note="gene_id=mCG147202.0 transcript_id=mCT187465.0
FT                   protein_id=mCP109609.0"
FT                   /db_xref="MGI:MGI:2661187"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQ62"
FT                   /protein_id="EDL07183.1"
FT                   FFP"
FT   gene            complement(5194101..5221784)
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /note="gene_id=mCG50168.2"
FT   mRNA            complement(join(5194101..5194749,5197432..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221293))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT185583"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT185583.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194102..5198405,5200604..5200674,
FT                   5213347..5213471,5220428..5221784))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT50351"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT50351.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194249..5195052,5195959..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221293))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT176337"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176337.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194249..5195052,5195959..5198405,
FT                   5200604..5200674,5202034..>5202100))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT176336"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176336.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(5194726..5194749,5197432..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_d"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT185583.0
FT                   protein_id=mCP106841.0 isoform=CRA_d"
FT                   /protein_id="EDL07182.1"
FT                   "
FT   CDS             complement(join(5194726..5195052,5195959..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_c"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176337.1
FT                   protein_id=mCP99259.1 isoform=CRA_c"
FT                   /protein_id="EDL07181.1"
FT                   WF"
FT   CDS             complement(join(5194726..5198405,5200604..5200674,
FT                   5213347..5213471,5220428..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_b"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT50351.1
FT                   protein_id=mCP29141.2 isoform=CRA_b"
FT                   /protein_id="EDL07180.1"
FT   CDS             complement(join(5194726..5195052,5195959..5198405,
FT                   5200604..5200674,5202034..>5202098))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_a"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176336.1
FT                   protein_id=mCP99258.1 isoform=CRA_a"
FT                   /protein_id="EDL07179.1"
FT   assembly_gap    5235064..5235169
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    5239832..5239851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5245405..5246400)
FT                   /pseudo
FT                   /locus_tag="mCG_13844"
FT                   /note="gene_id=mCG13844.1"
FT   mRNA            complement(5245405..5246400)
FT                   /pseudo
FT                   /locus_tag="mCG_13844"
FT                   /note="gene_id=mCG13844.1 transcript_id=mCT17548.1 created
FT                   on 20-NOV-2002"
FT   gene            complement(5247348..>5265892)
FT                   /locus_tag="mCG_49110"
FT                   /note="gene_id=mCG49110.2"
FT   mRNA            complement(join(5247348..5247915,5249022..5249217,
FT                   5265760..>5265892))
FT                   /locus_tag="mCG_49110"
FT                   /product="mCG49110"
FT                   /note="gene_id=mCG49110.2 transcript_id=mCT49293.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(5247452..>5247700)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49110"
FT                   /product="mCG49110"
FT                   /note="gene_id=mCG49110.2 transcript_id=mCT49293.2
FT                   protein_id=mCP29136.2"
FT                   /protein_id="EDL07174.1"
FT   assembly_gap    5250933..5250952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5254200..5254522
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    5266521..5266683
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    5272233..5272252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5274139..5274600
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    5276716..5277654
FT                   /estimated_length=939
FT                   /gap_type="unknown"
FT   assembly_gap    5279000..5279019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5285598..5285617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5316000..5316136
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    5331668..5331850
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    5344371..5344495
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(5349176..5349619)
FT                   /pseudo
FT                   /locus_tag="mCG_53844"
FT                   /note="gene_id=mCG53844.2"
FT   mRNA            complement(5349176..5349619)
FT                   /pseudo
FT                   /locus_tag="mCG_53844"
FT                   /note="gene_id=mCG53844.2 transcript_id=mCT54027.2 created
FT                   on 20-NOV-2002"
FT   assembly_gap    5371815..5371834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5383242..5383261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5414150..5414509
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   gene            5415317..>5482953
FT                   /locus_tag="mCG_13841"
FT                   /note="gene_id=mCG13841.2"
FT   mRNA            join(5415317..5415894,5467075..5467620,5482754..>5482953)
FT                   /locus_tag="mCG_13841"
FT                   /product="mCG13841"
FT                   /note="gene_id=mCG13841.2 transcript_id=mCT17546.1 created
FT                   on 20-NOV-2002"
FT   CDS             join(5415801..5415894,5467075..5467620,5482754..5482953)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13841"
FT                   /product="mCG13841"
FT                   /note="gene_id=mCG13841.2 transcript_id=mCT17546.1
FT                   protein_id=mCP6636.1"
FT                   /protein_id="EDL07173.1"
FT   assembly_gap    5416971..5417008
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    5441929..5442042
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    5451550..5451569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5453815..5453834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5458222..5458635
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5460149..5460168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5462820..5462839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5471124..5471463
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    5491116..5491295
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    5499364..5499383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5513529..5513789
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    5523062..5523091
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    5528545..5528913
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    5547690..5547729
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5561867..5561886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5569720..5570258
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    5592283..5592425
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            5628420..5692340
FT                   /locus_tag="mCG_13842"
FT                   /note="gene_id=mCG13842.2"
FT   mRNA            join(5628420..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653877..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5673195..5673287,5676276..5676438,5679201..5679330,
FT                   5682692..5682826,5690310..5692340)
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, transcript variant mCT176334"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT176334.0 created
FT                   on 20-NOV-2002"
FT   mRNA            join(5628421..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653895..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5676276..5676438,5679201..5679330,5682692..5682826,
FT                   5690310..5692340)
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, transcript variant mCT17549"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT17549.2 created
FT                   on 20-NOV-2002"
FT   CDS             join(5628697..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653877..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5673195..5673287,5676276..5676438,5679201..5679330,
FT                   5682692..5682826,5690310..5690703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, isoform CRA_b"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT176334.0
FT                   protein_id=mCP99256.0 isoform=CRA_b"
FT                   /protein_id="EDL07172.1"
FT   CDS             join(5628697..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653895..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5676276..5676438,5679201..5679330,5682692..5682826,
FT                   5690310..5690703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, isoform CRA_a"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT17549.2
FT                   protein_id=mCP6638.2 isoform=CRA_a"
FT                   /protein_id="EDL07171.1"
FT                   GRANERALPLPQSSTC"
FT   assembly_gap    5636827..5636846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5700658..5700750
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(5700752..>5728710)
FT                   /locus_tag="mCG_13840"
FT                   /note="gene_id=mCG13840.1"
FT   mRNA            complement(join(5700752..5701191,5701711..5701937,
FT                   5703141..5703263,5728619..>5728710))
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, transcript variant mCT17545"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT17545.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5701008..5701191,5701711..5701937,
FT                   5703141..5703263,5728619..>5728621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, isoform CRA_b"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT17545.1
FT                   protein_id=mCP6635.0 isoform=CRA_b"
FT                   /protein_id="EDL07170.1"
FT                   MLEEIGKVQTQSTAA"
FT   mRNA            complement(join(<5701770..5701937,5703141..5703263,
FT                   5713610..>5713773))
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, transcript variant mCT174590"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT174590.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(<5701770..5701937,5703141..5703263,
FT                   5713610..>5713621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, isoform CRA_a"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT174590.0
FT                   protein_id=mCP97509.0 isoform=CRA_a"
FT                   /protein_id="EDL07169.1"
FT   assembly_gap    5706605..5706924
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    5708097..5708145
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    5716735..5716754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5731375..>5741063)
FT                   /locus_tag="mCG_1028421"
FT                   /note="gene_id=mCG1028421.0"
FT   mRNA            complement(join(5731375..5731575,5734585..5734691,
FT                   5739626..5739805,5740986..>5741063))
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, transcript variant mCT146125"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT146125.0
FT                   created on 20-NOV-2002"
FT   mRNA            complement(join(5731375..5731575,5734585..5734691,
FT                   5739374..>5739474))
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, transcript variant mCT176329"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT176329.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(5731384..5731575,5734585..>5734638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, isoform CRA_b"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT176329.0
FT                   protein_id=mCP99251.0 isoform=CRA_b"
FT                   /protein_id="EDL07168.1"
FT   CDS             complement(join(5734607..5734691,5739626..5739805,
FT                   5740986..>5741005))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, isoform CRA_a"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT146125.0
FT                   protein_id=mCP88650.0 isoform=CRA_a"
FT                   /protein_id="EDL07167.1"
FT   gene            5738296..5827249
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /note="gene_id=mCG13843.2"
FT   mRNA            join(5738296..5738348,5765127..5765257,5768932..5769031,
FT                   5786195..5786280,5793609..5793786,5814613..5814795,
FT                   5817989..5818123,5822600..5822703,5825402..5827249)
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /product="hypothetical protein LOC434197"
FT                   /note="gene_id=mCG13843.2 transcript_id=mCT17547.2 created
FT                   on 27-MAY-2003"
FT   CDS             join(5738333..5738348,5765127..5765257,5768932..5769031,
FT                   5786195..5786280,5793609..5793786,5814613..5814795,
FT                   5817989..5818123,5822600..5822703,5825402..5825482)
FT                   /codon_start=1
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /product="hypothetical protein LOC434197"
FT                   /note="gene_id=mCG13843.2 transcript_id=mCT17547.2
FT                   protein_id=mCP6640.2"
FT                   /protein_id="EDL07165.1"
FT   assembly_gap    5754066..5754085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5768414..5768517
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    5791792..5791811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5818887..5818906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5825863..>5827241)
FT                   /locus_tag="mCG_1028420"
FT                   /note="gene_id=mCG1028420.0"
FT   mRNA            complement(join(5825863..5826192,5826334..5826731,
FT                   5826961..>5827241))
FT                   /locus_tag="mCG_1028420"
FT                   /product="mCG1028420"
FT                   /note="gene_id=mCG1028420.0 transcript_id=mCT146124.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(5826187..5826192,5826334..>5826624))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028420"
FT                   /product="mCG1028420"
FT                   /note="gene_id=mCG1028420.0 transcript_id=mCT146124.1
FT                   protein_id=mCP88636.1"
FT                   /protein_id="EDL07166.1"
FT   assembly_gap    5828105..5828205
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5834168..5834316
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    5839169..5839312
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    5847674..5847693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5862449..5862468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5881729..5890438
FT                   /locus_tag="mCG_13839"
FT                   /note="gene_id=mCG13839.1"
FT   mRNA            join(<5881729..5881835,5888898..5890038,5890154..5890438)
FT                   /locus_tag="mCG_13839"
FT                   /product="mCG13839"
FT                   /note="gene_id=mCG13839.1 transcript_id=mCT17544.1 created
FT                   on 20-NOV-2002"
FT   CDS             <5889171..5889674
FT                   /codon_start=1
FT                   /locus_tag="mCG_13839"
FT                   /product="mCG13839"
FT                   /note="gene_id=mCG13839.1 transcript_id=mCT17544.1
FT                   protein_id=mCP6645.1"
FT                   /protein_id="EDL07164.1"
FT                   KGCK"
FT   assembly_gap    5901031..5901070
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5944089..5944108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5959982..5960127
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    5965193..5965212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5974016..5974035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5976774..5976793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6005447..6005466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6036483..6036812
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   gene            <6083274..>6084020
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /note="gene_id=mCG63318.2"
FT   mRNA            <6083274..>6084020
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /product="similar to Transmembrane 4 superfamily member 2
FT                   (Cell surface glycoprotein A15) (PE31) (TALLA homolog)"
FT                   /note="gene_id=mCG63318.2 transcript_id=mCT63501.2 created
FT                   on 20-NOV-2002"
FT   CDS             6083274..6084020
FT                   /codon_start=1
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /product="similar to Transmembrane 4 superfamily member 2
FT                   (Cell surface glycoprotein A15) (PE31) (TALLA homolog)"
FT                   /note="gene_id=mCG63318.2 transcript_id=mCT63501.2
FT                   protein_id=mCP29146.2"
FT                   /protein_id="EDL07163.1"
FT   assembly_gap    6111177..6112515
FT                   /estimated_length=1339
FT                   /gap_type="unknown"
FT   assembly_gap    6117057..6117386
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    6167343..6167362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6183210..>6186271)
FT                   /locus_tag="mCG_1028418"
FT                   /note="gene_id=mCG1028418.1"
FT   mRNA            complement(join(6183210..6183742,6186182..>6186271))
FT                   /locus_tag="mCG_1028418"
FT                   /product="mCG1028418"
FT                   /note="gene_id=mCG1028418.1 transcript_id=mCT146122.1
FT                   created on 28-MAY-2003"
FT   CDS             complement(join(6183616..6183742,6186182..>6186270))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028418"
FT                   /product="mCG1028418"
FT                   /note="gene_id=mCG1028418.1 transcript_id=mCT146122.1
FT                   protein_id=mCP88623.1"
FT                   /protein_id="EDL07162.1"
FT   assembly_gap    6189920..6190222
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   gene            complement(6201128..6214046)
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /note="gene_id=mCG11874.2"
FT   mRNA            complement(join(6201128..6203666,6204018..6204172,
FT                   6205088..6205250,6205778..6206034,6206705..6206807,
FT                   6208915..6209062,6209278..6209344,6213615..6214046))
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /product="arrestin domain containing 4"
FT                   /note="gene_id=mCG11874.2 transcript_id=mCT12159.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(6203610..6203666,6204018..6204172,
FT                   6205088..6205250,6205778..6206034,6206705..6206807,
FT                   6208915..6209062,6209278..6209344,6213615..6213912))
FT                   /codon_start=1
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /product="arrestin domain containing 4"
FT                   /note="gene_id=mCG11874.2 transcript_id=mCT12159.2
FT                   protein_id=mCP6634.2"
FT                   /db_xref="GOA:A0A0B4J1F4"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="MGI:MGI:1913662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0B4J1F4"
FT                   /protein_id="EDL07161.1"
FT                   PHPGDAQETQPVSFIL"
FT   assembly_gap    6209851..6210705
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    6212651..6212670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6251506..6251959
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    6253041..6253060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6264018..6264231
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    6270228..6270339
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    6286833..6286852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6293910..6293929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6300335..6300401
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    6347380..6347508
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    6352963..6353116
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    6354407..6354426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6389463..6389537
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    6400702..6400721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6415338..6415638
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    6417283..6417457
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    6431970..6431989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6433038..6433057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6434344..6434363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6437671..6437892
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    6481772..6482203
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    6483507..6483964
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    6485745..6485874
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    6489946..6490087
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    6525310..6525329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6561653..6561672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6572843..6573038
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    6590699..6591172
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    6617752..6618186
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    6625281..6625300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6634278..6634477
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   gene            6669011..6670035
FT                   /pseudo
FT                   /locus_tag="mCG_11875"
FT                   /note="gene_id=mCG11875.0"
FT   mRNA            6669011..6670035
FT                   /pseudo
FT                   /locus_tag="mCG_11875"
FT                   /note="gene_id=mCG11875.0 transcript_id=mCT12160.1 created
FT                   on 19-NOV-2002"
FT   assembly_gap    6676053..6676652
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    6681570..6681589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6682839..6682858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6688148..6688167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6689863..6689882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6728345..6728364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6746457..6746729
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    6756683..6756740
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6776857..6776876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6782466..6782606
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    6803860..6803879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6805379..6805417
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    6809781..6809800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6825783..6825984
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    6836674..6836693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6846155..6846174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6861575..6861594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6897767..6897786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6912831..6912850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6923568..6923587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6924949..6924968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6947606..6947625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6954544..6958284
FT                   /locus_tag="mCG_144577"
FT                   /note="gene_id=mCG144577.0"
FT   mRNA            join(<6954544..6954617,6955114..6955178,6957422..6958284)
FT                   /locus_tag="mCG_144577"
FT                   /product="mCG144577"
FT                   /note="gene_id=mCG144577.0 transcript_id=mCT184001.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    6956791..6956810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <6957781..6957963
FT                   /codon_start=1
FT                   /locus_tag="mCG_144577"
FT                   /product="mCG144577"
FT                   /note="gene_id=mCG144577.0 transcript_id=mCT184001.0
FT                   protein_id=mCP106147.0"
FT                   /protein_id="EDL07160.1"
FT                   PAPLKKLSLPQRLLS"
FT   assembly_gap    6986354..6986394
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    6993960..6994055
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    7020878..7021083
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    7022341..7022569
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    7064429..7064448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7064563..>7065577)
FT                   /locus_tag="mCG_7742"
FT                   /note="gene_id=mCG7742.2"
FT   mRNA            complement(7064563..>7065577)
FT                   /locus_tag="mCG_7742"
FT                   /product="mCG7742"
FT                   /note="gene_id=mCG7742.2 transcript_id=mCT6768.2 created on
FT                   19-NOV-2002"
FT   CDS             complement(7064685..>7065290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7742"
FT                   /product="mCG7742"
FT                   /note="gene_id=mCG7742.2 transcript_id=mCT6768.2
FT                   protein_id=mCP6642.1"
FT                   /protein_id="EDL07159.1"
FT   assembly_gap    7091845..7091864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7096813..7097285
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    7115782..7116684
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   assembly_gap    7140505..7140831
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    7142122..7142284
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    7159704..7159749
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    7167393..7167412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7171762..7171783
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7217289..7218021
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   assembly_gap    7252296..7252329
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    7260223..7260242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7286181..7286594
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    7323962..7323981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7351626..7351654
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7378970..7379298
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    7464153..7464338
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    7478524..7478734
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    7483890..7484122
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    7508607..7508626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7535979..7536109
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    7544614..7544633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7586460..7586790
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    7588418..7588437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7623786..7623887
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    7626260..7626404
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    7659130..7662075
FT                   /estimated_length=2946
FT                   /gap_type="unknown"
FT   assembly_gap    7668028..7668178
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    7671058..7671077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7706370..7706472
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    7712694..7712713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7714838..7714857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7736271..7800856)
FT                   /locus_tag="mCG_141100"
FT                   /note="gene_id=mCG141100.0"
FT   mRNA            complement(join(7736271..7736507,7747598..7747758,
FT                   7748114..7748229,7800720..7800856))
FT                   /locus_tag="mCG_141100"
FT                   /product="mCG141100"
FT                   /note="gene_id=mCG141100.0 transcript_id=mCT173106.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(7736423..7736507,7747598..7747734))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141100"
FT                   /product="mCG141100"
FT                   /note="gene_id=mCG141100.0 transcript_id=mCT173106.0
FT                   protein_id=mCP96025.0"
FT                   /protein_id="EDL07158.1"
FT   assembly_gap    7737728..7737747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7745541..7745560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7750086..7750129
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7758569..7759016
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    7797384..7797403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7797737..7797855
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            <7814969..7815414
FT                   /locus_tag="mCG_1028256"
FT                   /note="gene_id=mCG1028256.0"
FT   mRNA            join(<7814969..7815176,7815228..7815414)
FT                   /locus_tag="mCG_1028256"
FT                   /product="mCG1028256"
FT                   /note="gene_id=mCG1028256.0 transcript_id=mCT145960.0
FT                   created on 12-SEP-2002"
FT   CDS             join(<7814996..7815176,7815228..7815229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028256"
FT                   /product="mCG1028256"
FT                   /note="gene_id=mCG1028256.0 transcript_id=mCT145960.0
FT                   protein_id=mCP88735.0"
FT                   /protein_id="EDL07157.1"
FT                   NKQPTKPPSTGQMLC"
FT   gene            complement(7816453..7828847)
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /note="gene_id=mCG9458.2"
FT   mRNA            complement(join(7816453..7817943,7820775..7821304,
FT                   7824095..7824122))
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   transcript variant mCT8980"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT8980.2 created on
FT                   12-SEP-2002"
FT   mRNA            complement(join(7817359..7817943,7820775..7821302,
FT                   7828814..7828847))
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   transcript variant mCT173135"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT173135.0 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(7817669..7817943,7820775..7821285))
FT                   /codon_start=1
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT173135.0
FT                   protein_id=mCP96054.0 isoform=CRA_a"
FT                   /protein_id="EDL07155.1"
FT   CDS             complement(join(7817669..7817943,7820775..7821285))
FT                   /codon_start=1
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT8980.2
FT                   protein_id=mCP7348.2 isoform=CRA_a"
FT                   /protein_id="EDL07156.1"
FT   assembly_gap    7822523..7823916
FT                   /estimated_length=1394
FT                   /gap_type="unknown"
FT   gene            <7828106..7873756
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /note="gene_id=mCG145717.0"
FT   mRNA            join(<7828106..7828212,7849170..7849225,7850853..7851005,
FT                   7851250..7851431,7852743..7852871,7861880..7862018,
FT                   7864711..7864806,7865043..7865164,7866866..7867002,
FT                   7869219..7869349,7873201..7873756)
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, transcript variant
FT                   mCT185289"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185289.0
FT                   created on 11-JUN-2003"
FT   mRNA            join(<7828106..7828212,7849170..7849225,7850853..7851005,
FT                   7851250..7851431,7852743..7852871,7861880..7862018,
FT                   7864711..7864806,7865038..7865137)
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, transcript variant
FT                   mCT185290"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185290.0
FT                   created on 11-JUN-2003"
FT   assembly_gap    7842460..7842483
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    7847427..7847452
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   CDS             join(<7849182..7849225,7850853..7851005,7851250..7851388)
FT                   /codon_start=1
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, isoform CRA_a"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185289.0
FT                   protein_id=mCP106548.0 isoform=CRA_a"
FT                   /protein_id="EDL07153.1"
FT                   LALNSPS"
FT   CDS             join(<7849182..7849225,7850853..7851005,7851250..7851388)
FT                   /codon_start=1
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, isoform CRA_a"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185290.0
FT                   protein_id=mCP106547.0 isoform=CRA_a"
FT                   /protein_id="EDL07154.1"
FT                   LALNSPS"
FT   assembly_gap    7849583..7849716
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    7857112..7857286
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            complement(7883523..7915863)
FT                   /locus_tag="mCG_147208"
FT                   /note="gene_id=mCG147208.0"
FT   mRNA            complement(join(7883523..7886044,7915791..7915863))
FT                   /locus_tag="mCG_147208"
FT                   /product="mCG147208"
FT                   /note="gene_id=mCG147208.0 transcript_id=mCT187471.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7885451..7885630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147208"
FT                   /product="mCG147208"
FT                   /note="gene_id=mCG147208.0 transcript_id=mCT187471.0
FT                   protein_id=mCP109615.0"
FT                   /protein_id="EDL07152.1"
FT                   ESQHWVRSNWTSVN"
FT   assembly_gap    7935034..7935466
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    7938975..7939103
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            <7953661..7954568
FT                   /locus_tag="mCG_49664"
FT                   /note="gene_id=mCG49664.2"
FT   mRNA            <7953661..7954568
FT                   /locus_tag="mCG_49664"
FT                   /product="mCG49664"
FT                   /note="gene_id=mCG49664.2 transcript_id=mCT49847.2 created
FT                   on 19-NOV-2002"
FT   CDS             7953661..7953987
FT                   /codon_start=1
FT                   /locus_tag="mCG_49664"
FT                   /product="mCG49664"
FT                   /note="gene_id=mCG49664.2 transcript_id=mCT49847.2
FT                   protein_id=mCP29890.2"
FT                   /protein_id="EDL07151.1"
FT                   PREV"
FT   assembly_gap    7965065..7965248
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    7980000..7980408
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    7985664..7985683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7988814..7989256
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    8014662..8014687
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    8032737..8038201
FT                   /estimated_length=5465
FT                   /gap_type="unknown"
FT   assembly_gap    8097964..8098545
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    8105377..8105396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8113500..8113519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8149009..8149165
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    8154666..8154685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8173803..8174030
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    8185008..8185027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8210288..8210451
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    8239960..8239982
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8248180..8248228
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    8296801..8297024
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   gene            <8328246..8369314
FT                   /locus_tag="mCG_1028254"
FT                   /note="gene_id=mCG1028254.1"
FT   mRNA            join(<8328246..8328503,8369229..8369314)
FT                   /locus_tag="mCG_1028254"
FT                   /product="mCG1028254"
FT                   /note="gene_id=mCG1028254.1 transcript_id=mCT145958.1
FT                   created on 19-NOV-2002"
FT   CDS             join(<8328280..8328503,8369229..8369241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028254"
FT                   /product="mCG1028254"
FT                   /note="gene_id=mCG1028254.1 transcript_id=mCT145958.1
FT                   protein_id=mCP88994.1"
FT                   /protein_id="EDL07150.1"
FT   assembly_gap    8329888..8329907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8354668..8355622
FT                   /estimated_length=955
FT                   /gap_type="unknown"
FT   assembly_gap    8357780..8357799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8361344..8361363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8383073..8383166
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    8404904..8404923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8435520..8435539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8442357..8442376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8472791..8472810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8477251..8477309
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8478535..8479309
FT                   /estimated_length=775
FT                   /gap_type="unknown"
FT   assembly_gap    8482750..8483196
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    8500760..8500793
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    8518529..8518548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8521951..8521970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8542300..>8570447)
FT                   /locus_tag="mCG_145070"
FT                   /note="gene_id=mCG145070.0"
FT   mRNA            complement(join(8542300..8544623,8548779..8548866,
FT                   8549234..8549328,8562580..8562667,8570198..8570285,
FT                   8570413..>8570447))
FT                   /locus_tag="mCG_145070"
FT                   /product="mCG145070"
FT                   /note="gene_id=mCG145070.0 transcript_id=mCT184494.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(8543313..>8543585)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145070"
FT                   /product="mCG145070"
FT                   /note="gene_id=mCG145070.0 transcript_id=mCT184494.0
FT                   protein_id=mCP106149.0"
FT                   /protein_id="EDL07149.1"
FT   assembly_gap    8574593..8574796
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    8592441..8592512
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    8593968..8594011
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    8611514..8611533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8618870..8618943
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    8622889..8623031
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    8636736..8636755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8644546..8644565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8647377..8647396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8678955..8681131
FT                   /estimated_length=2177
FT                   /gap_type="unknown"
FT   assembly_gap    8709697..8709716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8721549..8726369
FT                   /estimated_length=4821
FT                   /gap_type="unknown"
FT   assembly_gap    8745594..8745613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8746702..8746902
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    8748413..8748432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8751297..8751316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8752758..8753032
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    8754167..8754186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8755350..8755369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8757085..8757104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8760241..8760260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8826544..8826658
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    8842563..8842582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8866890..8866909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8878852..8884358
FT                   /estimated_length=5507
FT                   /gap_type="unknown"
FT   assembly_gap    8895769..8896350
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    8916244..8917319
FT                   /estimated_length=1076
FT                   /gap_type="unknown"
FT   assembly_gap    8923788..8923807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8973022..8973041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9012357..9014395
FT                   /estimated_length=2039
FT                   /gap_type="unknown"
FT   assembly_gap    9016008..9016027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9021084..9022722
FT                   /estimated_length=1639
FT                   /gap_type="unknown"
FT   assembly_gap    9024741..9025238
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    9038341..9038400
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9050332..9050366
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    9064831..9065390
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    9080447..9080956
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    9099993..9100019
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            9163715..9164422
FT                   /pseudo
FT                   /locus_tag="mCG_50813"
FT                   /note="gene_id=mCG50813.2"
FT   mRNA            9163715..9164422
FT                   /pseudo
FT                   /locus_tag="mCG_50813"
FT                   /note="gene_id=mCG50813.2 transcript_id=mCT50996.2 created
FT                   on 19-NOV-2002"
FT   assembly_gap    9166393..9166540
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9178846..9178865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9193381..9193400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9226139..9226158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9234910..9235008
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    9261097..9261129
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    9269113..9269299
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    9275904..9275923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9276934..9276953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9283729..9283748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9290384..9290403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9322485..9322777
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    9323602..9323886
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    9343502..9343785
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    9349702..9349721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9352861..9352950
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            9375744..9404578
FT                   /locus_tag="mCG_63065"
FT                   /note="gene_id=mCG63065.1"
FT   mRNA            join(9375744..9376004,9400552..9400700,9404488..9404578)
FT                   /locus_tag="mCG_63065"
FT                   /product="mCG63065"
FT                   /note="gene_id=mCG63065.1 transcript_id=mCT63248.2 created
FT                   on 15-JAN-2003"
FT   assembly_gap    9381917..9381936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9382958..9382977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9400570..9400700,9404488..9404497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63065"
FT                   /product="mCG63065"
FT                   /note="gene_id=mCG63065.1 transcript_id=mCT63248.2
FT                   protein_id=mCP29891.2"
FT                   /protein_id="EDL07148.1"
FT                   N"
FT   gene            complement(9413033..>9427392)
FT                   /locus_tag="mCG_1028389"
FT                   /note="gene_id=mCG1028389.1"
FT   mRNA            complement(join(9413033..9413124,9422159..9422268,
FT                   9422467..9422583,9423925..9424068,9427328..>9427392))
FT                   /locus_tag="mCG_1028389"
FT                   /product="mCG1028389"
FT                   /note="gene_id=mCG1028389.1 transcript_id=mCT146093.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(9422504..9422583,9423925..>9424057))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028389"
FT                   /product="mCG1028389"
FT                   /note="gene_id=mCG1028389.1 transcript_id=mCT146093.1
FT                   protein_id=mCP89035.1"
FT                   /protein_id="EDL07147.1"
FT   gene            <9426545..9488332
FT                   /locus_tag="mCG_145908"
FT                   /note="gene_id=mCG145908.0"
FT   mRNA            join(<9426545..9426628,9434817..9434874,9488110..9488332)
FT                   /locus_tag="mCG_145908"
FT                   /product="mCG145908"
FT                   /note="gene_id=mCG145908.0 transcript_id=mCT186016.0
FT                   created on 04-JUL-2003"
FT   assembly_gap    9431159..9432510
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   CDS             join(<9434861..9434874,9488110..9488290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145908"
FT                   /product="mCG145908"
FT                   /note="gene_id=mCG145908.0 transcript_id=mCT186016.0
FT                   protein_id=mCP107704.0"
FT                   /protein_id="EDL07146.1"
FT   assembly_gap    9439095..9445535
FT                   /estimated_length=6441
FT                   /gap_type="unknown"
FT   assembly_gap    9458518..9458582
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(9541408..>9675579)
FT                   /locus_tag="mCG_119297"
FT                   /note="gene_id=mCG119297.1"
FT   mRNA            complement(join(9541408..9541766,9541784..9541852,
FT                   9541903..9541990,9564242..9564351,9571629..9571685,
FT                   9574393..9574542,9582793..9582834,9588241..9588363,
FT                   9621694..9621751,9625084..9625203,9626261..9626390,
FT                   9627142..9627216,9628554..9628655,9647770..9647872,
FT                   9649728..9649830,9664303..9664396,9666246..9666432,
FT                   9675515..>9675579))
FT                   /locus_tag="mCG_119297"
FT                   /product="mCG119297"
FT                   /note="gene_id=mCG119297.1 transcript_id=mCT120467.1
FT                   created on 19-NOV-2002"
FT   assembly_gap    9542504..9543222
FT                   /estimated_length=719
FT                   /gap_type="unknown"
FT   assembly_gap    9549508..9549527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9585970..9586333
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    9593019..9593038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9594181..9594200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9595383..9595402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9599787..9600006
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    9603525..9603803
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    9606282..9606301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(9626376..9626390,9627142..9627216,
FT                   9628554..9628655,9647770..9647872,9649728..9649830,
FT                   9664303..9664396,9666246..9666432,9675515..9675579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119297"
FT                   /product="mCG119297"
FT                   /note="gene_id=mCG119297.1 transcript_id=mCT120467.1
FT                   protein_id=mCP88664.1"
FT                   /protein_id="EDL07145.1"
FT   assembly_gap    9672629..9672693
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    9685482..9685660
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            complement(9689475..>9693467)
FT                   /locus_tag="mCG_144575"
FT                   /note="gene_id=mCG144575.0"
FT   mRNA            complement(join(9689475..9692198,9692578..9692654,
FT                   9693434..>9693467))
FT                   /locus_tag="mCG_144575"
FT                   /product="mCG144575"
FT                   /note="gene_id=mCG144575.0 transcript_id=mCT183999.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(9689634..>9689900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144575"
FT                   /product="mCG144575"
FT                   /note="gene_id=mCG144575.0 transcript_id=mCT183999.0
FT                   protein_id=mCP106145.0"
FT                   /protein_id="EDL07144.1"
FT   assembly_gap    9700580..9700914
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    9714829..9714930
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    9746649..9746799
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    9750756..9750775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9788750..9788785
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    9789883..9789920
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    9812841..9812860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9821426..9821445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9824894..9824913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9826059..9826078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9827405..9827424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9843032..9843388
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    9874122..9874141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9880217..9880236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9926892..9927646
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    9928372..9928917
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    9957419..9960018
FT                   /estimated_length=2600
FT                   /gap_type="unknown"
FT   assembly_gap    9968935..9968954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9987300..9987319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9990864..9990883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9993441..9993568
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    10012033..10012075
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    10070231..10070534
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    10077899..10078065
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    10088113..10088220
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    10095102..10095121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10109634..10109653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10121592..10127525
FT                   /estimated_length=5934
FT                   /gap_type="unknown"
FT   assembly_gap    10128110..10128840
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   gene            complement(10129460..>10131565)
FT                   /locus_tag="mCG_141645"
FT                   /note="gene_id=mCG141645.0"
FT   mRNA            complement(join(10129460..10130628,10130731..>10131565))
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, transcript variant mCT176115"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176115.0
FT                   created on 19-NOV-2002"
FT   mRNA            complement(join(10129460..10129926,10130040..10130377,
FT                   10130731..>10131134))
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, transcript variant mCT176116"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176116.0
FT                   created on 19-NOV-2002"
FT   CDS             complement(10129546..>10129788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, isoform CRA_b"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176116.0
FT                   protein_id=mCP99037.0 isoform=CRA_b"
FT                   /protein_id="EDL07143.1"
FT   CDS             complement(10130965..>10131459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, isoform CRA_a"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176115.0
FT                   protein_id=mCP99038.0 isoform=CRA_a"
FT                   /protein_id="EDL07142.1"
FT                   E"
FT   assembly_gap    10144926..10144945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10169320..10170307)
FT                   /pseudo
FT                   /locus_tag="mCG_19746"
FT                   /note="gene_id=mCG19746.1"
FT   mRNA            complement(10169320..10170307)
FT                   /pseudo
FT                   /locus_tag="mCG_19746"
FT                   /note="gene_id=mCG19746.1 transcript_id=mCT21805.1 created
FT                   on 19-NOV-2002"
FT   assembly_gap    10180611..10180844
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    10202858..10202877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10205519..10213168
FT                   /estimated_length=7650
FT                   /gap_type="unknown"
FT   assembly_gap    10215422..10215870
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    10219178..10219197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10242743..10246344
FT                   /estimated_length=3602
FT                   /gap_type="unknown"
FT   assembly_gap    10274086..10278616
FT                   /estimated_length=4531
FT                   /gap_type="unknown"
FT   assembly_gap    10282758..10283227
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    10284425..10284444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10285449..10285468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10286655..10286674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10287831..10287850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10289439..10290440
FT                   /estimated_length=1002
FT                   /gap_type="unknown"
FT   assembly_gap    10324731..10325450
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    10353750..10353769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10354803..10354822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10355799..10355818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10380293..10380410
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    10383434..10383843
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    10385532..10390174
FT                   /estimated_length=4643
FT                   /gap_type="unknown"
FT   assembly_gap    10391189..10395184
FT                   /estimated_length=3996
FT                   /gap_type="unknown"
FT   assembly_gap    10396951..10397108
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    10429525..10429544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10440581..10440600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10442515..10442534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10453634..10454624)
FT                   /pseudo
FT                   /locus_tag="mCG_19748"
FT                   /note="gene_id=mCG19748.2"
FT   mRNA            complement(10453634..10454624)
FT                   /pseudo
FT                   /locus_tag="mCG_19748"
FT                   /note="gene_id=mCG19748.2 transcript_id=mCT21807.2 created
FT                   on 19-NOV-2002"
FT   assembly_gap    10489853..10489872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10494569..10494588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10499905..10499924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10507680..10509439
FT                   /estimated_length=1760
FT                   /gap_type="unknown"
FT   assembly_gap    10526774..10527601
FT                   /estimated_length=828
FT                   /gap_type="unknown"
FT   assembly_gap    10533882..10533901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10535239..10535387
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    10536470..10537197
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   gene            complement(10554751..>10559064)
FT                   /locus_tag="mCG_145074"
FT                   /note="gene_id=mCG145074.0"
FT   mRNA            complement(join(10554751..10555271,10556218..10556369,
FT                   10557649..>10559064))
FT                   /locus_tag="mCG_145074"
FT                   /product="mCG145074"
FT                   /note="gene_id=mCG145074.0 transcript_id=mCT184498.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10555020..10555271,10556218..10556369,
FT                   10557649..>10557691))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145074"
FT                   /product="mCG145074"
FT                   /note="gene_id=mCG145074.0 transcript_id=mCT184498.0
FT                   protein_id=mCP106153.0"
FT                   /protein_id="EDL07141.1"
FT   assembly_gap    10576277..10576296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10580984..10581003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10582012..10582031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10592856..10592875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10596833..10596852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10609019..10609038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10618666..10619699
FT                   /estimated_length=1034
FT                   /gap_type="unknown"
FT   gene            <10636584..10640260
FT                   /locus_tag="mCG_59835"
FT                   /note="gene_id=mCG59835.2"
FT   mRNA            join(<10636584..10636811,10637911..10638026,
FT                   10639448..10640260)
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, transcript variant mCT60018"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT60018.2 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<10636645..10636811,10639448..10640260)
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, transcript variant mCT176121"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT176121.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(<10636763..10636811,10637911..10638026,
FT                   10639448..10639558)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, isoform CRA_b"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT60018.2
FT                   protein_id=mCP29852.2 isoform=CRA_b"
FT                   /protein_id="EDL07140.1"
FT   CDS             <10639998..10640228
FT                   /codon_start=1
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, isoform CRA_a"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT176121.0
FT                   protein_id=mCP99043.0 isoform=CRA_a"
FT                   /protein_id="EDL07139.1"
FT   assembly_gap    10663045..10663640
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    10665282..10667086
FT                   /estimated_length=1805
FT                   /gap_type="unknown"
FT   assembly_gap    10668636..10669536
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    10675559..10675654
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    10679021..10680791
FT                   /estimated_length=1771
FT                   /gap_type="unknown"
FT   assembly_gap    10687601..10687620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10688484..10688910
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    10690019..10690038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10693861..10694401
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    10715205..10715224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10730417..10730588
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    10749220..10749493
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            10761852..>10763275
FT                   /locus_tag="mCG_147207"
FT                   /note="gene_id=mCG147207.0"
FT   mRNA            join(10761852..10762035,10762977..>10763275)
FT                   /locus_tag="mCG_147207"
FT                   /product="mCG147207"
FT                   /note="gene_id=mCG147207.0 transcript_id=mCT187470.0
FT                   created on 13-JAN-2004"
FT   CDS             10763111..>10763275
FT                   /codon_start=1
FT                   /locus_tag="mCG_147207"
FT                   /product="mCG147207"
FT                   /note="gene_id=mCG147207.0 transcript_id=mCT187470.0
FT                   protein_id=mCP109614.0"
FT                   /protein_id="EDL07138.1"
FT                   HINIFTFTFM"
FT   assembly_gap    10776428..10779473
FT                   /estimated_length=3046
FT                   /gap_type="unknown"
FT   assembly_gap    10787955..10788542
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    10794650..10794853
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    10801889..10801950
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    10803595..10803694
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    10812494..10812513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10827520..10827539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10828711..10829190
FT                   /pseudo
FT                   /locus_tag="mCG_1028161"
FT                   /note="gene_id=mCG1028161.1"
FT   mRNA            10828711..10829190
FT                   /pseudo
FT                   /locus_tag="mCG_1028161"
FT                   /note="gene_id=mCG1028161.1 transcript_id=mCT145865.1
FT                   created on 13-NOV-2002"
FT   assembly_gap    10830597..10830727
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            <10830728..10875229
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /note="gene_id=mCG50423.3"
FT   mRNA            join(<10830728..10831093,10864565..10865082,
FT                   10872648..10875228)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT189927"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT189927.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<10830784..10831093,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_b"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT189927.0
FT                   protein_id=mCP110927.0 isoform=CRA_b"
FT                   /protein_id="EDL07136.1"
FT   mRNA            join(10830893..10831093,10846718..10846833,
FT                   10864565..10865082,10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT50606"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT50606.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(10831080..10831093,10846718..10846833,
FT                   10864565..10865082,10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_c"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT50606.2
FT                   protein_id=mCP29916.2 isoform=CRA_c"
FT                   /protein_id="EDL07137.1"
FT   assembly_gap    10846224..10846392
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   mRNA            join(10846493..10846537,10846718..10846833,
FT                   10864565..10865082,10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT176118"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176118.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(10846554..10846833,10864565..10865082,
FT                   10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT176117"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176117.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(10846752..10846833,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176117.0
FT                   protein_id=mCP99040.0 isoform=CRA_a"
FT                   /protein_id="EDL07134.1"
FT   CDS             join(10846752..10846833,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176118.0
FT                   protein_id=mCP99039.0 isoform=CRA_a"
FT                   /protein_id="EDL07135.1"
FT   assembly_gap    10862110..10862129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10866159..10866388
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    10870488..10870589
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    10881542..10881567
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   gene            complement(<10891050..10997329)
FT                   /locus_tag="mCG_19747"
FT                   /note="gene_id=mCG19747.2"
FT   mRNA            complement(join(<10891050..10891293,10896901..10897114,
FT                   10899550..10899649,10902450..10902628,10904472..10904606,
FT                   10907014..10907154,10908414..10908542,10909644..10909766,
FT                   10910806..10910956,10911089..10911227,10918956..10919095,
FT                   10919668..10919709,10923764..10923939,10924866..10925036,
FT                   10927105..10927197,10928320..10928416,10929816..10929964,
FT                   10930654..10930803,10933969..10934040,10935711..10935863,
FT                   10936271..10936433,10940029..10940217,10946099..10946289,
FT                   10946955..10947044,10949045..10949261,10953328..10953452,
FT                   10955215..10955393,10955560..10955604,10956556..10956656,
FT                   10957530..10957776,10959001..10959134,10960608..10960748,
FT                   10963343..10963450,10969627..10969688,10971263..10971349,
FT                   10975013..10975244,10996354..10996486,10996828..10997329))
FT                   /locus_tag="mCG_19747"
FT                   /product="mCG19747"
FT                   /note="gene_id=mCG19747.2 transcript_id=mCT21806.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(<10891050..10891293,10896901..10897114,
FT                   10899550..10899649,10902450..10902628,10904472..10904606,
FT                   10907014..10907154,10908414..10908542,10909644..10909766,
FT                   10910806..10910956,10911089..10911227,10918956..10919095,
FT                   10919668..10919709,10923764..10923939,10924866..10925036,
FT                   10927105..10927197,10928320..10928416,10929816..10929964,
FT                   10930654..10930803,10933969..10934040,10935711..10935863,
FT                   10936271..10936433,10940029..10940217,10946099..10946289,
FT                   10946955..10947044,10949045..10949261,10953328..10953452,
FT                   10955215..10955393,10955560..10955604,10956556..10956656,
FT                   10957530..10957776,10959001..10959134,10960608..10960748,
FT                   10963343..10963450,10969627..10969688,10971263..10971349,
FT                   10975013..10975244,10996354..10996415))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19747"
FT                   /product="mCG19747"
FT                   /note="gene_id=mCG19747.2 transcript_id=mCT21806.2
FT                   protein_id=mCP7263.1"
FT                   /protein_id="EDL07132.1"
FT   assembly_gap    10939112..10939724
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    10962566..10962685
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    10979139..10979158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10979383..10983512
FT                   /locus_tag="mCG_147201"
FT                   /note="gene_id=mCG147201.0"
FT   mRNA            join(10979383..10980717,10983450..10983512)
FT                   /locus_tag="mCG_147201"
FT                   /product="mCG147201"
FT                   /note="gene_id=mCG147201.0 transcript_id=mCT187464.0
FT                   created on 13-JAN-2004"
FT   CDS             10979879..10980037
FT                   /codon_start=1
FT                   /locus_tag="mCG_147201"
FT                   /product="mCG147201"
FT                   /note="gene_id=mCG147201.0 transcript_id=mCT187464.0
FT                   protein_id=mCP109608.0"
FT                   /protein_id="EDL07133.1"
FT                   NRVTSIS"
FT   assembly_gap    10987569..10987588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10999492..>11013825)
FT                   /locus_tag="mCG_113526"
FT                   /note="gene_id=mCG113526.1"
FT   mRNA            complement(join(10999492..10999964,11005179..11005234,
FT                   11010831..11010909,11011432..11011497,11013616..>11013825))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT114610"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT114610.1
FT                   created on 18-OCT-2002"
FT   mRNA            complement(join(10999619..10999964,11005179..11005234,
FT                   11010831..11010909,11013616..>11013724))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174578"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174578.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(10999813..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_b"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174578.0
FT                   protein_id=mCP97500.0 isoform=CRA_b"
FT                   /protein_id="EDL07128.1"
FT                   IIQPTQDSFNVDSMK"
FT   mRNA            complement(join(<10999825..10999964,11005179..11005234,
FT                   11009075..11009165,11010831..11010909,11011432..>11011500))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174581"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174581.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(<10999825..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_d"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174581.0
FT                   protein_id=mCP97497.0 isoform=CRA_d"
FT                   /protein_id="EDL07131.1"
FT                   IIQPTQDSFNVD"
FT   mRNA            complement(join(<10999846..10999964,11005179..11005234,
FT                   11010831..11010909,11011432..11011497,11013352..>11013383))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174580"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174580.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(<10999846..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_c"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174580.0
FT                   protein_id=mCP97499.0 isoform=CRA_c"
FT                   /protein_id="EDL07130.1"
FT                   IIQPT"
FT   mRNA            complement(join(10999888..10999964,11005179..11005234,
FT                   11011432..11011497,11013616..>11013825))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174579"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174579.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(11011475..11011497,11013616..>11013823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_a"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT114610.1
FT                   protein_id=mCP88714.1 isoform=CRA_a"
FT                   /protein_id="EDL07127.1"
FT   CDS             complement(join(11011475..11011497,11013616..>11013823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_a"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174579.0
FT                   protein_id=mCP97498.0 isoform=CRA_a"
FT                   /protein_id="EDL07129.1"
FT   assembly_gap    11013935..11013983
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    11018358..11018499
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    11032311..11032330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11042934..11043467
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    11044958..11045273
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    11046878..11047368
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    11048675..11049544
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    11057111..11057267
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    11059893..11060334
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    11078547..11078566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11089554..11089573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11101423..11101741
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    11128365..11132010
FT                   /estimated_length=3646
FT                   /gap_type="unknown"
FT   assembly_gap    11133654..11133673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11138865..>11140312)
FT                   /locus_tag="mCG_61177"
FT                   /note="gene_id=mCG61177.1"
FT   mRNA            complement(11138865..>11140312)
FT                   /locus_tag="mCG_61177"
FT                   /product="mCG61177"
FT                   /note="gene_id=mCG61177.1 transcript_id=mCT61360.1 created
FT                   on 13-NOV-2002"
FT   CDS             complement(11139263..11140312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61177"
FT                   /product="mCG61177"
FT                   /note="gene_id=mCG61177.1 transcript_id=mCT61360.1
FT                   protein_id=mCP29917.0"
FT                   /protein_id="EDL07126.1"
FT                   DTSELEEGR"
FT   assembly_gap    11164525..11164929
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    11170403..11170733
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    11176720..11176816
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            11194092..11231122
FT                   /locus_tag="mCG_18431"
FT                   /note="gene_id=mCG18431.2"
FT   mRNA            join(11194092..11194802,11220702..11220833,
FT                   11229099..11231122)
FT                   /locus_tag="mCG_18431"
FT                   /product="mCG18431"
FT                   /note="gene_id=mCG18431.2 transcript_id=mCT11506.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(11194477..11194802,11220702..11220833,
FT                   11229099..11229102)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18431"
FT                   /product="mCG18431"
FT                   /note="gene_id=mCG18431.2 transcript_id=mCT11506.2
FT                   protein_id=mCP7248.2"
FT                   /protein_id="EDL07125.1"
FT   assembly_gap    11197802..11197821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11199907..11199926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11213407..11213426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11215617..11215636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11238266..>11270634)
FT                   /locus_tag="mCG_141101"
FT                   /note="gene_id=mCG141101.0"
FT   mRNA            complement(join(11238266..11238319,11264569..11264672,
FT                   11265713..11265776,11267080..11267184,11270139..11270370,
FT                   11270546..>11270634))
FT                   /locus_tag="mCG_141101"
FT                   /product="mCG141101"
FT                   /note="gene_id=mCG141101.0 transcript_id=mCT173108.0
FT                   created on 10-SEP-2002"
FT   assembly_gap    11252578..11252597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(11270181..11270370,11270546..>11270631))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141101"
FT                   /product="mCG141101"
FT                   /note="gene_id=mCG141101.0 transcript_id=mCT173108.0
FT                   protein_id=mCP96027.0"
FT                   /protein_id="EDL07124.1"
FT   assembly_gap    11274874..11274893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11306729..11306748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11324457..11324487
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    11336928..11336978
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    11346432..11346485
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    11382996..11383057
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    11385439..11385458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11390607..11390626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11393629..11468372)
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /note="gene_id=mCG113522.0"
FT   mRNA            complement(join(11393629..11397972,11415213..11415506,
FT                   11421259..11421516,11426443..11426571,11431138..11431200,
FT                   11468108..11468372))
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 2"
FT                   /note="gene_id=mCG113522.0 transcript_id=mCT114606.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(11397687..11397972,11415213..11415506,
FT                   11421259..11421516,11426443..11426571,11431138..11431200,
FT                   11468108..11468205))
FT                   /codon_start=1
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 2"
FT                   /note="gene_id=mCG113522.0 transcript_id=mCT114606.0
FT                   protein_id=mCP88967.1"
FT                   /db_xref="GOA:O35696"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:106020"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35696"
FT                   /protein_id="EDL07123.1"
FT   assembly_gap    11431029..11431048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11465111..11465389
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    11468395..11468431
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    11470257..11470719
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    11503914..11503933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11520561..11521173
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    11537593..11539911
FT                   /estimated_length=2319
FT                   /gap_type="unknown"
FT   assembly_gap    11541058..11541933
FT                   /estimated_length=876
FT                   /gap_type="unknown"
FT   assembly_gap    11543551..11543859
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    11588266..11588697
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    11590486..11590661
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    11601480..11601730
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    11646846..11648047
FT                   /estimated_length=1202
FT                   /gap_type="unknown"
FT   assembly_gap    11666557..11667237
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    11677083..11677102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11682052..11682491
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    11683747..11685770
FT                   /estimated_length=2024
FT                   /gap_type="unknown"
FT   assembly_gap    11687202..11690063
FT                   /estimated_length=2862
FT                   /gap_type="unknown"
FT   assembly_gap    11703261..11703596
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   gene            complement(11730433..12009567)
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /note="gene_id=mCG141102.1"
FT   mRNA            complement(join(11730433..11730519,11739249..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..>11775482))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT185130"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185130.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(11730437..11730519,11739249..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..>11775482))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_b"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185130.0
FT                   protein_id=mCP106389.0 isoform=CRA_b"
FT                   /protein_id="EDL07120.1"
FT   mRNA            complement(join(11736289..11737972,11739062..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..11775565,11782745..11782909,11801267..11801530,
FT                   11813744..11813842,11959609..11960074,12009434..12009567))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT173109"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT173109.1
FT                   created on 04-JUN-2003"
FT   assembly_gap    11738375..11738394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(11739112..11739491,11752053..11752117,
FT                   11757973..11758148,11773341..11773479,11775367..11775565,
FT                   11782745..11782909,11801267..11801530,11813744..11813842,
FT                   11959609..11960074,12009434..12009466))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_a"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT173109.1
FT                   protein_id=mCP96028.0 isoform=CRA_a"
FT                   /protein_id="EDL07119.1"
FT   mRNA            complement(join(11750574..11752117,11757973..11758148,
FT                   11773341..11773479,11775367..11775565,11782745..11782909,
FT                   11801267..11801530,11813744..11813842,11959609..11960074,
FT                   12009434..12009567))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT185131"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185131.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(11751997..11752117,11757973..11758148,
FT                   11773341..11773479,11775367..11775565,11782745..11782909,
FT                   11801267..11801530,11813744..11813842,11959609..11960074,
FT                   12009434..12009466))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_c"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185131.0
FT                   protein_id=mCP106388.0 isoform=CRA_c"
FT                   /protein_id="EDL07121.1"
FT   assembly_gap    11798776..11798879
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    11812322..11812379
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    11829076..11829100
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            11846607..11865936
FT                   /locus_tag="mCG_63340"
FT                   /note="gene_id=mCG63340.2"
FT   mRNA            join(11846607..11846655,11850980..11851208,
FT                   11853717..11853807,11865115..11865936)
FT                   /locus_tag="mCG_63340"
FT                   /product="mCG63340"
FT                   /note="gene_id=mCG63340.2 transcript_id=mCT63523.2 created
FT                   on 10-DEC-2002"
FT   CDS             join(11851137..11851208,11853717..11853807,
FT                   11865115..11865140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63340"
FT                   /product="mCG63340"
FT                   /note="gene_id=mCG63340.2 transcript_id=mCT63523.2
FT                   protein_id=mCP29884.2"
FT                   /protein_id="EDL07122.1"
FT                   VGHGFATETVGLLRMGG"
FT   assembly_gap    11857994..11858205
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    11862178..11862413
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    11885783..11885898
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    11894547..11894566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11901085..11901104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11918276..11918600
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    11930665..11930684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11932518..11932558
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11935915..11935934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11964030..11964049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11978956..11978975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12004969..12004988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12006520..12006618
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    12009568..12009782
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            <12013908..12014859
FT                   /locus_tag="mCG_1028382"
FT                   /note="gene_id=mCG1028382.0"
FT   mRNA            join(<12013908..12014277,12014650..12014859)
FT                   /locus_tag="mCG_1028382"
FT                   /product="mCG1028382"
FT                   /note="gene_id=mCG1028382.0 transcript_id=mCT146086.0
FT                   created on 12-NOV-2002"
FT   CDS             <12014064..12014222
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028382"
FT                   /product="mCG1028382"
FT                   /note="gene_id=mCG1028382.0 transcript_id=mCT146086.0
FT                   protein_id=mCP88804.0"
FT                   /protein_id="EDL07118.1"
FT                   FKLSLLI"
FT   assembly_gap    12026630..12026649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12040778..12040805
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12043595..12044114
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    12052460..12054300
FT                   /estimated_length=1841
FT                   /gap_type="unknown"
FT   assembly_gap    12063026..12063140
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    12064333..12064352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12076579..12076796
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    12079132..12079201
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    12134933..12134952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12136069..12136088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12186982..12188898
FT                   /estimated_length=1917
FT                   /gap_type="unknown"
FT   assembly_gap    12190045..12190854
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   gene            12196870..12197999
FT                   /pseudo
FT                   /locus_tag="mCG_1028192"
FT                   /note="gene_id=mCG1028192.0"
FT   mRNA            join(12196870..12197375,12197842..12197999)
FT                   /pseudo
FT                   /locus_tag="mCG_1028192"
FT                   /note="gene_id=mCG1028192.0 transcript_id=mCT145896.0
FT                   created on 12-NOV-2002"
FT   assembly_gap    12197453..12197620
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    12198179..12199862
FT                   /estimated_length=1684
FT                   /gap_type="unknown"
FT   assembly_gap    12202796..12202815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12208530..12209384
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    12211837..12212326
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    12214313..12214332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12215420..12215439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12264726..12264745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12271687..12271706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12273666..12273685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12278926..12278994
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            complement(12289492..>12320013)
FT                   /locus_tag="mCG_64353"
FT                   /note="gene_id=mCG64353.2"
FT   mRNA            complement(join(12289492..12290722,12318654..12318748,
FT                   12319749..>12320013))
FT                   /locus_tag="mCG_64353"
FT                   /product="mCG64353"
FT                   /note="gene_id=mCG64353.2 transcript_id=mCT64536.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(12290575..12290722,12318654..12318748,
FT                   12319749..>12319817))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64353"
FT                   /product="mCG64353"
FT                   /note="gene_id=mCG64353.2 transcript_id=mCT64536.2
FT                   protein_id=mCP29919.2"
FT                   /protein_id="EDL07117.1"
FT   gene            12352447..12353252
FT                   /pseudo
FT                   /locus_tag="mCG_1028248"
FT                   /note="gene_id=mCG1028248.0"
FT   mRNA            12352447..12353252
FT                   /pseudo
FT                   /locus_tag="mCG_1028248"
FT                   /note="gene_id=mCG1028248.0 transcript_id=mCT145952.1
FT                   created on 26-NOV-2002"
FT   assembly_gap    12360393..12363506
FT                   /estimated_length=3114
FT                   /gap_type="unknown"
FT   assembly_gap    12364861..12364880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12365957..12371259
FT                   /estimated_length=5303
FT                   /gap_type="unknown"
FT   assembly_gap    12383913..12383932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12397340..12397359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12428378..12429531
FT                   /estimated_length=1154
FT                   /gap_type="unknown"
FT   assembly_gap    12436090..12437656
FT                   /estimated_length=1567
FT                   /gap_type="unknown"
FT   assembly_gap    12464037..12464056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12475116..12476243
FT                   /estimated_length=1128
FT                   /gap_type="unknown"
FT   assembly_gap    12478948..12478967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12500602..12501543
FT                   /estimated_length=942
FT                   /gap_type="unknown"
FT   gene            12502281..12546103
FT                   /locus_tag="mCG_15697"
FT                   /note="gene_id=mCG15697.1"
FT   mRNA            join(12502281..12502325,12508219..12508508,
FT                   12520957..12521192,12525127..12525408,12526111..12526211,
FT                   12527726..12527832,12533271..12533359,12545750..12546103)
FT                   /locus_tag="mCG_15697"
FT                   /product="mCG15697"
FT                   /note="gene_id=mCG15697.1 transcript_id=mCT18579.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(12508336..12508508,12520957..12521044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15697"
FT                   /product="mCG15697"
FT                   /note="gene_id=mCG15697.1 transcript_id=mCT18579.1
FT                   protein_id=mCP7262.2"
FT                   /protein_id="EDL07116.1"
FT   assembly_gap    12542753..12542925
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    12553349..12553368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12556103..12556122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12557167..12557186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12574851..12575042
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    12579662..12579730
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            complement(12587092..12774354)
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /note="gene_id=mCG15698.2"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672779,12774245..12774354))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT176113"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176113.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672779,12685664..12685878))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT18580"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT18580.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596311,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12633530..12633617))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT176114"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176114.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(12589791..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672397))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_a"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176113.0
FT                   protein_id=mCP99036.0 isoform=CRA_a"
FT                   /protein_id="EDL07113.1"
FT   CDS             complement(join(12589791..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672397))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_a"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT18580.2
FT                   protein_id=mCP7279.2 isoform=CRA_a"
FT                   /protein_id="EDL07115.1"
FT   assembly_gap    12594776..12594863
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   CDS             complement(join(12596238..12596311,12597700..12597833,
FT                   12608682..12608846,12612462..12612550,12613365..12613475,
FT                   12619966..12620055,12621284..12621417,12628947..12629098,
FT                   12629609..12629769))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_b"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176114.0
FT                   protein_id=mCP99035.0 isoform=CRA_b"
FT                   /protein_id="EDL07114.1"
FT   assembly_gap    12607245..12607264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12616501..12617353
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    12654347..12654480
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    12726057..12726137
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    12737207..12738770
FT                   /estimated_length=1564
FT                   /gap_type="unknown"
FT   gene            <12774639..12795966
FT                   /locus_tag="mCG_1028376"
FT                   /note="gene_id=mCG1028376.1"
FT   mRNA            join(<12774639..12774956,12778114..12778225,
FT                   12795580..12795966)
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, transcript variant mCT146080"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT146080.1
FT                   created on 18-OCT-2002"
FT   CDS             join(12774639..12774956,12778114..12778206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, isoform CRA_a"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT146080.1
FT                   protein_id=mCP88769.1 isoform=CRA_a"
FT                   /protein_id="EDL07111.1"
FT   mRNA            join(<12774735..12774956,12778114..12778225,
FT                   12784283..12784561)
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, transcript variant mCT174577"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT174577.0
FT                   created on 18-OCT-2002"
FT   CDS             join(<12774735..12774956,12778114..12778206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, isoform CRA_b"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT174577.0
FT                   protein_id=mCP97496.0 isoform=CRA_b"
FT                   /protein_id="EDL07112.1"
FT                   "
FT   assembly_gap    12788189..12788420
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    12789725..12790217
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    12799637..12799656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12805047..12805735
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    12806847..12807078
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    12822315..12822334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12823743..12823762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12827893..12828068
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    12839567..12839586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12844840..12844859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12852941..12853038
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    12856746..12856880
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    12859441..12859542
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    12863331..12864109
FT                   /estimated_length=779
FT                   /gap_type="unknown"
FT   assembly_gap    12865934..12866377
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    12868238..12868257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12884485..12884582
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    12893293..12893312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12903794..12903813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12905306..12905781
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    12911078..12911097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12921531..13213509
FT                   /locus_tag="mCG_15699"
FT                   /note="gene_id=mCG15699.2"
FT   mRNA            join(12921531..12921635,13000946..13000989,
FT                   13030611..13030758,13040221..13040517,13046876..13047059,
FT                   13063518..13063710,13069216..13072279,13075649..13075776,
FT                   13121709..13121784,13124809..13124945,13136087..13136460,
FT                   13138801..13138854,13142375..13142440,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163460..13163580,13176788..13176855,13179142..13179208,
FT                   13182800..13182935,13184315..13184427,13184983..13185135,
FT                   13185985..13186235,13187811..13187936,13188049..13188166,
FT                   13189378..13189626,13194639..13194670,13195167..13195348,
FT                   13195489..13195571,13198247..13198441,13201528..13201689,
FT                   13202358..13202428,13202857..13202901,13205654..13205704,
FT                   13206472..13206921,13208074..13208404,13209468..13209552,
FT                   13209742..13213509)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT18581"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT18581.2 created
FT                   on 22-OCT-2002"
FT   mRNA            join(12921753..12921982,13000946..13000989,
FT                   13030611..13030758,13040221..13041095)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175210"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175210.0 created
FT                   on 22-OCT-2002"
FT   assembly_gap    12954355..12954544
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    12985104..12985123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12999360..12999561
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   CDS             join(13000957..13000989,13030611..13030758,
FT                   13040221..13040517,13046876..13047059,13063518..13063710,
FT                   13069216..13072279,13075649..13075776,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13138801..13138854,
FT                   13142375..13142440,13144098..13144290,13146194..13146302,
FT                   13154606..13154648,13156286..13156418,13163460..13163580,
FT                   13176788..13176855,13179142..13179208,13182800..13182935,
FT                   13184315..13184427,13184983..13185135,13185985..13186235,
FT                   13187811..13187936,13188049..13188166,13189378..13189626,
FT                   13194639..13194670,13195167..13195348,13195489..13195571,
FT                   13198247..13198441,13201528..13201689,13202358..13202428,
FT                   13202857..13202901,13205654..13205704,13206472..13206921,
FT                   13208074..13208404,13209468..13209517)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_d"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT18581.2
FT                   protein_id=mCP7304.2 isoform=CRA_d"
FT                   /protein_id="EDL07110.1"
FT                   FC"
FT   CDS             join(13000957..13000989,13030611..13030758,
FT                   13040221..13040726)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_c"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175210.0
FT                   protein_id=mCP98128.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D9W9"
FT                   /db_xref="InterPro:IPR028852"
FT                   /db_xref="MGI:MGI:2676556"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9W9"
FT                   /protein_id="EDL07109.1"
FT                   RVVDGS"
FT   assembly_gap    13007642..13007661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13091833..13092264
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    13092934..13093103
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   mRNA            join(<13101617..13101763,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163406..>13163459)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175209"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175209.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(<13101617..13101763,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163406..>13163459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_b"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175209.0
FT                   protein_id=mCP98127.0 isoform=CRA_b"
FT                   /protein_id="EDL07108.1"
FT   assembly_gap    13117378..13117459
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    13130133..13130152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13132170..13132189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13156577..13156726
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   mRNA            join(<13161040..13161193,13163406..13163580,
FT                   13176788..13177066)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175208"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175208.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(<13161089..13161193,13163406..13163580,
FT                   13176788..13176864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_a"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175208.0
FT                   protein_id=mCP98129.0 isoform=CRA_a"
FT                   /protein_id="EDL07107.1"
FT                   ENLASCAKVKMKVR"
FT   assembly_gap    13172538..13172557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13192875..13193368
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    13225223..13225383
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            <13225422..13235733
FT                   /locus_tag="mCG_1028373"
FT                   /note="gene_id=mCG1028373.0"
FT   mRNA            join(<13225422..13225523,13235330..13235733)
FT                   /locus_tag="mCG_1028373"
FT                   /product="mCG1028373"
FT                   /note="gene_id=mCG1028373.0 transcript_id=mCT176109.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<13225440..13225523,13235330..13235620)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028373"
FT                   /product="mCG1028373"
FT                   /note="gene_id=mCG1028373.0 transcript_id=mCT176109.0
FT                   protein_id=mCP99031.0"
FT                   /protein_id="EDL07105.1"
FT   gene            complement(<13227955..>13232803)
FT                   /locus_tag="mCG_1028374"
FT                   /note="gene_id=mCG1028374.0"
FT   mRNA            complement(join(<13227955..13228144,13232579..>13232803))
FT                   /locus_tag="mCG_1028374"
FT                   /product="mCG1028374"
FT                   /note="gene_id=mCG1028374.0 transcript_id=mCT146078.0
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(<13227955..13228144,13232579..>13232764))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028374"
FT                   /product="mCG1028374"
FT                   /note="gene_id=mCG1028374.0 transcript_id=mCT146078.0
FT                   protein_id=mCP89054.0"
FT                   /protein_id="EDL07106.1"
FT   assembly_gap    13238986..13239732
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    13241191..13241210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13242493..13242515
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    13246036..13246138
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    13261040..13261169
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    13262475..13262732
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    13266064..13266083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13268857..13268876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13270328..13273490
FT                   /estimated_length=3163
FT                   /gap_type="unknown"
FT   assembly_gap    13274471..13275206
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    13277096..13277224
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13277948..13277967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13306152..13335132
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /note="gene_id=mCG53536.2"
FT   mRNA            join(13306152..13306244,13326081..13328189)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT53719"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT53719.1 created
FT                   on 12-NOV-2002"
FT   mRNA            join(<13306157..13306233,13333700..13334528)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT176119"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176119.0 created
FT                   on 12-NOV-2002"
FT   CDS             join(<13306180..13306233,13333700..13333987)
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176119.0
FT                   protein_id=mCP99041.0 isoform=CRA_a"
FT                   /protein_id="EDL07102.1"
FT                   GPLAQQHSL"
FT   assembly_gap    13324108..13324156
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   CDS             13326092..13327861
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT53719.1
FT                   protein_id=mCP29847.2 isoform=CRA_c"
FT                   /protein_id="EDL07104.1"
FT                   PTAFVSTWKHLPA"
FT   mRNA            join(<13327807..13327885,13333700..13335132)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT176120"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176120.0 created
FT                   on 12-NOV-2002"
FT   assembly_gap    13329066..13329131
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   CDS             <13334196..13334831
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176120.0
FT                   protein_id=mCP99042.0 isoform=CRA_b"
FT                   /protein_id="EDL07103.1"
FT   assembly_gap    13338866..13338927
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    13405498..13405517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13410848..13410867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13423710..13423729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13425382..13425401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13427966..13427985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13429151..13429170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13430187..13430206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13431293..13431312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13432850..13432869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13434242..13434261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13441390..13447665
FT                   /estimated_length=6276
FT                   /gap_type="unknown"
FT   assembly_gap    13457157..13457241
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    13468632..13469188
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    13469974..13471413
FT                   /estimated_length=1440
FT                   /gap_type="unknown"
FT   assembly_gap    13485623..13485642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13486943..13486962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13491450..13491709
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    13495319..13495338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13498575..13498594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13521899..13528342
FT                   /estimated_length=6444
FT                   /gap_type="unknown"
FT   assembly_gap    13529447..13530151
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    13531164..13531183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13532892..13537096
FT                   /estimated_length=4205
FT                   /gap_type="unknown"
FT   assembly_gap    13538414..13538489
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    13548668..13548768
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    13567667..13570564
FT                   /estimated_length=2898
FT                   /gap_type="unknown"
FT   assembly_gap    13572493..13572512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13595424..13595443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13597368..13597563
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    13605929..13606190
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    13610108..13610127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13631445..13631464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13653845..13653864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13655671..13655690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13694077..13696101
FT                   /estimated_length=2025
FT                   /gap_type="unknown"
FT   assembly_gap    13697229..13701402
FT                   /estimated_length=4174
FT                   /gap_type="unknown"
FT   assembly_gap    13719102..13719121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13729089..13730623
FT                   /estimated_length=1535
FT                   /gap_type="unknown"
FT   assembly_gap    13745262..13745281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13759126..13759145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13837663..>13931263
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /note="gene_id=mCG55764.2"
FT   mRNA            join(<13837663..13837765,13838254..13838380,
FT                   13838702..13838739,13839052..13839201,13862125..13862333,
FT                   13866498..13866663,13867619..13867683,13873411..13873527,
FT                   13874546..13875126,13876581..13876664,13876890..13876976,
FT                   13879380..13879528,13880565..13880652,13888082..13888226,
FT                   13901291..13901444,13918268..13918427,13918571..13918689,
FT                   13931154..>13931263)
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /product="hypothetical protein D430020F16"
FT                   /note="gene_id=mCG55764.2 transcript_id=mCT55947.2 created
FT                   on 12-NOV-2002"
FT   CDS             join(13837663..13837765,13838254..13838380,
FT                   13838702..13838739,13839052..13839201,13862125..13862333,
FT                   13866498..13866663,13867619..13867683,13873411..13873527,
FT                   13874546..13875126,13876581..13876664,13876890..13876976,
FT                   13879380..13879528,13880565..13880652,13888082..13888226,
FT                   13901291..13901444,13918268..13918427,13918571..13918689,
FT                   13931154..13931263)
FT                   /codon_start=1
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /product="hypothetical protein D430020F16"
FT                   /note="gene_id=mCG55764.2 transcript_id=mCT55947.2
FT                   protein_id=mCP29832.2"
FT                   /protein_id="EDL07101.1"
FT                   RATSTCSDALPV"
FT   assembly_gap    13850538..13851059
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    13868790..13869749
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    13870911..13870930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13892941..13894396
FT                   /estimated_length=1456
FT                   /gap_type="unknown"
FT   assembly_gap    13895096..13896303
FT                   /estimated_length=1208
FT                   /gap_type="unknown"
FT   assembly_gap    13912485..13912504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13921363..13927807
FT                   /estimated_length=6445
FT                   /gap_type="unknown"
FT   assembly_gap    13935564..13935583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13942204..13942223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13943396..13943415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13945068..13945637
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    13957470..13957489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14002305..14002324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14021604..14022157
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    14033275..14036978
FT                   /estimated_length=3704
FT                   /gap_type="unknown"
FT   assembly_gap    14038451..14038616
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    14053639..14053658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14072343..14072506
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    14078996..14079015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14101396..14101491
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    14140708..14143045
FT                   /estimated_length=2338
FT                   /gap_type="unknown"
FT   assembly_gap    14151546..14151565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14162326..14162509
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    14171684..14174090
FT                   /estimated_length=2407
FT                   /gap_type="unknown"
FT   assembly_gap    14206357..14206376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14222386..14222405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14223693..14223712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14226234..14226253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14249347..14249366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14295772..14295791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14312351..14313257
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    14366724..14366749
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    14394017..14394810
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    14396875..14396894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14406552..14406571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14411968..14412483
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    14416500..14416519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14418087..14418106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14449790..14449809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14470123..14470179
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    14498220..14498292
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    14507157..14507405
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    14531263..14531282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14532707..14532726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14558487..14558848
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    14569348..14569367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14571850..14571961
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    14589491..14589510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14591147..14591166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14592433..14592452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14598373..14598483
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    14674350..14674512
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    14730004..14730023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14732074..14732259
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    14763958..14763977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14790122..14790207
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    14792943..14793382
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    14818679..14818698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14834127..14834146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14860629..14860648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14861729..14861922
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    14910267..14913003
FT                   /estimated_length=2737
FT                   /gap_type="unknown"
FT   assembly_gap    14916786..14916888
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    14919986..14920568
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    14925284..14925392
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    14958629..14959360
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    14960438..14961955
FT                   /estimated_length=1518
FT                   /gap_type="unknown"
FT   assembly_gap    14994697..14994777
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    14994991..14995010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14997790..14997834
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    15000675..15000919
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    15026168..15026430
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    15086666..15086685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15107281..15117381
FT                   /estimated_length=10101
FT                   /gap_type="unknown"
FT   assembly_gap    15130739..15130855
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    15193249..15193268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15223162..15223587
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    15229526..15229545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15260121..15260285
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    15262743..15262762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15272608..15272659
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15327484..15327503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15329288..15329307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15338733..15338752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15364254..15364273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15368322..15368958
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    15370999..15371018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15372533..15376563
FT                   /estimated_length=4031
FT                   /gap_type="unknown"
FT   assembly_gap    15377662..15377681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15386914..15387113
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    15389059..15389550
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    15393909..15393928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15405890..15405916
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    15408667..15408686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15435742..15435850
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    15439409..15439428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15451821..15452200
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    15453613..15453632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15510552..15510571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15530190..15530450
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    15579625..15579737
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    15591388..15613685
FT                   /estimated_length=22298
FT                   /gap_type="unknown"
FT   assembly_gap    15625636..15626367
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    15639123..15639142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15656412..15656431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15670544..15670681
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   gene            <15674405..15675764
FT                   /locus_tag="mCG_1028362"
FT                   /note="gene_id=mCG1028362.0"
FT   mRNA            join(<15674405..15674678,15674939..15675764)
FT                   /locus_tag="mCG_1028362"
FT                   /product="mCG1028362"
FT                   /note="gene_id=mCG1028362.0 transcript_id=mCT146066.0
FT                   created on 17-OCT-2002"
FT   CDS             join(<15674638..15674678,15674939..15675203)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028362"
FT                   /product="mCG1028362"
FT                   /note="gene_id=mCG1028362.0 transcript_id=mCT146066.0
FT                   protein_id=mCP88777.0"
FT                   /protein_id="EDL07100.1"
FT   gene            complement(15722621..15999044)
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /note="gene_id=mCG9459.2"
FT   mRNA            complement(join(15722621..15722742,15724287..15724421,
FT                   15776072..15776260,15872304..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15999044))
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   transcript variant mCT173136"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT173136.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(15722624..15722742,15724287..15724421,
FT                   15776072..15776260,15872304..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15998786))
FT                   /codon_start=1
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT173136.0
FT                   protein_id=mCP96055.0 isoform=CRA_a"
FT                   /protein_id="EDL07098.1"
FT   assembly_gap    15745446..15745520
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    15780082..15780101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15806532..15808144
FT                   /estimated_length=1613
FT                   /gap_type="unknown"
FT   assembly_gap    15812695..15813275
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    15841243..15844284
FT                   /estimated_length=3042
FT                   /gap_type="unknown"
FT   assembly_gap    15860262..15860342
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    15865742..15865987
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   mRNA            complement(join(15871042..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15999044))
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   transcript variant mCT9047"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT9047.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(15872191..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15998786))
FT                   /codon_start=1
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT9047.2
FT                   protein_id=mCP7365.2 isoform=CRA_b"
FT                   /protein_id="EDL07099.1"
FT   assembly_gap    15900842..15904093
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   assembly_gap    15950857..15950893
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    15973919..15973938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15975233..15975317
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    15999045..15999702
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   gene            15999995..16000675
FT                   /locus_tag="mCG_147200"
FT                   /note="gene_id=mCG147200.0"
FT   mRNA            15999995..16000675
FT                   /locus_tag="mCG_147200"
FT                   /product="mCG147200"
FT                   /note="gene_id=mCG147200.0 transcript_id=mCT187463.0
FT                   created on 13-JAN-2004"
FT   CDS             16000374..16000556
FT                   /codon_start=1
FT                   /locus_tag="mCG_147200"
FT                   /product="mCG147200"
FT                   /note="gene_id=mCG147200.0 transcript_id=mCT187463.0
FT                   protein_id=mCP109607.0"
FT                   /protein_id="EDL07097.1"
FT                   AQNLLFPSPTNTPSW"
FT   gene            complement(16002220..16158774)
FT                   /locus_tag="mCG_57387"
FT                   /note="gene_id=mCG57387.2"
FT   mRNA            complement(join(16002220..16003913,16006586..16006655,
FT                   16015564..16015751,16078804..16078904,16081799..16081853,
FT                   16104539..16104731,16130259..16130361,16131740..16131797,
FT                   16133017..16133324,16134899..16135079,16138833..16138973))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT57570"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT57570.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(16003905..16003913,16006586..16006655,
FT                   16015564..16015730))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_b"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT57570.2
FT                   protein_id=mCP29881.2 isoform=CRA_b"
FT                   /protein_id="EDL07095.1"
FT   mRNA            complement(join(16008534..16008996,16015564..16015751,
FT                   16078804..16078904,16079033..16079150,16081799..16081853,
FT                   16104539..16104731,16152469..16152693,16158684..16158774))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT176108"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT176108.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(16008930..16008996,16015564..16015730))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_c"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT176108.1
FT                   protein_id=mCP99030.1 isoform=CRA_c"
FT                   /protein_id="EDL07096.1"
FT   assembly_gap    16018551..16018570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16033067..16033086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16035783..16036391
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    16045600..16045619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16056422..16056441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16080202..16080221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16084184..16084225
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    16085005..16085100
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    16103964..16103983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16108762..16108785
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    16135942..16136032
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   mRNA            complement(join(16147460..16148258,16152469..16152693,
FT                   16158684..16158766))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT146064"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT146064.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(16147548..16147715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_a"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT146064.1
FT                   protein_id=mCP88762.1 isoform=CRA_a"
FT                   /protein_id="EDL07094.1"
FT                   ELKKRVQNVK"
FT   assembly_gap    16168476..16168699
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    16176633..16176652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16196125..16203829)
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /note="gene_id=mCG6297.1"
FT   mRNA            complement(join(16196125..16196507,16201219..16201392,
FT                   16202181..16202367,16203588..16203829))
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /product="mitochondrial ribosomal protein L46"
FT                   /note="gene_id=mCG6297.1 transcript_id=mCT5363.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16196239..16196507,16201219..16201392,
FT                   16202181..16202367,16203588..16203809))
FT                   /codon_start=1
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /product="mitochondrial ribosomal protein L46"
FT                   /note="gene_id=mCG6297.1 transcript_id=mCT5363.1
FT                   protein_id=mCP7351.1"
FT                   /protein_id="EDL07093.1"
FT                   CL"
FT   gene            16204072..16213768
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /note="gene_id=mCG6300.1"
FT   mRNA            join(16204072..16204204,16204354..16204461,
FT                   16211418..16211547,16212655..16212720,16213421..16213768)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT5366"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT5366.1 created on
FT                   10-SEP-2002"
FT   mRNA            join(16204120..16204204,16204354..16204461,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213767)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT173127"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173127.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(16204137..16204204,16204354..16204467,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213766)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT173126"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173126.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(16204140..16204204,16204354..16204461,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213528)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173127.0
FT                   protein_id=mCP96045.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U8Y1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="MGI:MGI:1915244"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8Y1"
FT                   /protein_id="EDL07091.1"
FT   CDS             join(16204140..16204204,16204354..16204461,
FT                   16211418..16211547,16212655..16212720,16213421..16213528)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT5366.1
FT                   protein_id=mCP7335.2 isoform=CRA_c"
FT                   /protein_id="EDL07092.1"
FT   CDS             join(16204140..16204204,16204354..16204465)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173126.0
FT                   protein_id=mCP96046.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RPK7"
FT                   /db_xref="MGI:MGI:1915244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RPK7"
FT                   /protein_id="EDL07090.1"
FT                   QNTEREAAPSRFR"
FT   assembly_gap    16229853..16229998
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            16238999..16241379
FT                   /locus_tag="mCG_147204"
FT                   /note="gene_id=mCG147204.0"
FT   mRNA            join(16238999..16239986,16240822..16241379)
FT                   /locus_tag="mCG_147204"
FT                   /product="mCG147204"
FT                   /note="gene_id=mCG147204.0 transcript_id=mCT187467.0
FT                   created on 13-JAN-2004"
FT   CDS             16239795..16239950
FT                   /codon_start=1
FT                   /locus_tag="mCG_147204"
FT                   /product="mCG147204"
FT                   /note="gene_id=mCG147204.0 transcript_id=mCT187467.0
FT                   protein_id=mCP109611.0"
FT                   /protein_id="EDL07089.1"
FT                   CSPGSL"
FT   assembly_gap    16243949..16246923
FT                   /estimated_length=2975
FT                   /gap_type="unknown"
FT   gene            complement(<16247035..16260197)
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /note="gene_id=mCG6308.1"
FT   mRNA            complement(join(<16247035..16247232,16252959..16253146,
FT                   16256126..16257218,16260065..16260197))
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /product="de-etiolated homolog 1 (Arabidopsis)"
FT                   /note="gene_id=mCG6308.1 transcript_id=mCT5355.1 created on
FT                   16-OCT-2002"
FT   CDS             complement(join(<16247035..16247232,16252959..16253146,
FT                   16256126..16257208))
FT                   /codon_start=1
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /product="de-etiolated homolog 1 (Arabidopsis)"
FT                   /note="gene_id=mCG6308.1 transcript_id=mCT5355.1
FT                   protein_id=mCP7364.2"
FT                   /protein_id="EDL07088.1"
FT   assembly_gap    16269149..16269168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16285593..16286195
FT                   /pseudo
FT                   /locus_tag="mCG_54597"
FT                   /note="gene_id=mCG54597.2"
FT   mRNA            16285593..16286195
FT                   /pseudo
FT                   /locus_tag="mCG_54597"
FT                   /note="gene_id=mCG54597.2 transcript_id=mCT54780.2 created
FT                   on 11-NOV-2002"
FT   assembly_gap    16287842..16287863
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    16295206..16295394
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    16302278..16302303
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    16304712..16304731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16308876..16318439
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /note="gene_id=mCG6304.3"
FT   mRNA            join(16308876..16308948,16312288..16312888,
FT                   16315901..16316101,16317202..16317634)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT5356"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT5356.1 created on
FT                   10-SEP-2002"
FT   mRNA            join(<16308879..16308948,16312402..16312888,
FT                   16315901..16316101,16317202..16318439)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT189928"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT189928.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<16308915..16308948,16315901..16316101,
FT                   16317202..16318181)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT173131"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173131.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(<16308916..16308948,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173131.0
FT                   protein_id=mCP96050.0 isoform=CRA_a"
FT                   /protein_id="EDL07084.1"
FT                   RSAPP"
FT   CDS             join(<16308920..16308948,16312402..16312888,
FT                   16315901..16316101,16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT189928.0
FT                   protein_id=mCP110929.0 isoform=CRA_c"
FT                   /protein_id="EDL07086.1"
FT   mRNA            join(16308987..16309135,16312288..16312888,
FT                   16315901..16316101,16317202..16318432)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT173132"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173132.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(16312352..16312888,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173132.0
FT                   protein_id=mCP96051.0 isoform=CRA_b"
FT                   /protein_id="EDL07085.1"
FT   CDS             join(16312352..16312888,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT5356.1
FT                   protein_id=mCP7313.1 isoform=CRA_b"
FT                   /protein_id="EDL07087.1"
FT   gene            16323515..16330419
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /note="gene_id=mCG6303.2"
FT   mRNA            join(16323515..16323551,16324379..16324631,
FT                   16326600..16326800,16329779..16330374)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT173129"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173129.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(16323875..16324099,16324379..16324631,
FT                   16326600..16326800,16330113..16330407)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT173130"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173130.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(16324290..16324631,16326600..16326800,
FT                   16330113..16330419)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT5369"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT5369.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(16324386..16324631,16326600..16326800,
FT                   16329868..16330254)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT177652"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT177652.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16329779..16330252)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_a"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173129.0
FT                   protein_id=mCP96049.0 isoform=CRA_a"
FT                   /protein_id="EDL07080.1"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16330113..16330229)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_b"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173130.0
FT                   protein_id=mCP96048.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FK39"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="MGI:MGI:1928895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK39"
FT                   /protein_id="EDL07081.1"
FT                   ISQRLRAQRGLPCPGTSD"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16330113..16330229)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_b"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT5369.2
FT                   protein_id=mCP7284.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FK39"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="MGI:MGI:1928895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK39"
FT                   /protein_id="EDL07083.1"
FT                   ISQRLRAQRGLPCPGTSD"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16329868..16329876)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_c"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT177652.0
FT                   protein_id=mCP100574.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0U1RP59"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="MGI:MGI:1928895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RP59"
FT                   /protein_id="EDL07082.1"
FT   assembly_gap    16331450..16331591
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    16358246..16358265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16368063..16383895
FT                   /estimated_length=15833
FT                   /gap_type="unknown"
FT   assembly_gap    16385105..16385124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16389488..16389507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16394460..16394479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16400032..16400216
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    16406602..16406621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16408723..16408802
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    16413724..16413743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16417517..16417576
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    16422092..16422111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16423536..16423555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16445013..16445076
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    16454908..16454927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16460339..16460358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16460362..16522345
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /note="gene_id=mCG141103.0"
FT   mRNA            join(16460362..16460487,16489427..16489503,
FT                   16491720..16492103,16493515..16493689,16495431..16495558,
FT                   16496854..16497147,16498192..16498596,16499569..16499743,
FT                   16499935..16500062,16501240..16501533,16503925..16504140,
FT                   16505010..16508492,16518554..16518712,16519225..16519307,
FT                   16519945..16520089,16520903..16521085,16521448..16522345)
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /product="aggrecan 1"
FT                   /note="gene_id=mCG141103.0 transcript_id=mCT173113.0
FT                   created on 10-SEP-2002"
FT   assembly_gap    16475027..16475377
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    16484664..16486320
FT                   /estimated_length=1657
FT                   /gap_type="unknown"
FT   CDS             join(16489434..16489503,16491720..16492103,
FT                   16493515..16493689,16495431..16495558,16496854..16497147,
FT                   16498192..16498596,16499569..16499743,16499935..16500062,
FT                   16501240..16501533,16503925..16504140,16505010..16508492,
FT                   16518554..16518712,16519225..16519307,16519945..16520089,
FT                   16520903..16521085,16521448..16521524)
FT                   /codon_start=1
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /product="aggrecan 1"
FT                   /note="gene_id=mCG141103.0 transcript_id=mCT173113.0
FT                   protein_id=mCP96032.0"
FT                   /protein_id="EDL07079.1"
FT   assembly_gap    16509422..16509441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16524276..16537949)
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /note="gene_id=mCG6307.1"
FT   mRNA            complement(join(16524276..16524741,16525097..16525399,
FT                   16528907..16529275,16530630..16530811,16537836..16537949))
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /product="hyaluronan and proteoglycan link protein 3"
FT                   /note="gene_id=mCG6307.1 transcript_id=mCT5359.1 created on
FT                   17-OCT-2002"
FT   CDS             complement(join(16524458..16524741,16525097..16525399,
FT                   16528907..16529275,16530630..16530753))
FT                   /codon_start=1
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /product="hyaluronan and proteoglycan link protein 3"
FT                   /note="gene_id=mCG6307.1 transcript_id=mCT5359.1
FT                   protein_id=mCP7363.2"
FT                   /db_xref="GOA:Q80WM5"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:1914916"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80WM5"
FT                   /protein_id="EDL07078.1"
FT   gene            complement(16540665..16555890)
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /note="gene_id=mCG6301.2"
FT   mRNA            complement(join(16540665..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16550128..16550238,16552100..16552231,
FT                   16552475..16552597,16555754..16555872))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT5360"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT5360.0 created on
FT                   16-DEC-2002"
FT   mRNA            complement(join(16540665..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16552100..16552231,16552475..16552597,
FT                   16555754..16555863))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT173128"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT173128.0 created
FT                   on 16-DEC-2002"
FT   mRNA            complement(join(16541042..16541442,16541548..16541697,
FT                   16543514..16543580,16552511..16552597,16555754..16555890))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT177651"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT177651.0 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(16541305..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16552100..16552231,16552475..16552597,
FT                   16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT173128.0
FT                   protein_id=mCP96047.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR027060"
FT                   /db_xref="MGI:MGI:102768"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDU5"
FT                   /protein_id="EDL07075.1"
FT   CDS             complement(join(16541305..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16550128..16550238,16552100..16552231,
FT                   16552475..16552597,16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT5360.0
FT                   protein_id=mCP7369.1 isoform=CRA_c"
FT                   /protein_id="EDL07077.1"
FT                   ELLGC"
FT   CDS             complement(join(16541670..16541697,16543514..16543580,
FT                   16552511..16552597,16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT177651.0
FT                   protein_id=mCP100573.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR027060"
FT                   /db_xref="MGI:MGI:102768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNV7"
FT                   /protein_id="EDL07076.1"
FT   assembly_gap    16568786..16568805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16569844..16569863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16574174..16574193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16597889..16598788
FT                   /estimated_length=900
FT                   /gap_type="unknown"
FT   assembly_gap    16608500..16609971
FT                   /estimated_length=1472
FT                   /gap_type="unknown"
FT   assembly_gap    16610751..16611000
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    16614602..16618862
FT                   /estimated_length=4261
FT                   /gap_type="unknown"
FT   assembly_gap    16621151..16621442
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    16622786..16622805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16648449..16648587
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    16655297..16655484
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    16674380..16674741
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   gene            16681281..16765066
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /note="gene_id=mCG6299.1"
FT   mRNA            join(16681281..16681344,16704873..16704972,
FT                   16706350..16706552,16733692..16733867,16735657..16735824,
FT                   16752924..16753107,16755415..16755507,16758654..16758764,
FT                   16760475..16760544,16762731..16762815,16764625..16765066)
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /product="abhydrolase domain containing 2"
FT                   /note="gene_id=mCG6299.1 transcript_id=mCT5365.1 created on
FT                   11-NOV-2002"
FT   assembly_gap    16691594..16692208
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    16702745..16702764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16706295..16706314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16706362..16706552,16733692..16733867,
FT                   16735657..16735824,16752924..16753107,16755415..16755507,
FT                   16758654..16758764,16760475..16760544,16762731..16762815,
FT                   16764625..16764821)
FT                   /codon_start=1
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /product="abhydrolase domain containing 2"
FT                   /note="gene_id=mCG6299.1 transcript_id=mCT5365.1
FT                   protein_id=mCP7352.1"
FT                   /protein_id="EDL07074.1"
FT   assembly_gap    16725978..16725997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16779534..16791723)
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /note="gene_id=mCG6305.2"
FT   mRNA            complement(join(16779534..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788637,16789334..16789454,
FT                   16791364..16791723))
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, transcript
FT                   variant mCT173133"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT173133.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(16779534..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788719,16789334..16789460))
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, transcript
FT                   variant mCT5357"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT5357.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16780223..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788620))
FT                   /codon_start=1
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT173133.0
FT                   protein_id=mCP96052.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Y3"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR032941"
FT                   /db_xref="MGI:MGI:97930"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y3"
FT                   /protein_id="EDL07072.1"
FT   CDS             complement(join(16780223..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788620))
FT                   /codon_start=1
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT5357.1
FT                   protein_id=mCP7329.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Y3"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR032941"
FT                   /db_xref="MGI:MGI:97930"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y3"
FT                   /protein_id="EDL07073.1"
FT   assembly_gap    16784262..16784445
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    16795041..16795320
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   gene            <16798039..16860182
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /note="gene_id=mCG141643.0"
FT   mRNA            join(<16798039..16798100,16801601..16801703,
FT                   16804844..16804916,16807531..16807661,16807975..16808131,
FT                   16808217..16808274,16810758..16810799,16811782..16811905,
FT                   16812939..16813024,16814755..16814881,16817113..16817205,
FT                   16818564..16818700,16834124..16834251,16834812..16834882,
FT                   16836025..16836139,16837045..16837167,16840348..16840416,
FT                   16842032..16842133,16843101..16843277,16843351..16843472,
FT                   16844054..16844218,16845115..16845294,16848154..16848320,
FT                   16849539..16849615,16850552..16850668,16853657..16853708,
FT                   16853864..16853991,16854074..16854142,16854317..16854425,
FT                   16854591..16854778,16855453..16855506,16855586..16855645,
FT                   16858166..16858228,16858736..16859096,16859556..16860182)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT176110"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176110.1
FT                   created on 04-JUN-2003"
FT   mRNA            join(<16804835..16804916,16807531..16807661,
FT                   16807975..16808131,16808217..16808274,16810758..16810799,
FT                   16811782..16811905,16812939..16813024,16814755..16814881,
FT                   16817113..16817205,16818564..16818700,16830182..16830269,
FT                   16834124..16834251,16834812..16834882,16836025..16836139,
FT                   16837045..16837167,16840348..16840416,16842032..16842133,
FT                   16843101..16843277,16843351..16843472,16844054..16844218,
FT                   16845115..16845611)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT185132"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT185132.0
FT                   created on 04-JUN-2003"
FT   assembly_gap    16810396..16810600
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    16815031..16815050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<16818572..16818700,16830182..16830269,
FT                   16834124..16834251,16834812..16834882,16836025..16836139,
FT                   16837045..16837167,16840348..16840416,16842032..16842133,
FT                   16843101..16843277,16843351..16843472,16844054..16844218,
FT                   16845115..16845298)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_c"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT185132.0
FT                   protein_id=mCP106390.0 isoform=CRA_c"
FT                   /protein_id="EDL07071.1"
FT   CDS             join(<16818694..16818700,16834124..16834251,
FT                   16834812..16834882,16836025..16836139,16837045..16837167,
FT                   16840348..16840416,16842032..16842133,16843101..16843277,
FT                   16843351..16843472,16844054..16844218,16845115..16845294,
FT                   16848154..16848320,16849539..16849615,16850552..16850668,
FT                   16853657..16853708,16853864..16853991,16854074..16854142,
FT                   16854317..16854425,16854591..16854778,16855453..16855506,
FT                   16855586..16855645,16858166..16858228,16858736..16858909)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_a"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176110.1
FT                   protein_id=mCP99033.1 isoform=CRA_a"
FT                   /protein_id="EDL07069.1"
FT   assembly_gap    16820499..16820518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16824198..16824217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16827654..16828074
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   mRNA            join(<16855596..16855645,16858166..16858228,
FT                   16858736..16858831,16858989..16859096,16859556..16859732)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT176111"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176111.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<16855598..16855645,16858166..16858228,
FT                   16858736..16858831,16858989..16859096,16859556..16859627)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_b"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176111.0
FT                   protein_id=mCP99032.0 isoform=CRA_b"
FT                   /protein_id="EDL07070.1"
FT   gene            complement(16859297..>16876108)
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /note="gene_id=mCG6296.2"
FT   mRNA            complement(join(16859297..16859450,16860401..16860558))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173125"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173125.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(16859298..16859953,16860401..16860561,
FT                   16861458..16861666,16861776..16861944,16862023..16862145,
FT                   16863621..16863867,16863955..16864090,16864510..16864627,
FT                   16864727..16864780,16865351..16865511,16865957..16866064,
FT                   16866351..16866428,16866624..16866744,16868090..16868326,
FT                   16869090..16869216,16869353..16869501,16869605..16869787,
FT                   16869974..16870053,16870179..16870325,16870432..16870596,
FT                   16871614..16871809,16874518..16875285,16875984..>16876108))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT5362"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT5362.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16859422..16859450,16860401..16860557))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_a"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173125.0
FT                   protein_id=mCP96044.0 isoform=CRA_a"
FT                   /protein_id="EDL07065.1"
FT                   RRYGIPQGCDLELRPE"
FT   CDS             complement(join(16859877..16859953,16860401..16860561,
FT                   16861458..16861666,16861776..16861944,16862023..16862145,
FT                   16863621..16863867,16863955..16864090,16864510..16864627,
FT                   16864727..16864780,16865351..16865511,16865957..16866064,
FT                   16866351..16866428,16866624..16866744,16868090..16868326,
FT                   16869090..16869216,16869353..16869501,16869605..16869787,
FT                   16869974..16870053,16870179..16870325,16870432..16870596,
FT                   16871614..16871809,16874518..>16875191))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_b"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT5362.1
FT                   protein_id=mCP7291.1 isoform=CRA_b"
FT                   /protein_id="EDL07066.1"
FT                   LTKGSLEKRSQPGP"
FT   mRNA            complement(join(<16861511..16861666,16861776..16862145,
FT                   16863621..>16863687))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173124"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173124.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(<16861511..16861666,16861776..>16862018))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_d"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173124.0
FT                   protein_id=mCP96042.0 isoform=CRA_d"
FT                   /protein_id="EDL07068.1"
FT   mRNA            complement(join(<16874809..16875285,16875817..>16875984))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173123"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173123.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(<16874809..>16875207)
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_c"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173123.0
FT                   protein_id=mCP96043.0 isoform=CRA_c"
FT                   /protein_id="EDL07067.1"
FT   assembly_gap    16878179..16878198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16894652..16894692
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            <16911438..16945731
FT                   /locus_tag="mCG_144576"
FT                   /note="gene_id=mCG144576.0"
FT   mRNA            join(<16911438..16911572,16935218..16935277,
FT                   16942514..16945731)
FT                   /locus_tag="mCG_144576"
FT                   /product="mCG144576"
FT                   /note="gene_id=mCG144576.0 transcript_id=mCT184000.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    16937129..16937203
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    16940619..16940781
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   CDS             <16942872..16943381
FT                   /codon_start=1
FT                   /locus_tag="mCG_144576"
FT                   /product="mCG144576"
FT                   /note="gene_id=mCG144576.0 transcript_id=mCT184000.0
FT                   protein_id=mCP106146.0"
FT                   /protein_id="EDL07064.1"
FT                   HSPPKP"
FT   assembly_gap    16952050..16952069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16963900..16964142
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    16974351..16976277
FT                   /estimated_length=1927
FT                   /gap_type="unknown"
FT   assembly_gap    16978164..16978183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16987797..16987816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16989603..16989639
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(16997747..17003720)
FT                   /locus_tag="mCG_147198"
FT                   /note="gene_id=mCG147198.0"
FT   mRNA            complement(join(16997747..16998148,17003482..17003720))
FT                   /locus_tag="mCG_147198"
FT                   /product="mCG147198"
FT                   /note="gene_id=mCG147198.0 transcript_id=mCT187461.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16997837..16998043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147198"
FT                   /product="mCG147198"
FT                   /note="gene_id=mCG147198.0 transcript_id=mCT187461.0
FT                   protein_id=mCP109605.0"
FT                   /protein_id="EDL07063.1"
FT   gene            complement(17004469..>17029149)
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /note="gene_id=mCG6306.1"
FT   mRNA            complement(join(17004469..17004904,17005886..17006092,
FT                   17009909..17009982,17010338..17010462,17010725..17010861,
FT                   17011048..17011185,17011863..17012029,17012956..17013103,
FT                   17015200..17015350,17019005..17019191,17028841..>17029149))
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   transcript variant mCT5358"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT5358.1 created on
FT                   10-SEP-2002"
FT   mRNA            complement(join(17004472..17004720,17009951..17009982,
FT                   17010338..>17010377))
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   transcript variant mCT173134"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT173134.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(17004488..>17004664)
FT                   /codon_start=1
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT173134.0
FT                   protein_id=mCP96053.0 isoform=CRA_a"
FT                   /protein_id="EDL07061.1"
FT                   FQGTQDHSILCSK"
FT   CDS             complement(join(17005910..17006092,17009909..17009982,
FT                   17010338..17010462,17010725..17010861,17011048..17011185,
FT                   17011863..17012029,17012956..17013103,17015200..17015350,
FT                   17019005..17019191,17028841..>17029147))
FT                   /codon_start=1
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT5358.1
FT                   protein_id=mCP7272.0 isoform=CRA_b"
FT                   /protein_id="EDL07062.1"
FT   assembly_gap    17007987..17008354
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    17013340..17013359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17014408..17014513
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    17024560..17024579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17051803..17052289
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    17053163..17053657
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    17057685..17060292
FT                   /estimated_length=2608
FT                   /gap_type="unknown"
FT   assembly_gap    17061373..17063681
FT                   /estimated_length=2309
FT                   /gap_type="unknown"
FT   assembly_gap    17066964..17066983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17069847..17069866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17071380..17074057
FT                   /estimated_length=2678
FT                   /gap_type="unknown"
FT   gene            <17074659..17081937
FT                   /locus_tag="mCG_124632"
FT                   /note="gene_id=mCG124632.0"
FT   mRNA            join(<17074659..17074821,17076222..17076351,
FT                   17081489..17081625,17081727..17081937)
FT                   /locus_tag="mCG_124632"
FT                   /product="mCG124632"
FT                   /note="gene_id=mCG124632.0 transcript_id=mCT125880.0
FT                   created on 11-NOV-2002"
FT   CDS             join(17074659..17074821,17076222..17076351,
FT                   17081489..17081625,17081727..17081749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124632"
FT                   /product="mCG124632"
FT                   /note="gene_id=mCG124632.0 transcript_id=mCT125880.0
FT                   protein_id=mCP88938.0"
FT                   /protein_id="EDL07060.1"
FT   assembly_gap    17075393..17075750
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    17076993..17077012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17078085..17078104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17081985..17082154
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   gene            17083634..17103459
FT                   /locus_tag="mCG_141644"
FT                   /note="gene_id=mCG141644.0"
FT   mRNA            join(17083634..17083757,17085369..17085520,
FT                   17087260..17087360,17088173..17088266,17088353..17088432,
FT                   17088612..17088839,17089319..17089415,17090566..17090623,
FT                   17092139..17092300,17094592..17094682,17096274..17096332,
FT                   17097238..17097369,17098168..17098325,17100005..17102130,
FT                   17102243..17102368,17102962..17103459)
FT                   /locus_tag="mCG_141644"
FT                   /product="mCG141644"
FT                   /note="gene_id=mCG141644.0 transcript_id=mCT176112.0
FT                   created on 11-NOV-2002"
FT   assembly_gap    17083873..17083892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(17085467..17085520,17087260..17087360,
FT                   17088173..17088266,17088353..17088432,17088612..17088839,
FT                   17089319..17089415,17090566..17090623,17092139..17092300,
FT                   17094592..17094682,17096274..17096332,17097238..17097369,
FT                   17098168..17098325,17100005..17100634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141644"
FT                   /product="mCG141644"
FT                   /note="gene_id=mCG141644.0 transcript_id=mCT176112.0
FT                   protein_id=mCP99034.0"
FT                   /protein_id="EDL07059.1"
FT                   PLSPEEHFTSGM"
FT   gene            complement(17104019..>17120467)
FT                   /locus_tag="mCG_19450"
FT                   /note="gene_id=mCG19450.1"
FT   mRNA            complement(join(17104019..17105223,17105458..17105604,
FT                   17105695..17105893,17106491..17106697,17107258..17107473,
FT                   17108413..17108589,17108760..17108885,17109086..17109283,
FT                   17110934..17111136,17113046..17113233,17114011..17114108,
FT                   17114732..17114950,17115476..17115592,17116628..17116874,
FT                   17117013..17117191,17117270..17117406,17117723..17117923,
FT                   17120140..>17120467))
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, transcript variant mCT20073"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT20073.2 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(17104856..17105223,17105458..17105604,
FT                   17105695..17105893,17106491..17106697,17107258..17107473,
FT                   17108413..17108589,17108760..17108885,17109086..17109283,
FT                   17110934..17111136,17113046..17113233,17114011..17114108,
FT                   17114732..17114950,17115476..17115592,17116628..17116874,
FT                   17117013..17117191,17117270..17117406,17117723..17117923,
FT                   17120140..17120467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, isoform CRA_b"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT20073.2
FT                   protein_id=mCP7219.2 isoform=CRA_b"
FT                   /protein_id="EDL07057.1"
FT                   WEPRRTSPGMIDVRKNPL"
FT   mRNA            complement(join(<17105832..17105893,17106491..17106697,
FT                   17107258..17107441,17110996..17111136,17113046..17113195,
FT                   17113299..>17113353))
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, transcript variant mCT175837"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT175837.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(<17105832..17105893,17106491..17106697,
FT                   17107258..17107441,17110996..>17111045))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, isoform CRA_a"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT175837.0
FT                   protein_id=mCP98759.0 isoform=CRA_a"
FT                   /protein_id="EDL07056.1"
FT                   ELEM"
FT   gene            17116679..17118667
FT                   /locus_tag="mCG_147196"
FT                   /note="gene_id=mCG147196.0"
FT   mRNA            17116679..17118667
FT                   /locus_tag="mCG_147196"
FT                   /product="mCG147196"
FT                   /note="gene_id=mCG147196.0 transcript_id=mCT187459.0
FT                   created on 13-JAN-2004"
FT   CDS             17117040..17117426
FT                   /codon_start=1
FT                   /locus_tag="mCG_147196"
FT                   /product="mCG147196"
FT                   /note="gene_id=mCG147196.0 transcript_id=mCT187459.0
FT                   protein_id=mCP109604.0"
FT                   /db_xref="GOA:Q9D5P0"
FT                   /db_xref="MGI:MGI:3696417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5P0"
FT                   /protein_id="EDL07058.1"
FT   assembly_gap    17120921..17120940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17124567..17124586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17127304..17127794
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   gene            complement(17128086..17139806)
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /note="gene_id=mCG19463.2"
FT   mRNA            complement(join(17128086..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..17139067,
FT                   17139654..17139806))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT20084"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT20084.2 created
FT                   on 11-NOV-2002"
FT   mRNA            complement(join(17128086..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..>17139083))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT189931"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT189931.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(17128309..17128680,17129529..17129601,
FT                   17130264..>17130301))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175844"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175844.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17128342..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..>17139083))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_e"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT189931.0
FT                   protein_id=mCP110920.0 isoform=CRA_e"
FT                   /protein_id="EDL07054.1"
FT                   AQYSQLRKKS"
FT   CDS             complement(join(17128342..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_f"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT20084.2
FT                   protein_id=mCP7265.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q8CGN5"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:1890505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGN5"
FT                   /protein_id="EDL07055.1"
FT                   "
FT   CDS             complement(join(17128342..17128680,17129529..17129601,
FT                   17130264..>17130265))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_c"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175844.0
FT                   protein_id=mCP98766.0 isoform=CRA_c"
FT                   /protein_id="EDL07052.1"
FT   mRNA            complement(join(17129302..17129774,17130172..17130189,
FT                   17136839..17136967,17139009..17139067,17139654..17139805))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175842"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175842.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17129478..17129774,17130172..17130189,
FT                   17136839..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_a"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175842.0
FT                   protein_id=mCP98765.0 isoform=CRA_a"
FT                   /protein_id="EDL07050.1"
FT   mRNA            complement(join(17132412..17132728,17133316..17133577,
FT                   17134882..>17134971))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175845"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175845.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17132517..17132728,17133316..17133577,
FT                   17134882..>17134971))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_d"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175845.0
FT                   protein_id=mCP98764.0 isoform=CRA_d"
FT                   /protein_id="EDL07053.1"
FT   mRNA            complement(join(17136392..17136967,17139009..17139067,
FT                   17139654..17139805))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175843"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175843.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17136749..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_b"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175843.0
FT                   protein_id=mCP98767.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0U1RNY2"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:1890505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNY2"
FT                   /protein_id="EDL07051.1"
FT   assembly_gap    17140198..17140690
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   gene            complement(17144028..>17149790)
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /note="gene_id=mCG19440.0"
FT   mRNA            complement(join(17144028..17144674,17146929..17147044,
FT                   17149675..>17149790))
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, transcript
FT                   variant mCT19835"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT19835.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(17144028..17144674,17149675..17149772))
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, transcript
FT                   variant mCT173115"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT173115.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(17144106..17144674,17146929..17147044,
FT                   17149675..>17149790))
FT                   /codon_start=1
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, isoform CRA_b"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT19835.0
FT                   protein_id=mCP7235.0 isoform=CRA_b"
FT                   /protein_id="EDL07049.1"
FT   CDS             complement(join(17144632..17144674,17149675..17149730))
FT                   /codon_start=1
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, isoform CRA_a"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT173115.0
FT                   protein_id=mCP96034.0 isoform=CRA_a"
FT                   /protein_id="EDL07048.1"
FT                   /translation="MDAFIRVANQSQGRDRLFRVQTGQRVPCHPGN"
FT   assembly_gap    17166001..17166260
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    17167085..17167104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17170157..17170731
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    17186881..17187126
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   gene            complement(17196875..17197537)
FT                   /locus_tag="mCG_141320"
FT                   /note="gene_id=mCG141320.0"
FT   mRNA            complement(17196875..17197537)
FT                   /locus_tag="mCG_141320"
FT                   /product="mCG141320"
FT                   /note="gene_id=mCG141320.0 transcript_id=mCT174600.0
FT                   created on 17-OCT-2002"
FT   CDS             complement(17197023..17197349)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141320"
FT                   /product="mCG141320"
FT                   /note="gene_id=mCG141320.0 transcript_id=mCT174600.0
FT                   protein_id=mCP97519.0"
FT                   /protein_id="EDL07047.1"
FT                   LSEA"
FT   gene            complement(17198996..17200522)
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /note="gene_id=mCG19467.1"
FT   mRNA            complement(join(17198996..17199345,17199619..17200522))
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /product="mesoderm posterior 1"
FT                   /note="gene_id=mCG19467.1 transcript_id=mCT20089.2 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(17199277..17199345,17199619..17200281))
FT                   /codon_start=1
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /product="mesoderm posterior 1"
FT                   /note="gene_id=mCG19467.1 transcript_id=mCT20089.2
FT                   protein_id=mCP7308.1"
FT                   /protein_id="EDL07046.1"
FT   gene            17217553..17220184
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /note="gene_id=mCG19460.1"
FT   mRNA            join(17217553..17218518,17219288..17220184)
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /product="mesoderm posterior 2"
FT                   /note="gene_id=mCG19460.1 transcript_id=mCT20081.1 created
FT                   on 11-NOV-2002"
FT   CDS             join(17217688..17218518,17219288..17219569)
FT                   /codon_start=1
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /product="mesoderm posterior 2"
FT                   /note="gene_id=mCG19460.1 transcript_id=mCT20081.1
FT                   protein_id=mCP7231.1"
FT                   /db_xref="GOA:A6H5V4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:1096325"
FT                   /db_xref="UniProtKB/TrEMBL:A6H5V4"
FT                   /protein_id="EDL07045.1"
FT   assembly_gap    17228462..17228564
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            complement(17228651..17250509)
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /note="gene_id=mCG19457.1"
FT   mRNA            complement(join(17228651..17229223,17232150..17232231,
FT                   17232553..17232693,17233439..17233606,17233718..17233828,
FT                   17234419..17234510,17241813..17241960,17243356..17243411,
FT                   17243513..17243646,17244195..17244268,17244457..17244632,
FT                   17246468..17246533,17246639..17246704,17246873..17247016,
FT                   17247114..17247227,17247388..17247542,17247627..17247753,
FT                   17249098..17249234,17249311..17249453,17249863..17250509))
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /product="alanyl (membrane) aminopeptidase"
FT                   /note="gene_id=mCG19457.1 transcript_id=mCT20079.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17229071..17229223,17232150..17232231,
FT                   17232553..17232693,17233439..17233606,17233718..17233828,
FT                   17234419..17234510,17241813..17241960,17243356..17243411,
FT                   17243513..17243646,17244195..17244268,17244457..17244632,
FT                   17246468..17246533,17246639..17246704,17246873..17247016,
FT                   17247114..17247227,17247388..17247542,17247627..17247753,
FT                   17249098..17249234,17249311..17249453,17249863..17250476))
FT                   /codon_start=1
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /product="alanyl (membrane) aminopeptidase"
FT                   /note="gene_id=mCG19457.1 transcript_id=mCT20079.1
FT                   protein_id=mCP7344.1"
FT                   /protein_id="EDL07044.1"
FT   assembly_gap    17235810..17237803
FT                   /estimated_length=1994
FT                   /gap_type="unknown"
FT   assembly_gap    17254034..17254053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17255926..17257131
FT                   /estimated_length=1206
FT                   /gap_type="unknown"
FT   assembly_gap    17258350..17258369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17274327..17274383
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    17276903..17276961
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(17286171..17327030)
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /note="gene_id=mCG19454.2"
FT   mRNA            complement(join(17286171..17287021,17288875..17288982,
FT                   17316269..17316340,17321581..17321692,17322450..17322541,
FT                   17326943..17327029))
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, transcript variant mCT20077"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT20077.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(17286893..17287021,17288875..17288982,
FT                   17316269..17316340,17321581..17321692,17322450..17322541,
FT                   17326943..17327011))
FT                   /codon_start=1
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT20077.1
FT                   protein_id=mCP7324.1 isoform=CRA_b"
FT                   /protein_id="EDL07043.1"
FT   mRNA            complement(join(17288920..17288982,17316269..17316340,
FT                   17321581..17321692,17322450..17322541,17323665..17323756,
FT                   17326943..17327030))
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, transcript variant mCT173116"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT173116.0 created
FT                   on 10-SEP-2002"
FT   assembly_gap    17304037..17304112
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   CDS             complement(join(17323697..17323756,17326943..17327011))
FT                   /codon_start=1
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT173116.0
FT                   protein_id=mCP96035.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RQ64"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="MGI:MGI:1337060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RQ64"
FT                   /protein_id="EDL07042.1"
FT   gene            17327187..17328955
FT                   /locus_tag="mCG_147210"
FT                   /note="gene_id=mCG147210.0"
FT   mRNA            join(17327187..17327373,17327483..17328955)
FT                   /locus_tag="mCG_147210"
FT                   /product="mCG147210"
FT                   /note="gene_id=mCG147210.0 transcript_id=mCT187473.0
FT                   created on 13-JAN-2004"
FT   CDS             17327805..17328062
FT                   /codon_start=1
FT                   /locus_tag="mCG_147210"
FT                   /product="mCG147210"
FT                   /note="gene_id=mCG147210.0 transcript_id=mCT187473.0
FT                   protein_id=mCP109617.0"
FT                   /protein_id="EDL07041.1"
FT   gene            complement(17332253..17341748)
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /note="gene_id=mCG141104.0"
FT   mRNA            complement(join(17332253..17333284,17334060..17334223,
FT                   17334606..17334812,17336007..17336139,17338229..17338304,
FT                   17341579..17341748))
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /product="RIKEN cDNA 2610034B18"
FT                   /note="gene_id=mCG141104.0 transcript_id=mCT173117.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(17333276..17333284,17334060..17334223,
FT                   17334606..17334812,17336007..17336139,17338229..17338304,
FT                   17341579..17341670))
FT                   /codon_start=1
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /product="RIKEN cDNA 2610034B18"
FT                   /note="gene_id=mCG141104.0 transcript_id=mCT173117.0
FT                   protein_id=mCP96036.0"
FT                   /protein_id="EDL07040.1"
FT                   EWDD"
FT   assembly_gap    17343560..17343579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17352534..17352701
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    17358965..17359016
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    17373582..17373601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17378989..17379193
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    17381793..17381812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17383084..17383103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17388225..17388279
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    17397531..17398252
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    17402277..17402505
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    17407092..17407144
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    17410440..17410531
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    17414727..17414983
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    17415864..17415984
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    17417415..17417947
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    17424629..17424648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17431710..17432673
FT                   /estimated_length=964
FT                   /gap_type="unknown"
FT   assembly_gap    17439554..17439612
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    17446229..17446265
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    17459507..17459612
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(17468468..>17481218)
FT                   /locus_tag="mCG_1028355"
FT                   /note="gene_id=mCG1028355.1"
FT   mRNA            complement(join(17468468..17468657,17475494..17475661,
FT                   17481044..>17481218))
FT                   /locus_tag="mCG_1028355"
FT                   /product="mCG1028355"
FT                   /note="gene_id=mCG1028355.1 transcript_id=mCT146059.1
FT                   created on 11-NOV-2002"
FT   gene            17469599..17470936
FT                   /locus_tag="mCG_1028354"
FT                   /note="gene_id=mCG1028354.1"
FT   mRNA            join(17469599..17470094,17470272..17470936)
FT                   /locus_tag="mCG_1028354"
FT                   /product="mCG1028354"
FT                   /note="gene_id=mCG1028354.1 transcript_id=mCT146058.1
FT                   created on 11-NOV-2002"
FT   CDS             17469705..17469857
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028354"
FT                   /product="mCG1028354"
FT                   /note="gene_id=mCG1028354.1 transcript_id=mCT146058.1
FT                   protein_id=mCP88742.1"
FT                   /protein_id="EDL07039.1"
FT                   APFFF"
FT   assembly_gap    17471250..17471341
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    17474505..17474691
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   CDS             complement(join(17475540..17475661,17481044..>17481122))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028355"
FT                   /product="mCG1028355"
FT                   /note="gene_id=mCG1028355.1 transcript_id=mCT146059.1
FT                   protein_id=mCP88745.1"
FT                   /protein_id="EDL07038.1"
FT   gene            17486824..17496945
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /note="gene_id=mCG19453.2"
FT   mRNA            join(17486824..17488490,17491948..17492139,
FT                   17492431..17492605,17496341..17496945)
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, transcript variant
FT                   mCT20076"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT20076.2 created
FT                   on 11-NOV-2002"
FT   CDS             join(17487027..17488490,17491948..17492139,
FT                   17492431..17492605,17496341..17496510)
FT                   /codon_start=1
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, isoform CRA_b"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT20076.2
FT                   protein_id=mCP7226.2 isoform=CRA_b"
FT                   /protein_id="EDL07037.1"
FT   mRNA            join(<17487027..17488490,17491948..17492139,
FT                   17492431..17492847)
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, transcript variant
FT                   mCT175838"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT175838.0 created
FT                   on 11-NOV-2002"
FT   CDS             join(17487027..17488490,17491948..17492139,
FT                   17492431..17492772)
FT                   /codon_start=1
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, isoform CRA_a"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT175838.0
FT                   protein_id=mCP98760.0 isoform=CRA_a"
FT                   /protein_id="EDL07036.1"
FT   gene            complement(17500853..17521345)
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /note="gene_id=mCG19451.2"
FT   mRNA            complement(join(17500853..17501210,17501630..17501722,
FT                   17501808..17501905,17502032..17502144,17503813..17503964,
FT                   17504145..17504281,17504774..17504917,17505001..17505161,
FT                   17506746..17506911,17509124..17509215,17521185..17521334))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT20074"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT20074.0 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(17501066..17501175,17506865..17506911,
FT                   17509124..17509215,17521185..17521327))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172343"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172343.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(17501123..17501210,17501630..17501722,
FT                   17501808..17501905,17502032..17502144,17503813..17503964,
FT                   17504145..17504281,17504774..17504917,17505001..17505161,
FT                   17506746..17506911,17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_d"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT20074.0
FT                   protein_id=mCP7300.1 isoform=CRA_d"
FT                   /protein_id="EDL07035.1"
FT   CDS             complement(join(17501157..17501175,17506865..17506911,
FT                   17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_a"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172343.0
FT                   protein_id=mCP95262.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RPR1"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:96414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RPR1"
FT                   /protein_id="EDL07032.1"
FT   mRNA            complement(join(<17501687..17501722,17501808..17501905,
FT                   17502032..17502144,17503813..>17504412))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172344"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172344.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(<17501687..17501722,17501808..17501905,
FT                   17502032..17502144,17503813..>17504140))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_b"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172344.0
FT                   protein_id=mCP95263.0 isoform=CRA_b"
FT                   /protein_id="EDL07033.1"
FT   mRNA            complement(join(17505004..17505159,17506739..17506911,
FT                   17509124..17509215,17521185..17521345))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172345"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172345.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(17505150..17505159,17506739..17506911,
FT                   17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_c"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172345.0
FT                   protein_id=mCP95264.0 isoform=CRA_c"
FT                   /protein_id="EDL07034.1"
FT   assembly_gap    17526587..17527909
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    17531322..17531341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17548355..17548374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17549552..17549571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17552877..17552896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17555950..17555969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17557061..17559166
FT                   /estimated_length=2106
FT                   /gap_type="unknown"
FT   assembly_gap    17563925..17564059
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    17565713..17565813
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    17569828..17569847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17584965..17585023
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    17592477..17592997
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    17594581..17595613
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   gene            17595619..17634311
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /note="gene_id=mCG19462.2"
FT   mRNA            join(17595619..17595732,17607448..17607699,
FT                   17621718..17621881,17622184..17622246,17624541..17624639,
FT                   17625246..17625357,17625647..17625760,17625865..17626016,
FT                   17627800..17627981,17628103..17628253,17629038..17629248,
FT                   17629359..17629474,17629705..17629871,17632822..17632904,
FT                   17633484..17634311)
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4B"
FT                   /note="gene_id=mCG19462.2 transcript_id=mCT20086.2 created
FT                   on 16-DEC-2002"
FT   assembly_gap    17601317..17601431
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    17605471..17605795
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   CDS             join(17607582..17607699,17621718..17621881,
FT                   17622184..17622246,17624541..17624639,17625246..17625357,
FT                   17625647..17625760,17625865..17626016,17627800..17627981,
FT                   17628103..17628253,17629038..17629248,17629359..17629474,
FT                   17629705..17629871,17632822..17632904,17633484..17634223)
FT                   /codon_start=1
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4B"
FT                   /note="gene_id=mCG19462.2 transcript_id=mCT20086.2
FT                   protein_id=mCP7317.1"
FT                   /protein_id="EDL07031.1"
FT                   RLGSEIRDSVV"
FT   gene            complement(17636036..17641618)
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /note="gene_id=mCG19448.1"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT177763"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177763.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637417,17639200..17639308,
FT                   17641228..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT177762"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177762.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17639200..17639308,
FT                   17641228..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT19839"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT19839.2 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177763.1
FT                   protein_id=mCP100685.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C2K4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1344418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C2K4"
FT                   /protein_id="EDL07028.1"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637417,17639200..17639308,
FT                   17641228..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177762.1
FT                   protein_id=mCP100684.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RPF3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1344418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RPF3"
FT                   /protein_id="EDL07027.1"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17639200..17639308,
FT                   17641228..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT19839.2
FT                   protein_id=mCP7282.0 isoform=CRA_c"
FT                   /protein_id="EDL07029.1"
FT   mRNA            complement(join(17640450..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT172341"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT172341.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(17641224..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT172341.0
FT                   protein_id=mCP95260.0 isoform=CRA_d"
FT                   /protein_id="EDL07030.1"
FT                   /translation="MGGSGSRLSKELLAEYQDLTFLTKQEILL"
FT   gene            17641801..17649533
FT                   /locus_tag="mCG_131044"
FT                   /note="gene_id=mCG131044.1"
FT   mRNA            join(17641801..17642093,17648252..17649533)
FT                   /locus_tag="mCG_131044"
FT                   /product="mCG131044"
FT                   /note="gene_id=mCG131044.1 transcript_id=mCT132372.1
FT                   created on 11-NOV-2002"
FT   assembly_gap    17647727..17648251
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   CDS             17648395..17649144
FT                   /codon_start=1
FT                   /locus_tag="mCG_131044"
FT                   /product="mCG131044"
FT                   /note="gene_id=mCG131044.1 transcript_id=mCT132372.1
FT                   protein_id=mCP88792.1"
FT                   /protein_id="EDL07026.1"
FT   assembly_gap    17655880..17656056
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            17656214..17670914
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /note="gene_id=mCG141534.0"
FT   mRNA            join(17656214..17656320,17656941..17657208,
FT                   17657953..17657993,17662531..17662750,17663160..17663316,
FT                   17663698..17663841,17664207..17664292,17664593..17664824,
FT                   17665434..17665618,17666939..17667124,17668274..17668454,
FT                   17668740..17668919,17669472..17669790,17670425..17670914)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175839"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175839.0
FT                   created on 11-NOV-2002"
FT   mRNA            join(17656651..17657208,17657953..>17658006)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175840"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175840.0
FT                   created on 11-NOV-2002"
FT   CDS             join(17656952..17657208,17657953..17657993,
FT                   17662531..17662750,17663160..17663316,17663698..17663841,
FT                   17664207..17664292,17664593..17664824,17665434..17665618,
FT                   17666939..17667124,17668274..17668454,17668740..17668919,
FT                   17669472..17669790,17670425..17670621)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_c"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175839.0
FT                   protein_id=mCP98763.0 isoform=CRA_c"
FT                   /protein_id="EDL07025.1"
FT   CDS             join(17656952..17657208,17657953..>17658006)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_a"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175840.0
FT                   protein_id=mCP98762.0 isoform=CRA_a"
FT                   /protein_id="EDL07023.1"
FT                   "
FT   assembly_gap    17660217..17660236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17661730..17661899
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   mRNA            join(<17668371..17668454,17668740..17669285)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175841"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175841.0
FT                   created on 11-NOV-2002"
FT   CDS             join(<17668371..17668454,17668740..17669012)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_b"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175841.0
FT                   protein_id=mCP98761.0 isoform=CRA_b"
FT                   /protein_id="EDL07024.1"
FT                   DANTWWWFHQRRFL"
FT   gene            17671344..17674073
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /note="gene_id=mCG19449.1"
FT   mRNA            join(17671344..17671519,17671917..17672027,
FT                   17673106..17674073)
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, transcript
FT                   variant mCT20072"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT20072.1 created
FT                   on 23-AUG-2002"
FT   mRNA            join(17671344..17672027,17673106..17673213)
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, transcript
FT                   variant mCT172342"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT172342.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(17671356..17671519,17671917..17672027,
FT                   17673106..17673712)
FT                   /codon_start=1
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT20072.1
FT                   protein_id=mCP7326.2 isoform=CRA_b"
FT                   /protein_id="EDL07022.1"
FT                   FFDSNGNFLYRI"
FT   CDS             17671356..17671556
FT                   /codon_start=1
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT172342.0
FT                   protein_id=mCP95261.0 isoform=CRA_a"
FT                   /protein_id="EDL07021.1"
FT   assembly_gap    17674074..17674300
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   gene            17678569..17699970
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /note="gene_id=mCG19446.2"
FT   mRNA            join(17678569..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17690890..17690984,17691827..17691931,17692379..17692456)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT175836"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175836.0 created
FT                   on 08-NOV-2002"
FT   mRNA            join(17678593..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17688364..17688409,17690890..17690984,17691827..17691931,
FT                   17692379..17692475,17692683..17692760,17692941..17693014,
FT                   17693417..17693503,17693649..17693739,17693955..17694029,
FT                   17694233..17694297,17694410..17694464,17695507..17695553,
FT                   17696177..17696309,17696799..17696872,17698382..17698483,
FT                   17698668..17698743,17698848..17698964,17699515..17699970)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT20070"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT20070.2 created
FT                   on 08-NOV-2002"
FT   CDS             join(17678883..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17688364..17688409,17690890..17690984,17691827..17691931,
FT                   17692379..17692475,17692683..17692760,17692941..17693014,
FT                   17693417..17693503,17693649..17693739,17693955..17694029,
FT                   17694233..17694297,17694410..17694464,17695507..17695553,
FT                   17696177..17696309,17696799..17696872,17698382..17698483,
FT                   17698668..17698743,17698848..17698964,17699515..17699594)
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT20070.2
FT                   protein_id=mCP7270.2 isoform=CRA_c"
FT                   /protein_id="EDL07020.1"
FT   CDS             join(17678883..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17690890..17690895)
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175836.0
FT                   protein_id=mCP98757.0 isoform=CRA_b"
FT                   /protein_id="EDL07019.1"
FT                   AGRIRKYKVILSPQKM"
FT   assembly_gap    17680592..17680611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17688534..17688624
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   mRNA            join(<17698440..17698483,17698668..17698743,
FT                   17699515..17699970)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT175835"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175835.0 created
FT                   on 08-NOV-2002"
FT   CDS             <17699644..17699910
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175835.0
FT                   protein_id=mCP98758.0 isoform=CRA_a"
FT                   /protein_id="EDL07018.1"
FT   gene            complement(17701631..>17733640)
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /note="gene_id=mCG131045.1"
FT   mRNA            complement(join(17701631..17703341,17704396..17704442,
FT                   17711204..17711299,17714010..17714201,17719293..17719367,
FT                   17725011..17725197,17725600..17725629,17726707..17726874,
FT                   17727094..>17727723))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180397"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180397.0
FT                   created on 04-FEB-2003"
FT   gene            17702858..17724575
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /note="gene_id=mCG19465.2"
FT   mRNA            join(17702858..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17721052)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT185137"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185137.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702873..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721437,17723427..17724568)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT185136"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185136.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702876..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721514,17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT20087"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT20087.2 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702911..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17721836..17721874,
FT                   17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT175846"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT175846.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(<17702911..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT189936"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT189936.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<17702912..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT189936.0
FT                   protein_id=mCP110921.0 isoform=CRA_d"
FT                   /protein_id="EDL07015.1"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721514,17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT20087.2
FT                   protein_id=mCP7267.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3UW86"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="InterPro:IPR032921"
FT                   /db_xref="MGI:MGI:1858961"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW86"
FT                   /protein_id="EDL07016.1"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17721836..17721874,
FT                   17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT175846.0
FT                   protein_id=mCP98768.0 isoform=CRA_a"
FT                   /protein_id="EDL07012.1"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721437,17723427..17723455)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185136.0
FT                   protein_id=mCP106395.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UY19"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="InterPro:IPR032921"
FT                   /db_xref="MGI:MGI:1858961"
FT                   /db_xref="UniProtKB/TrEMBL:G3UY19"
FT                   /protein_id="EDL07013.1"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719505)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185137.0
FT                   protein_id=mCP106394.0 isoform=CRA_c"
FT                   /protein_id="EDL07014.1"
FT   gene            17706125..17708009
FT                   /locus_tag="mCG_147197"
FT                   /note="gene_id=mCG147197.0"
FT   mRNA            join(17706125..17706663,17707360..17708009)
FT                   /locus_tag="mCG_147197"
FT                   /product="mCG147197"
FT                   /note="gene_id=mCG147197.0 transcript_id=mCT187460.0
FT                   created on 13-JAN-2004"
FT   CDS             17706206..17706304
FT                   /codon_start=1
FT                   /locus_tag="mCG_147197"
FT                   /product="mCG147197"
FT                   /note="gene_id=mCG147197.0 transcript_id=mCT187460.0
FT                   protein_id=mCP109603.0"
FT                   /protein_id="EDL07017.1"
FT                   /translation="MYVNVWFSHQQRSEVLHSMAVTDGCDDIGAAN"
FT   mRNA            complement(join(17723599..17723800,17726157..>17726216))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT175833"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT175833.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(17723606..>17723725)
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT175833.0
FT                   protein_id=mCP98755.0 isoform=CRA_b"
FT                   /protein_id="EDL07007.1"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728045..17728137,
FT                   17728226..17728622,17728786..17729105,17729201..17729267,
FT                   17732934..>17733610))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180396"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180396.0
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728226..17728622,
FT                   17728786..17729267,17731675..17732080))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT132373"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT132373.1
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728045..17729105,
FT                   17729201..17729267,17731675..>17732055))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180399"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180399.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(17725046..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..>17727265))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180397.0
FT                   protein_id=mCP103321.0 isoform=CRA_c"
FT                   /protein_id="EDL07008.1"
FT                   YVYAMERDKS"
FT   CDS             complement(join(17727156..17727189,17728226..17728392))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT132373.1
FT                   protein_id=mCP88795.1 isoform=CRA_a"
FT                   /protein_id="EDL07006.1"
FT   assembly_gap    17727724..17728038
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   mRNA            complement(join(17728046..17728137,17728226..17729105,
FT                   17729201..17729267,17732934..>17733640))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180398"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180398.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(17728053..17728137,17728226..17728622,
FT                   17728786..>17729056))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_f"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180396.0
FT                   protein_id=mCP103319.0 isoform=CRA_f"
FT                   /protein_id="EDL07011.1"
FT   CDS             complement(join(17728053..17728137,17728226..>17728788))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_d"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180398.0
FT                   protein_id=mCP103318.0 isoform=CRA_d"
FT                   /protein_id="EDL07009.1"
FT   CDS             complement(17728222..>17728788)
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_e"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180399.0
FT                   protein_id=mCP103320.0 isoform=CRA_e"
FT                   /protein_id="EDL07010.1"
FT   assembly_gap    17732126..17732145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17734476..17749189)
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /note="gene_id=mCG19459.1"
FT   mRNA            complement(join(17734476..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738343,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749189))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT20082"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT20082.1 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(17734476..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738312,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749171))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT185135"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT185135.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(<17734479..17734638,17738776..17738828,
FT                   17739529..17739623,17740744..>17740954))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172347"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172347.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(<17734479..17734638,17738776..17738828,
FT                   17739529..17739623,17740744..>17740953))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172347.0
FT                   protein_id=mCP95267.0 isoform=CRA_b"
FT                   /protein_id="EDL07002.1"
FT                   QAHPANKFCG"
FT   mRNA            complement(join(17734506..17734669,17746113..17746165,
FT                   17748037..17748212,17748510..>17748547))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172346"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172346.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(17734612..17734669,17746113..17746165,
FT                   17748037..17748212,17748510..>17748546))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172346.0
FT                   protein_id=mCP95265.0 isoform=CRA_a"
FT                   /protein_id="EDL07001.1"
FT                   VES"
FT   CDS             complement(join(17734800..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738343,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749119))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_e"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT20082.1
FT                   protein_id=mCP7246.1 isoform=CRA_e"
FT                   /protein_id="EDL07005.1"
FT                   AVEYRLIQPNQDGE"
FT   CDS             complement(join(17737969..17737999,17738203..17738312,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749119))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_d"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT185135.0
FT                   protein_id=mCP106393.0 isoform=CRA_d"
FT                   /protein_id="EDL07004.1"
FT   mRNA            complement(join(<17746133..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..>17748999))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172348"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172348.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(<17746133..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..>17748998))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_c"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172348.0
FT                   protein_id=mCP95266.0 isoform=CRA_c"
FT                   /protein_id="EDL07003.1"
FT                   AKV"
FT   assembly_gap    17746591..17746754
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            17752135..17754336
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /note="gene_id=mCG19441.3"
FT   mRNA            join(17752135..17752265,17752555..17752610,
FT                   17752695..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT185199"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT185199.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(17752135..17752265,17752555..17752610,
FT                   17752732..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT19836"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT19836.3 created
FT                   on 12-JUN-2003"
FT   mRNA            join(17752143..17752471,17752555..17752610,
FT                   17752732..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT175834"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT175834.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(17752154..17752265,17752555..17752610,
FT                   17752732..17752972,17753280..17753410)
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT19836.3
FT                   protein_id=mCP7256.2 isoform=CRA_c"
FT                   /protein_id="EDL07000.1"
FT                   LEEALKQLFEERGLTL"
FT   CDS             join(17752154..17752265,17752555..17752610,
FT                   17752695..17752748)
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT185199.0
FT                   protein_id=mCP106457.0 isoform=CRA_b"
FT                   /protein_id="EDL06999.1"
FT   CDS             17752154..17752429
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT175834.1
FT                   protein_id=mCP98756.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1915945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNP1"
FT                   /protein_id="EDL06998.1"
FT   assembly_gap    17755236..17756178
FT                   /estimated_length=943
FT                   /gap_type="unknown"
FT   gene            complement(17756492..17778661)
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /note="gene_id=mCG19442.2"
FT   mRNA            complement(join(17756492..17757032,17761742..>17761865))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT175212"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175212.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(17756627..>17756806)
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_b"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175212.0
FT                   protein_id=mCP98130.0 isoform=CRA_b"
FT                   /protein_id="EDL06996.1"
FT                   VARLRPHGFLFMSW"
FT   mRNA            complement(join(17758697..17759252,17760325..17760432,
FT                   17760561..17760761,17763750..17763886,17765651..17765792,
FT                   17766318..17766451,17766688..17766802,17767044..17767166,
FT                   17768353..17768589,17769756..17769921,17770066..17770133,
FT                   17770346..17770460,17770611..17770793,17770924..17771126,
FT                   17771385..17771562,17774320..17774506,17774762..17774935,
FT                   17775148..17775275,17775665..17775836,17775957..17776101,
FT                   17776171..17776428,17777064..17777216,17778208..17778405,
FT                   17778578..17778661))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT19841"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT19841.2 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(17759100..17759252,17760325..17760432,
FT                   17760561..17760761,17763750..17763886,17765651..17765792,
FT                   17766318..17766451,17766688..17766802,17767044..17767166,
FT                   17768353..17768589,17769756..17769921,17770066..17770133,
FT                   17770346..17770460,17770611..17770793,17770924..17771126,
FT                   17771385..17771562,17774320..17774506,17774762..17774935,
FT                   17775148..17775275,17775665..17775836,17775957..17776101,
FT                   17776171..17776428,17777064..17777195))
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_c"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT19841.2
FT                   protein_id=mCP7225.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q197W7"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="MGI:MGI:2150656"
FT                   /db_xref="UniProtKB/TrEMBL:Q197W7"
FT                   /protein_id="EDL06997.1"
FT   mRNA            complement(join(<17760565..17760761,17763396..17763470,
FT                   17763750..17763886,17765651..17765792,17766318..17766451,
FT                   17766688..17766802,17767044..>17767153))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT175211"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175211.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(<17760565..17760761,17763396..17763470,
FT                   17763750..17763886,17765651..17765792,17766318..17766451,
FT                   17766688..17766802,17767044..>17767151))
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_a"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175211.0
FT                   protein_id=mCP98131.0 isoform=CRA_a"
FT                   /protein_id="EDL06995.1"
FT   assembly_gap    17767403..17767542
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(17785270..17795471)
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /note="gene_id=mCG19444.1"
FT   mRNA            complement(join(17785270..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789909,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794857,17795348..17795471))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT19842"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT19842.1 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785270..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787217,17787331..17787425,
FT                   17787722..17788405,17788678..17788800,17789114..17789323,
FT                   17789826..17789909,17790034..17790220,17790324..17790702,
FT                   17790782..17790919,17791347..17791530,17791704..17791800,
FT                   17794326..17794499,17794636..17794857,17795348..17795448))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174597"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174597.0 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785278..17785542,17786156..17786178,
FT                   17786292..17786449,17787124..>17787143))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174596"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174596.0 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785287..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789903,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..>17794906))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT189930"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT189930.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(17785304..17785542,17786156..>17786156))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_f"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174596.0
FT                   protein_id=mCP97516.0 isoform=CRA_f"
FT                   /protein_id="EDL06994.1"
FT   CDS             complement(join(17785446..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789903,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..>17794875))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_d"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT189930.0
FT                   protein_id=mCP110919.0 isoform=CRA_d"
FT                   /protein_id="EDL06992.1"
FT                   SFSIICQELHSIRKRHR"
FT   CDS             complement(join(17785446..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789909,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794848))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_e"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT19842.1
FT                   protein_id=mCP7259.1 isoform=CRA_e"
FT                   /protein_id="EDL06993.1"
FT                   ELHSIRKRHR"
FT   mRNA            complement(join(<17786332..17786449,17787124..17787247,
FT                   17787331..>17787948))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174599"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174599.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(<17786332..17786449,17787124..17787247,
FT                   17787331..>17787442))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_c"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174599.0
FT                   protein_id=mCP97518.0 isoform=CRA_c"
FT                   /protein_id="EDL06991.1"
FT                   EADGIYAASAGLRQ"
FT   mRNA            complement(join(<17789281..17789323,17789826..17789909,
FT                   17790034..17790220,17790324..17790446,17790583..17790702,
FT                   17790782..17790836,17794357..>17794491))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174598"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174598.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(<17789281..17789323,17789826..17789909,
FT                   17790034..17790220,17790324..17790446,17790583..17790702,
FT                   17790782..17790836,17794357..>17794375))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_b"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174598.0
FT                   protein_id=mCP97517.0 isoform=CRA_b"
FT                   /protein_id="EDL06990.1"
FT   CDS             complement(join(17790426..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794848))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174597.0
FT                   protein_id=mCP97515.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RNL3"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR016250"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="MGI:MGI:95514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNL3"
FT                   /protein_id="EDL06989.1"
FT   gene            complement(17796719..17806455)
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /note="gene_id=mCG19445.1"
FT   mRNA            complement(join(17796719..17798817,17799029..17799139,
FT                   17799249..17799373,17799708..17799887,17799991..17800108,
FT                   17800195..17800298,17800405..17800505,17800930..17801142,
FT                   17802856..17803028,17803481..17803569,17804450..17804526,
FT                   17804643..17804771,17805417..17805512,17805614..17805712,
FT                   17806113..17806455))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT19838"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT19838.1 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(17796719..17796865,17797681..>17797720))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172340"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172340.0 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(17796720..17796887,17803494..17803569,
FT                   17804450..17804526,17804643..17804771,17805417..>17805435))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT173475"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT173475.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(17796777..17796887,17803494..17803569,
FT                   17804450..17804526,17804643..17804771,17805417..>17805434))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT173475.0
FT                   protein_id=mCP96394.0 isoform=CRA_d"
FT                   /protein_id="EDL06987.1"
FT   CDS             complement(join(17796777..17796865,17797681..>17797720))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172340.0
FT                   protein_id=mCP95258.0 isoform=CRA_c"
FT                   /protein_id="EDL06986.1"
FT   mRNA            complement(join(<17796869..17796907,17798239..17798618,
FT                   17802958..>17802989))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172339"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172339.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(<17796869..17796907,17798239..17798618,
FT                   17802958..>17802968))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172339.0
FT                   protein_id=mCP95259.0 isoform=CRA_b"
FT                   /protein_id="EDL06985.1"
FT   CDS             complement(join(17798228..17798817,17799029..17799139,
FT                   17799249..17799373,17799708..17799887,17799991..17800108,
FT                   17800195..17800298,17800405..17800505,17800930..17801142,
FT                   17802856..17803028,17803481..17803569,17804450..17804526,
FT                   17804643..17804771,17805417..17805512,17805614..17805712,
FT                   17806113..17806289))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT19838.1
FT                   protein_id=mCP7258.1 isoform=CRA_e"
FT                   /db_xref="GOA:P23188"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR032815"
FT                   /db_xref="MGI:MGI:97513"
FT                   /db_xref="PDB:1P8J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23188"
FT                   /protein_id="EDL06988.1"
FT   mRNA            complement(join(<17800262..17800298,17800405..17800505,
FT                   17800930..17800957,17805413..>17805447))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172338"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172338.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(<17800262..17800298,17800405..17800505,
FT                   17800930..17800957,17805413..>17805447))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172338.0
FT                   protein_id=mCP95257.0 isoform=CRA_a"
FT                   /protein_id="EDL06984.1"
FT   assembly_gap    17809725..17810292
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            17836654..17838365
FT                   /pseudo
FT                   /locus_tag="mCG_19464"
FT                   /note="gene_id=mCG19464.2"
FT   mRNA            join(17836654..17837855,17837945..17838365)
FT                   /pseudo
FT                   /locus_tag="mCG_19464"
FT                   /note="gene_id=mCG19464.2 transcript_id=mCT20085.2 created
FT                   on 30-OCT-2002"
FT   assembly_gap    17844640..17845253
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    17845535..17845809
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    17856140..17857069
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   gene            complement(17862503..17943277)
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /note="gene_id=mCG19443.2"
FT   mRNA            complement(join(17862503..17862648,17862881..17863443,
FT                   17866819..17867002,17868736..17868858,17871776..17871968,
FT                   17872741..17872940,17874778..17874916,17877562..17877752,
FT                   17881990..17882185,17888373..17888533,17889442..17889548,
FT                   17902081..17902229,17902412..17902510,17903969..17904082,
FT                   17905383..17905501,17907731..17907922,17910261..17910931,
FT                   17911218..17911350,17913831..17913958,17917414..17917573,
FT                   17920790..17921508,17922605..17922706,17943223..17943277))
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), transcript
FT                   variant mCT19837"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT19837.2 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(17863099..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922706,17942831..17943168))
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), transcript
FT                   variant mCT173474"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT173474.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(17863266..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922706,17942831..17942835))
FT                   /codon_start=1
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT173474.0
FT                   protein_id=mCP96393.0 isoform=CRA_a"
FT                   /protein_id="EDL06982.1"
FT                   APPKPVNRTFLRPSYAFS"
FT   CDS             complement(join(17863266..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922702))
FT                   /codon_start=1
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT19837.2
FT                   protein_id=mCP7353.2 isoform=CRA_b"
FT                   /protein_id="EDL06983.1"
FT                   KPVNRTFLRPSYAFS"
FT   assembly_gap    17886329..17886389
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    17888175..17888194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17940149..17940216
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    17950399..17950418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17955092..17955450
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    17961733..17962457
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    17967505..17967524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17977272..17977291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17991832..17991851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18000812..18090975)
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /note="gene_id=mCG60560.2"
FT   mRNA            complement(join(18000812..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041402..18041521,18090866..>18090974))
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   transcript variant mCT189940"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT189940.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(18000813..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041427..18041521,18090866..18090975))
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   transcript variant mCT60743"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT60743.2 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(18002349..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041402..18041521,18090866..>18090973))
FT                   /codon_start=1
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT189940.0
FT                   protein_id=mCP110928.0 isoform=CRA_a"
FT                   /protein_id="EDL06980.1"
FT                   RL"
FT   CDS             complement(join(18002349..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18028986))
FT                   /codon_start=1
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT60743.2
FT                   protein_id=mCP29933.2 isoform=CRA_b"
FT                   /protein_id="EDL06981.1"
FT   assembly_gap    18009586..18009605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18018637..18018818
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    18035021..18035040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18059855..18059874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18086784..18360592)
FT                   /locus_tag="mCG_1050959"
FT                   /note="gene_id=mCG1050959.0"
FT   mRNA            complement(join(18086784..18089119,18099596..18099632,
FT                   18360465..18360592))
FT                   /locus_tag="mCG_1050959"
FT                   /product="mCG1050959"
FT                   /note="gene_id=mCG1050959.0 transcript_id=mCT194748.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(18088792..18088947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050959"
FT                   /product="mCG1050959"
FT                   /note="gene_id=mCG1050959.0 transcript_id=mCT194748.0
FT                   protein_id=mCP115777.0"
FT                   /protein_id="EDL06967.1"
FT                   LGSLFL"
FT   assembly_gap    18101995..18102730
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    18118931..18118983
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(<18124421..18219371)
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /note="gene_id=mCG131033.1"
FT   mRNA            complement(join(<18124421..18124444,18136065..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..>18141038))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173471"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173471.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(<18124421..18124444,18136065..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..>18141036))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173471.0
FT                   protein_id=mCP96391.0 isoform=CRA_a"
FT                   /protein_id="EDL06975.1"
FT   mRNA            complement(join(18124908..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..18141195,18142182..18142266,
FT                   18142355..18142495,18146099..18146323,18147587..18147750,
FT                   18148369..18148524,18150239..18150447,18150798..18150867,
FT                   18150958..18151029,18151120..18151203,18151915..18152085,
FT                   18155137..18155279,18155894..18156061,18156219..18156309,
FT                   18160933..18161096,18163438..18163562,18163981..18164141,
FT                   18164302..18164465,18168202..18168286,18169422..18169585,
FT                   18170192..18170276,18171777..18171955,18172835..18172948,
FT                   18174507..18174574,18177304..18177380,18178894..18178971,
FT                   18180318..18180474,18215902..18216001,18219218..18219371))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT132361"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT132361.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(18125967..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..18141195,18142182..18142266,
FT                   18142355..18142495,18146099..18146323,18147587..18147750,
FT                   18148369..18148524,18150239..18150447,18150798..18150867,
FT                   18150958..18151029,18151120..18151203,18151915..18152085,
FT                   18155137..18155279,18155894..18156061,18156219..18156309,
FT                   18160933..18161096,18163438..18163562,18163981..18164141,
FT                   18164302..18164465,18168202..18168286,18169422..18169585,
FT                   18170192..18170276,18171777..18171955,18172835..18172948,
FT                   18174507..18174574,18177304..18177380,18178894..18178971,
FT                   18180318..18180474,18215902..18216001,18219218..18219272))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT132361.1
FT                   protein_id=mCP88706.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9JKF1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1352757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JKF1"
FT                   /protein_id="EDL06977.1"
FT   mRNA            complement(join(<18126027..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18135998,
FT                   18148406..>18148473))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173473"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173473.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(<18126027..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18135998,
FT                   18148406..>18148471))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173473.0
FT                   protein_id=mCP96392.0 isoform=CRA_d"
FT                   /protein_id="EDL06978.1"
FT   assembly_gap    18130294..18130364
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   mRNA            complement(join(18146099..18146217,18180325..18180474,
FT                   18215902..18216001,18219218..>18219332))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173472"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173472.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(18146199..18146217,18180325..18180474,
FT                   18215902..18216001,18219218..>18219332))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173472.0
FT                   protein_id=mCP96390.0 isoform=CRA_b"
FT                   /protein_id="EDL06976.1"
FT   gene            <18163932..18170630
FT                   /locus_tag="mCG_145909"
FT                   /note="gene_id=mCG145909.0"
FT   mRNA            join(<18163932..18164115,18168657..18168745,
FT                   18170267..18170630)
FT                   /locus_tag="mCG_145909"
FT                   /product="mCG145909"
FT                   /note="gene_id=mCG145909.0 transcript_id=mCT186017.0
FT                   created on 04-JUL-2003"
FT   CDS             <18170306..18170563
FT                   /codon_start=1
FT                   /locus_tag="mCG_145909"
FT                   /product="mCG145909"
FT                   /note="gene_id=mCG145909.0 transcript_id=mCT186017.0
FT                   protein_id=mCP107705.0"
FT                   /protein_id="EDL06979.1"
FT   assembly_gap    18181997..18182271
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    18197218..18197237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18198247..18198266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18199301..18199320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18206971..18206990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18209436..18210976
FT                   /estimated_length=1541
FT                   /gap_type="unknown"
FT   assembly_gap    18217443..18217462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18222976..18223161
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    18237619..18237748
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    18240987..18241022
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    18250050..18250069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18263309..18264706
FT                   /estimated_length=1398
FT                   /gap_type="unknown"
FT   gene            18279118..18292364
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /note="gene_id=mCG15309.1"
FT   mRNA            join(18279118..18279622,18290878..18292364)
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /product="zinc finger and SCAN domain containing 2"
FT                   /note="gene_id=mCG15309.1 transcript_id=mCT15818.1 created
FT                   on 23-AUG-2002"
FT   CDS             join(18279220..18279622,18290878..18292319)
FT                   /codon_start=1
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /product="zinc finger and SCAN domain containing 2"
FT                   /note="gene_id=mCG15309.1 transcript_id=mCT15818.1
FT                   protein_id=mCP7232.1"
FT                   /protein_id="EDL06974.1"
FT   assembly_gap    18292365..18292963
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   gene            complement(18306859..18317377)
FT                   /locus_tag="mCG_15313"
FT                   /note="gene_id=mCG15313.2"
FT   mRNA            complement(join(18306859..18309474,18309782..18309946,
FT                   18314063..18314127,18314643..18314731,18316488..18316576,
FT                   18316784..18316851,18317325..18317373))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT185134"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT185134.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(18306860..18308042,18309109..18309474,
FT                   18309782..18309946,18314063..18314127,18314643..18314731,
FT                   18316488..18316576,18316784..18316851,18317325..18317377))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT15822"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT15822.1 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(18307394..18309474,18309782..18309946,
FT                   18314063..18314127,18314643..18314731,18316488..18316576,
FT                   18316784..18317374))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT174594"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT174594.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(18307810..18308042,18309109..18309474,
FT                   18309782..18309946,18314063..18314127,18314643..18314731,
FT                   18316488..18316576,18316784..18316851,18317325..18317365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, isoform CRA_a"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT15822.