spacer

EBI Dbfetch

ID   CH466543; SV 2; linear; genomic DNA; CON; MUS; 33498426 BP.
XX
AC   CH466543;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009749938 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-33498426
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-33498426
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-33498426
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 1fe0d5e2f9580697326ec36e6883cc61.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000215.
DR   Ensembl-Gn; ENSMUSG00000001741; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025724; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025789; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030509; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030518; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030543; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030562; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030606; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030615; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038943; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039133; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053091; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061549; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091006; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098346; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121777; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133771; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171213; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172178; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179662; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980437.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..33498426
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             6873..10725
FT                   /estimated_length=3853
FT   gap             28478..28954
FT                   /estimated_length=477
FT   gap             54834..54853
FT                   /estimated_length=20
FT   gap             72922..72941
FT                   /estimated_length=20
FT   gap             76046..77611
FT                   /estimated_length=1566
FT   gap             86046..86126
FT                   /estimated_length=81
FT   gap             111436..115808
FT                   /estimated_length=4373
FT   gene            complement(116685..117795)
FT                   /pseudo
FT                   /locus_tag="mCG_1028267"
FT                   /note="gene_id=mCG1028267.1"
FT   mRNA            complement(116685..117795)
FT                   /pseudo
FT                   /locus_tag="mCG_1028267"
FT                   /note="gene_id=mCG1028267.1 transcript_id=mCT145971.1
FT                   created on 25-NOV-2002"
FT   gap             118910..118929
FT                   /estimated_length=20
FT   gap             119975..119994
FT                   /estimated_length=20
FT   gap             132640..132659
FT                   /estimated_length=20
FT   gap             135760..136108
FT                   /estimated_length=349
FT   gap             181476..181495
FT                   /estimated_length=20
FT   gap             200164..202510
FT                   /estimated_length=2347
FT   gap             203815..204222
FT                   /estimated_length=408
FT   gap             233376..233395
FT                   /estimated_length=20
FT   gap             274577..276539
FT                   /estimated_length=1963
FT   gap             281555..281625
FT                   /estimated_length=71
FT   gap             291653..291672
FT                   /estimated_length=20
FT   gap             308484..308503
FT                   /estimated_length=20
FT   gap             339531..339550
FT                   /estimated_length=20
FT   gap             340702..340721
FT                   /estimated_length=20
FT   gap             341761..341780
FT                   /estimated_length=20
FT   gap             343422..343650
FT                   /estimated_length=229
FT   gap             348652..348671
FT                   /estimated_length=20
FT   gap             357320..357498
FT                   /estimated_length=179
FT   gap             370601..370620
FT                   /estimated_length=20
FT   gap             373316..373335
FT                   /estimated_length=20
FT   gap             397810..397829
FT                   /estimated_length=20
FT   gap             403518..403537
FT                   /estimated_length=20
FT   gap             408847..408866
FT                   /estimated_length=20
FT   gap             410049..410068
FT                   /estimated_length=20
FT   gap             411469..411488
FT                   /estimated_length=20
FT   gap             413065..413084
FT                   /estimated_length=20
FT   gap             419694..420184
FT                   /estimated_length=491
FT   gap             431128..431147
FT                   /estimated_length=20
FT   gap             440154..440890
FT                   /estimated_length=737
FT   gap             442214..442233
FT                   /estimated_length=20
FT   gap             443668..443687
FT                   /estimated_length=20
FT   gap             445230..445249
FT                   /estimated_length=20
FT   gap             471484..471503
FT                   /estimated_length=20
FT   gap             472643..472662
FT                   /estimated_length=20
FT   gap             475114..475133
FT                   /estimated_length=20
FT   gap             484398..484945
FT                   /estimated_length=548
FT   gap             499334..499936
FT                   /estimated_length=603
FT   gap             501012..501031
FT                   /estimated_length=20
FT   gap             503163..503330
FT                   /estimated_length=168
FT   gap             506232..506251
FT                   /estimated_length=20
FT   gap             514689..514753
FT                   /estimated_length=65
FT   gap             526308..526680
FT                   /estimated_length=373
FT   gap             534245..534264
FT                   /estimated_length=20
FT   gap             539687..539706
FT                   /estimated_length=20
FT   gene            complement(550377..667973)
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /note="gene_id=mCG11830.2"
FT   mRNA            complement(join(550377..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,614040..614084,
FT                   667510..667649,667824..667920))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT173467"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173467.0 created
FT                   on 13-SEP-2002"
FT   mRNA            complement(join(550620..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,607328..607372,
FT                   667510..667649,667824..667928))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT12092"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT12092.1 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(550909..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,607328..607372,
FT                   667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_c"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT12092.1
FT                   protein_id=mCP17333.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q53YJ9"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YJ9"
FT                   /protein_id="EDL07273.1"
FT                   /translation="MCGRRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVA
FT                   NDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPD
FT                   GQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQ
FT                   CKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTY
FT                   TVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAE
FT                   IMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCA
FT                   WFLRMKRPGEDKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAP
FT                   TPDSGVVCGRLACSPTHDEHLMHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICS
FT                   EWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA"
FT   CDS             complement(join(550909..551427,555460..555569,
FT                   556644..556730,557669..557863,559217..559384,
FT                   562062..562141,600227..600336,614040..614084,
FT                   667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_a"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173467.0
FT                   protein_id=mCP96386.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q53YJ9"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YJ9"
FT                   /protein_id="EDL07271.1"
FT                   /translation="MCGRRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVA
FT                   NDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPD
FT                   GQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQ
FT                   CKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTY
FT                   TVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAE
FT                   IMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCA
FT                   WFLRMKRPGEDKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAP
FT                   TPDSGVVCGRLACSPTHDEHLMHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICS
FT                   EWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA"
FT   gap             575023..575042
FT                   /estimated_length=20
FT   gap             588058..588077
FT                   /estimated_length=20
FT   mRNA            complement(join(593251..593471,600227..600336,
FT                   607328..607372,667510..667649,667824..667973))
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, transcript variant mCT173468"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173468.0 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(593384..593471,600227..600336,
FT                   607328..607372,667510..667649,667824..667878))
FT                   /codon_start=1
FT                   /gene="Chrna7"
FT                   /locus_tag="mCG_11830"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 7, isoform CRA_b"
FT                   /note="gene_id=mCG11830.2 transcript_id=mCT173468.0
FT                   protein_id=mCP96387.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CC01"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="MGI:MGI:99779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CC01"
FT                   /protein_id="EDL07272.1"
FT                   /translation="MCGRRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVA
FT                   NDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPD
FT                   GQIWKPDILLYNRSSEPSRMAVHVSPFWMHLRIVCYALLFT"
FT   gap             604631..604650
FT                   /estimated_length=20
FT   gap             606597..606616
FT                   /estimated_length=20
FT   gap             609162..609181
FT                   /estimated_length=20
FT   gap             610450..610469
FT                   /estimated_length=20
FT   gap             613307..613326
FT                   /estimated_length=20
FT   gap             619336..619355
FT                   /estimated_length=20
FT   gap             624481..624500
FT                   /estimated_length=20
FT   gap             659703..659722
FT                   /estimated_length=20
FT   gap             688162..688332
FT                   /estimated_length=171
FT   gap             695984..700340
FT                   /estimated_length=4357
FT   gap             728344..733151
FT                   /estimated_length=4808
FT   gap             749572..749591
FT                   /estimated_length=20
FT   gap             764324..764630
FT                   /estimated_length=307
FT   gap             765675..765694
FT                   /estimated_length=20
FT   gap             768533..768552
FT                   /estimated_length=20
FT   gap             794656..794675
FT                   /estimated_length=20
FT   gene            complement(804350..893710)
FT                   /locus_tag="mCG_67596"
FT                   /note="gene_id=mCG67596.1"
FT   mRNA            complement(join(804350..804719,807545..807718,
FT                   809689..809743,864078..864253,866575..866720,
FT                   876036..876152,877500..877720,881975..882078,
FT                   892361..892570,892744..893710))
FT                   /locus_tag="mCG_67596"
FT                   /product="mCG67596"
FT                   /note="gene_id=mCG67596.1 transcript_id=mCT67779.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(807662..807718,809689..809743,
FT                   864078..864229))
FT                   /codon_start=1
FT                   /locus_tag="mCG_67596"
FT                   /product="mCG67596"
FT                   /note="gene_id=mCG67596.1 transcript_id=mCT67779.1
FT                   protein_id=mCP38088.2"
FT                   /protein_id="EDL07270.1"
FT                   /translation="METITKSHNQYKFREETIMLHSVSIDTSTTQILPPKLRDHCRNIV
FT                   KARGTRQRQHKAWRETVSTWKENGPTQLKMCLLMERKTGFHS"
FT   gap             821242..821261
FT                   /estimated_length=20
FT   gap             822592..822611
FT                   /estimated_length=20
FT   gap             823955..823974
FT                   /estimated_length=20
FT   gap             826003..826022
FT                   /estimated_length=20
FT   gap             833954..833973
FT                   /estimated_length=20
FT   gap             835496..835515
FT                   /estimated_length=20
FT   gap             846890..847219
FT                   /estimated_length=330
FT   gap             852550..856925
FT                   /estimated_length=4376
FT   gap             858976..858995
FT                   /estimated_length=20
FT   gap             862109..862128
FT                   /estimated_length=20
FT   gap             867241..867260
FT                   /estimated_length=20
FT   gap             868588..868607
FT                   /estimated_length=20
FT   gap             869738..872501
FT                   /estimated_length=2764
FT   gap             873640..873659
FT                   /estimated_length=20
FT   gap             891363..891382
FT                   /estimated_length=20
FT   gene            893953..1211138
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /note="gene_id=mCG11831.2"
FT   mRNA            join(893953..894108,1063413..1063542,1104412..1104505,
FT                   1105618..1105772,1140199..1140381,1151828..1152049,
FT                   1179930..1180031,1181570..1181697,1182321..1182415,
FT                   1186171..1186298,1188306..1188455,1206675..1206789,
FT                   1206969..1207053,1209363..1210097,1210201..1211138)
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /product="OTU domain containing 7A"
FT                   /note="gene_id=mCG11831.2 transcript_id=mCT12093.3 created
FT                   on 19-MAR-2004"
FT   gap             896747..896766
FT                   /estimated_length=20
FT   gap             953352..953371
FT                   /estimated_length=20
FT   gap             977762..977781
FT                   /estimated_length=20
FT   gap             979520..979539
FT                   /estimated_length=20
FT   gap             981744..981763
FT                   /estimated_length=20
FT   gap             993006..993025
FT                   /estimated_length=20
FT   gap             994253..994272
FT                   /estimated_length=20
FT   gap             995754..999154
FT                   /estimated_length=3401
FT   gap             1009897..1010223
FT                   /estimated_length=327
FT   gap             1011659..1011678
FT                   /estimated_length=20
FT   gap             1025953..1025980
FT                   /estimated_length=28
FT   gap             1050276..1050295
FT                   /estimated_length=20
FT   gap             1052292..1052595
FT                   /estimated_length=304
FT   gap             1053903..1053967
FT                   /estimated_length=65
FT   gap             1060383..1060821
FT                   /estimated_length=439
FT   gap             1075680..1075699
FT                   /estimated_length=20
FT   gap             1077275..1077294
FT                   /estimated_length=20
FT   gap             1080542..1080812
FT                   /estimated_length=271
FT   gap             1083506..1083525
FT                   /estimated_length=20
FT   gap             1085230..1085249
FT                   /estimated_length=20
FT   gap             1086569..1086588
FT                   /estimated_length=20
FT   gap             1087599..1087618
FT                   /estimated_length=20
FT   gap             1088786..1088805
FT                   /estimated_length=20
FT   gap             1090933..1090952
FT                   /estimated_length=20
FT   gap             1092282..1093559
FT                   /estimated_length=1278
FT   gap             1098439..1098458
FT                   /estimated_length=20
FT   CDS             join(1105622..1105772,1140199..1140381,1151828..1152049,
FT                   1179930..1180031,1181570..1181697,1182321..1182415,
FT                   1186171..1186298,1188306..1188455,1206675..1206789,
FT                   1206969..1207053,1209363..1210097,1210201..1210842)
FT                   /codon_start=1
FT                   /gene="Otud7a"
FT                   /locus_tag="mCG_11831"
FT                   /product="OTU domain containing 7A"
FT                   /note="gene_id=mCG11831.2 transcript_id=mCT12093.3
FT                   protein_id=mCP17344.3"
FT                   /protein_id="EDL07269.1"
FT                   /translation="MVSSLLPNPPSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLA
FT                   RDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRCAKQAERELPQPGHKVERPCLQ
FT                   RQDDIAQAEKRLSRGISHASSAIVSLARSHVANECNNEQFPLEMPIYTFQLPDLSVYSE
FT                   DFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMW
FT                   GFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPR
FT                   THFSKNGSGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAP
FT                   IPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLL
FT                   PLHFAVDPGKDWEWGKDDNDNARLANLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQ
FT                   PESPTASAGEDVQSLAESLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKDKDKTRADSVA
FT                   NKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERNKEKKSKSRKGSKE
FT                   ESGASASTSPSEKTTPSPTDKASGASPADKGSGSRGDAWKYSTDVKLSLNILRAAMQGE
FT                   RKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAAAAAAAATATATVKR
FT                   PARRPTAAQPTQLVLKLKERPSPGTGASARAARAAGGAASPGPGGGARRAAPGTGGPTP
FT                   GRSPPAPARQSVIHVQAAARDEACAPTVGEIRPCATYPQQNRSLWSQSYSPARSALRTV
FT                   NTVESLAPGGADAPGPAEHKSQTYSNGFGAARDGLEFADADAPAARSNAECGRGGPGPA
FT                   QRRCQRENCAFYGRAETEHFCSYCYREELRRRREARAARP"
FT   gap             1116103..1116122
FT                   /estimated_length=20
FT   gap             1117863..1118437
FT                   /estimated_length=575
FT   gap             1119966..1120132
FT                   /estimated_length=167
FT   gap             1121333..1121951
FT                   /estimated_length=619
FT   gap             1155923..1155942
FT                   /estimated_length=20
FT   gap             1172173..1172192
FT                   /estimated_length=20
FT   gap             1173605..1173624
FT                   /estimated_length=20
FT   gap             1174950..1174969
FT                   /estimated_length=20
FT   gap             1177031..1177050
FT                   /estimated_length=20
FT   gap             1210098..1210200
FT                   /estimated_length=103
FT   gap             1217845..1217864
FT                   /estimated_length=20
FT   gap             1220088..1220208
FT                   /estimated_length=121
FT   gap             1227472..1227491
FT                   /estimated_length=20
FT   gap             1252412..1252431
FT                   /estimated_length=20
FT   gene            complement(1336488..1384445)
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /note="gene_id=mCG123556.1"
FT   mRNA            complement(join(1336488..1336888,1381826..>1381897))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT173469"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173469.0
FT                   created on 13-SEP-2002"
FT   mRNA            complement(join(1336491..1336888,1369700..>1369901))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT173470"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173470.0
FT                   created on 13-SEP-2002"
FT   mRNA            complement(join(<1336599..1336888,1383563..1384445))
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, transcript variant
FT                   mCT124789"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT124789.0
FT                   created on 13-SEP-2002"
FT   CDS             complement(join(1336599..1336888,1383563..1384142))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_a"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT124789.0
FT                   protein_id=mCP89016.1 isoform=CRA_a"
FT                   /protein_id="EDL07265.1"
FT                   /translation="MAAAAYVDHFAAECLVSMSSRAVVHEPREGPEPRPEGAAAAAPTL
FT                   PRVDERRDGKDSASLFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPAPPAP
FT                   PPGPEPASPGQAGAPAAPPSPAWSEPEAALEQEPGPAGSGEPGLRQRGRRGRSRADLES
FT                   PQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQECNKKFARSDELARHYRTH
FT                   TGEKKFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSP
FT                   TISPASSP"
FT   CDS             complement(join(1336599..1336888,1381826..>1381871))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_b"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173469.0
FT                   protein_id=mCP96389.0 isoform=CRA_b"
FT                   /protein_id="EDL07266.1"
FT                   /translation="WKGSHSLRSARKLRAGERPFACSWQECNKKFARSDELARHYRTHT
FT                   GEKKFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPT
FT                   ISPASSP"
FT   CDS             complement(join(1336599..1336888,1369700..>1369790))
FT                   /codon_start=1
FT                   /gene="Klf13"
FT                   /locus_tag="mCG_123556"
FT                   /product="Kruppel-like factor 13, isoform CRA_c"
FT                   /note="gene_id=mCG123556.1 transcript_id=mCT173470.0
FT                   protein_id=mCP96388.0 isoform=CRA_c"
FT                   /protein_id="EDL07267.1"
FT                   /translation="IQQQVPMASCFARVSSPTGHLIYPCPNKEPGERPFACSWQECNKK
FT                   FARSDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRT
FT                   GSLSDYSRSDASSPTISPASSP"
FT   gene            <1361894..1365576
FT                   /locus_tag="mCG_145072"
FT                   /note="gene_id=mCG145072.0"
FT   mRNA            join(<1361894..1362132,1364277..1364465,1364990..1365576)
FT                   /locus_tag="mCG_145072"
FT                   /product="mCG145072"
FT                   /note="gene_id=mCG145072.0 transcript_id=mCT184496.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1362069..1362132,1364277..1364465,1364990..1365108)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145072"
FT                   /product="mCG145072"
FT                   /note="gene_id=mCG145072.0 transcript_id=mCT184496.0
FT                   protein_id=mCP106151.0"
FT                   /protein_id="EDL07268.1"
FT                   /translation="LSQLRVLNKEMEVRDADRGDLKQGSDMTDSVFSTHAGCAGAHEAE
FT                   GYPAEWSCITSVSGDGSQAQQSTCSTDEVYPFGHTRSQCAQGFSQDEGQTKKEQKGVRK
FT                   HWPHTSTVHTQPSNHPELP"
FT   gap             1373772..1373791
FT                   /estimated_length=20
FT   gap             1377532..1377761
FT                   /estimated_length=230
FT   gene            <1407846..1413338
FT                   /locus_tag="mCG_1028452"
FT                   /note="gene_id=mCG1028452.0"
FT   mRNA            join(<1407846..1407929,1411895..1411978,1413110..1413338)
FT                   /locus_tag="mCG_1028452"
FT                   /product="mCG1028452"
FT                   /note="gene_id=mCG1028452.0 transcript_id=mCT146156.0
FT                   created on 25-NOV-2002"
FT   CDS             join(<1407910..1407929,1411895..1411978,1413110..1413290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028452"
FT                   /product="mCG1028452"
FT                   /note="gene_id=mCG1028452.0 transcript_id=mCT146156.0
FT                   protein_id=mCP88924.0"
FT                   /protein_id="EDL07264.1"
FT                   /translation="WTEPLNLLEDLTRPSNHRLTPQRNRSSGIDFPTFKRPLKRATETV
FT                   LRTSAEPMEDGCPEEEKRRLIVPSIYSALCISPTQPFVCMPQYYSGLRT"
FT   gap             1420643..1420758
FT                   /estimated_length=116
FT   gap             1431545..1431610
FT                   /estimated_length=66
FT   gap             1437612..1437779
FT                   /estimated_length=168
FT   gap             1448978..1448997
FT                   /estimated_length=20
FT   gene            <1453623..1466682
FT                   /locus_tag="mCG_123560"
FT                   /note="gene_id=mCG123560.0"
FT   mRNA            join(<1453623..1453704,1457503..1457635,1464586..1464710,
FT                   1466561..1466682)
FT                   /locus_tag="mCG_123560"
FT                   /product="mCG123560"
FT                   /note="gene_id=mCG123560.0 transcript_id=mCT124793.1
FT                   created on 25-NOV-2002"
FT   CDS             join(<1457571..1457635,1464586..1464710,1466561..1466601)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123560"
FT                   /product="mCG123560"
FT                   /note="gene_id=mCG123560.0 transcript_id=mCT124793.1
FT                   protein_id=mCP88766.1"
FT                   /protein_id="EDL07263.1"
FT                   /translation="IQWQLPVPKPRLFWYFCPSNCRVPRNILTEFPASTTPRWQVPNIS
FT                   WSPVMYQIHKYLWRNTSEGPTGIVASSGNCP"
FT   gap             1476896..1477373
FT                   /estimated_length=478
FT   gap             1481872..1481891
FT                   /estimated_length=20
FT   gap             1484906..1484925
FT                   /estimated_length=20
FT   gap             1501382..1501401
FT                   /estimated_length=20
FT   gap             1508539..1508558
FT                   /estimated_length=20
FT   gap             1516982..1517001
FT                   /estimated_length=20
FT   gap             1518218..1518788
FT                   /estimated_length=571
FT   gap             1526196..1528328
FT                   /estimated_length=2133
FT   gap             1530234..1530253
FT                   /estimated_length=20
FT   gap             1532585..1532604
FT                   /estimated_length=20
FT   gap             1533690..1538807
FT                   /estimated_length=5118
FT   gap             1544965..1544984
FT                   /estimated_length=20
FT   gap             1550892..1550911
FT                   /estimated_length=20
FT   gap             1552902..1552921
FT                   /estimated_length=20
FT   gap             1554492..1554511
FT                   /estimated_length=20
FT   gap             1566145..1566194
FT                   /estimated_length=50
FT   gap             1572197..1577780
FT                   /estimated_length=5584
FT   gap             1584450..1584469
FT                   /estimated_length=20
FT   gap             1600268..1600378
FT                   /estimated_length=111
FT   gap             1618521..1618676
FT                   /estimated_length=156
FT   gap             1622100..1622615
FT                   /estimated_length=516
FT   gap             1624438..1624764
FT                   /estimated_length=327
FT   gap             1631726..1635915
FT                   /estimated_length=4190
FT   gap             1637213..1639475
FT                   /estimated_length=2263
FT   gap             1640657..1640676
FT                   /estimated_length=20
FT   gap             1641881..1641900
FT                   /estimated_length=20
FT   gene            1642874..>1718161
FT                   /locus_tag="mCG_11829"
FT                   /note="gene_id=mCG11829.2"
FT   mRNA            join(1642874..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1673946,1674741..1674770,
FT                   1676823..1677115,1680166..1680394,1681146..1681192,
FT                   1685863..1686055,1687834..1687962,1690592..1690843,
FT                   1693596..1693770,1696150..1696261,1697539..1697741,
FT                   1698363..1698495,1717563..>1718161)
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, transcript variant mCT173466"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT173466.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(1642874..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1674863)
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, transcript variant mCT12233"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT12233.1 created
FT                   on 13-SEP-2002"
FT   CDS             join(1642925..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1673946,1674741..1674770,
FT                   1676823..1677115,1680166..1680394,1681146..1681192,
FT                   1685863..1686055,1687834..1687962,1690592..1690843,
FT                   1693596..1693770,1696150..1696261,1697539..1697741,
FT                   1698363..1698495,1717563..>1718161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, isoform CRA_b"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT173466.0
FT                   protein_id=mCP96385.0 isoform=CRA_b"
FT                   /protein_id="EDL07262.1"
FT                   /translation="MVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTG
FT                   AWIFTGGVSTGVVSHVGDALKDHSSKSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQT
FT                   MSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVV
FT                   GLVVEGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHKYCDEGGVINESLRDQ
FT                   LLVTIQKTFNYSKSQSYQLFAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTN
FT                   ASAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPVDTKATEKEKKPPTATTKGR
FT                   GKGKGKKKGKVKEEVEEETDPRKLELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNM
FT                   QHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYR
FT                   CNYTRKSFRTLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAV
FT                   SRFQYPFHELMVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDD
FT                   ISQDLDNNSKDFGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDF
FT                   IAHTCSQMLLTDMWMGRLRMRKNPGLKMDHQLTIDPGTEEMAQCWRWPIPTCSPPAIYC
FT                   AVFQDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFN
FT                   YVILVRMDGWPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLV
FT                   AISMFMVGAILRLQSQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI
FT                   DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDRKR
FT                   LPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMT
FT                   FHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKKLHEFE
FT                   EQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEINERENFMKTSLQTVDLRLS
FT                   QLEELSGRMVSALENLAGIDRSDLIQARSRASSECEATYLLRQSSINSADGYSLYRYHF
FT                   NGEELLFEEPALSTSPGTAFRKKTCSFRVKDEDAKSHLDQPSNLHHTPGPSPPATPGRS
FT                   RLALEGPLSTELRPGSDPGISAGEFDPRADFKSTEAAPSLNAAGVTGTQLT"
FT   CDS             join(1642925..1643090,1643997..1644121,1653947..1654118,
FT                   1658423..1658597,1659016..1659139,1660104..1660176,
FT                   1660985..1661085,1667625..1667795,1669244..1669378,
FT                   1670378..1670428,1673806..1674090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11829"
FT                   /product="mCG11829, isoform CRA_a"
FT                   /note="gene_id=mCG11829.2 transcript_id=mCT12233.1
FT                   protein_id=mCP17336.2 isoform=CRA_a"
FT                   /protein_id="EDL07261.1"
FT                   /translation="MVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTG
FT                   AWIFTGGVSTGVVSHVGDALKDHSSKSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQT
FT                   MSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVV
FT                   GLVVEGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHKYCDEGGVINESLRDQ
FT                   LLVTIQKTFNYSKSQSYQLFAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTN
FT                   ASAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPVDTKATEKEKKPPTATTKGR
FT                   GKGKGKKKGKVKEEVEEETDPRKLELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNM
FT                   QHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYR
FT                   CNYTRKSFRTLYNNLFGPKRVELSRHTVSCASQSNMWFLDVLPQKPTCAECNSSPHLSQ
FT                   TDITPPLP"
FT   gap             1645208..1645227
FT                   /estimated_length=20
FT   gap             1647991..1653232
FT                   /estimated_length=5242
FT   gap             1656166..1656283
FT                   /estimated_length=118
FT   gap             1683188..1684295
FT                   /estimated_length=1108
FT   gap             1684949..1685386
FT                   /estimated_length=438
FT   gap             1719641..1719660
FT                   /estimated_length=20
FT   gap             1722610..1722629
FT                   /estimated_length=20
FT   gap             1724767..1724786
FT                   /estimated_length=20
FT   gene            1740919..1793694
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /note="gene_id=mCG11825.2"
FT   mRNA            join(1740919..1741061,1741559..1741619,1750687..1750823,
FT                   1752767..1752839,1753430..1753572,1761026..1761116,
FT                   1766966..1767146,1770969..1771056,1771137..1771225,
FT                   1772293..1772423,1773443..1773512,1774041..1774111,
FT                   1779531..1779700,1786185..1786355,1789585..1789767,
FT                   1790306..1793694)
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /product="expressed sequence BB128963"
FT                   /note="gene_id=mCG11825.2 transcript_id=mCT12230.2 created
FT                   on 15-JAN-2003"
FT   CDS             join(1741002..1741061,1741559..1741619,1750687..1750823,
FT                   1752767..1752839,1753430..1753572,1761026..1761116,
FT                   1766966..1767146,1770969..1771056,1771137..1771225,
FT                   1772293..1772423,1773443..1773512,1774041..1774111,
FT                   1779531..1779700,1786185..1786355,1789585..1789767,
FT                   1790306..1790902)
FT                   /codon_start=1
FT                   /gene="BB128963"
FT                   /locus_tag="mCG_11825"
FT                   /product="expressed sequence BB128963"
FT                   /note="gene_id=mCG11825.2 transcript_id=mCT12230.2
FT                   protein_id=mCP17337.2"
FT                   /protein_id="EDL07260.1"
FT                   /translation="MFSLKPPRPSFRSYLLPPAQTDDKISSEPKIKKLEPVLLPGEIVV
FT                   NEVNFVRKCIATDTSQYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTC
FT                   IEQIVTVNDHKRKQKVLGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAI
FT                   AHYSQPTDLQLLFAFEYVGKKYHNSANKVNGVSSGGGGVWSGAGSTGSQRTPLFETYSD
FT                   WDRETKRTGASGWRVCSINEGYMISTCLPEYFVVPSSLADQDLKIFSHSFVGRRMPFWC
FT                   WSHSNGSALVRMALIKDALQQRKIDQRICNAITKSHPQRSDVYKSDLDKALPNIQEIQA
FT                   AFVKLKQLCVNEPFEETEEKWLSSLESTRWLEYVRAFLKHSAELVYILESQRLSVVLQE
FT                   EEGRDLSCLVASLIQVMMDPYFRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPL
FT                   FLLFLDTTWQLLEQYPAAFEFSETYLAVLCDSTRISLFGTFLFNSPHQRVKQSTEFAIS
FT                   KNIQLGDEKGLKFPSVWDWALQFTAKDRTLFHNPFYIGKSTPCVQNGSRKSFKRTKKSY
FT                   SSTLRGMPSCLKNGIITDQDLLPRRNSLVLKLKPDPPQHTDSQHSGAEQYFKEWFSRPA
FT                   NLHGIILPRLSGTHIKLWKLCYFRWVPEAQINLGGSIMAFHKLSLLADEVDMLSRMLRQ
FT                   HRSGPLEACYAELDQSRMYFRATGPHDTLGTPEFLSSSFPFSPVGNLCRRSILGTPLSK
FT                   FLSGAKIWLSTETLANED"
FT   gap             1742696..1742715
FT                   /estimated_length=20
FT   gene            complement(1790423..1830139)
FT                   /locus_tag="mCG_11826"
FT                   /note="gene_id=mCG11826.2"
FT   mRNA            complement(join(1790423..1790806,1798230..1799399,
FT                   1801510..1801638,1801980..1802174,1802698..1802801,
FT                   1803457..1803567,1809671..1809821,1810466..1810630,
FT                   1813691..1813753,1818036..1818155,1819228..1819336,
FT                   1822592..1822825,1825082..1825283,1827581..1827721,
FT                   1828320..1829813,1829994..1830139))
FT                   /locus_tag="mCG_11826"
FT                   /product="mCG11826"
FT                   /note="gene_id=mCG11826.2 transcript_id=mCT12231.2 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(1799262..1799399,1801510..1801638,
FT                   1801980..1802174,1802698..1802801,1803457..1803567,
FT                   1809671..1809821,1810466..1810630,1813691..1813753,
FT                   1818036..1818155,1819228..1819336,1822592..1822825,
FT                   1825082..1825283,1827581..1827721,1828320..1829415))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11826"
FT                   /product="mCG11826"
FT                   /note="gene_id=mCG11826.2 transcript_id=mCT12231.2
FT                   protein_id=mCP17338.2"
FT                   /protein_id="EDL07259.1"
FT                   /translation="MVPRYDLIRHLDESCANNGVGDDVQVEPAQAGLMSPTVPTSDLPS
FT                   VPLENVTPQKLSPPKRSLISVQCGSKLGIQQQTSPYFKDALVSKDQNELPNQSVEIMPL
FT                   GSLRSKLSRRYLKAKKSLAKNEGLASQCPQTSPSTPGTSLTDNGPEMEDKDEVLNSSQK
FT                   ENIYSCAPLKEENASEQKVKNNKVTGDESQKASCGEPALTPASAEHASILLSSDSTLVS
FT                   NTKSSPGDTLVKQESARRADVGLAEPLEVHSHKEVQMTFYAAAKTLVSGEAESNGPTDV
FT                   DMSDMTTWSNNRELVREAGSVLHCPLEQGSSCGGPSETAQLALSHPYYLRSFLVVLQAL
FT                   LGNEEDMKLFDEQEKAIITRFYQLSASGQKLYVRLFQRKLTWIKMSKLEYEEIASDLTP
FT                   VVEELKDSGFLQTESELQELSDVLELLSAPELKALAKTFHLVSPGGQKQQLVDAFHKLA
FT                   KQRSVCTWGKTQPGIRAVILKRAKDLAGRSLRVCKGPRAVFARILLLFSLTDSMEDEEA
FT                   ACGGQGQLSTVLLVNLGRMEFPQYTICRKTQIFRDREDLIRYHEALPPFLRCFTVGWIY
FT                   TRISSRAVEVLERLHMYEEAVKELENLLSQKIYCPDSRGRWWDRLALNLHQHLKRLEEG
FT                   QQRAESQGSAVKGTHWLELAAIRCIREGLADPHVRTGHRLSLYQRAVRLRESPSCRKYK
FT                   HLFSRLPEVAVGDVKHVTITGRLCPQHGMGKSVFVMESGDGANPTTVLCSVEELALGYY
FT                   RQSGFDQARGGTRTRWSLQMTVSVEALHISNTVVTSSGQIGFMNGIHGEGSTFSTLCGL
FT                   LLWDIIFMDGIPDVFRNAYQASPLDLLTDSFFASREQALEARLQLIHSAPAESLRAWVG
FT                   EAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLV
FT                   VWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVAVGAKSKGLG"
FT   gap             1805345..1805364
FT                   /estimated_length=20
FT   gap             1806456..1806475
FT                   /estimated_length=20
FT   gap             1807892..1807911
FT                   /estimated_length=20
FT   gap             1820220..1821619
FT                   /estimated_length=1400
FT   gap             1823013..1824044
FT                   /estimated_length=1032
FT   gene            complement(1832594..1848063)
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /note="gene_id=mCG123989.0"
FT   mRNA            complement(join(1832594..1832855,1833219..1833446,
FT                   1834785..1834892,1836978..1837088,1838925..1839062,
FT                   1840309..1840376,1841689..1841830,1843455..1843623,
FT                   1844872..1845029,1845453..1846137,1847931..1848063))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT125226"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT125226.1
FT                   created on 18-OCT-2002"
FT   mRNA            complement(join(1832628..1832855,1833219..1833356,
FT                   1839002..1839062,1840309..1840376,1841689..>1841757))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT174585"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174585.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(1832706..1832855,1833219..1833446,
FT                   1834785..1834892,1836978..1837088,1838925..1839062,
FT                   1840309..1840376,1841689..1841830,1843455..1843623,
FT                   1844872..1845029,1845453..1846137,1847931..1848019))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_a"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT125226.1
FT                   protein_id=mCP88984.1 isoform=CRA_a"
FT                   /protein_id="EDL07256.1"
FT                   /translation="MAPRVFRRQTLERCLREIRKATNRPECFLTIQNGLASNFTSLTKV
FT                   LYDFNKVLENGRISGSPLQKLEINSFDDEQIWQQLELQNEPVLQYFQNAVSETIEDEDI
FT                   SLLPECEDEECEEDASEVEADNQENLETDLEEEQLSDEGGDVPKGRDRAKSSRKSDPRK
FT                   SPVFSDEDSDLDFDIGKLEQQTKMQIKPPGKPREKSVVDDKFFKLSEMESFLEKVEKEE
FT                   EKRPDGEEEDEEDIDLFEDIDSDESEGGLFGRQKIKSNKSSRNLKYKDFFDPVESDEDI
FT                   TGVDEELGPDEEKEEEEGFAEEADESISDTDEDNDLEEDENSDQHKGSLKRVTFALPDD
FT                   EAEDTSPLAVKQESDEVKSSFEKRQEKMNEKIASLEKELLDKKPWQLQGEVTAQKRPEN
FT                   SLLEETLHFDHAVRMAPVITEETTLHLEDIIKQRIRDQAWDDVERKEKPKEDAYEYKKR
FT                   LTLDHEKSKLSLAEIYEQEYLKLNQQKTEEEDNPEHVEIQKMMDSLFLKLDALSNFHFI
FT                   PKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDLKTAAEKTATDKK
FT                   RERRKKKYQKRLKIKEKEKRKKLLEKNNPDQSKSSRAAASEKLKQLTKTGKVSLLKDER
FT                   KDKPLKSSQAFFSKLQDQVKMQINDAKQPEKIKKKKQDISVHKLKL"
FT   CDS             complement(join(1832706..1832855,1833219..1833356,
FT                   1839002..>1839046))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_b"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174585.0
FT                   protein_id=mCP97505.0 isoform=CRA_b"
FT                   /protein_id="EDL07257.1"
FT                   /translation="NEKKNLKRMRMNIKSRLKIKEKEKRKKLLEKNNPDQSKSSRAAAS
FT                   EKLKQLTKTGKVSLLKDERKDKPLKSSQAFFSKLQDQVKMQINDAKQPEKIKKKKQDIS
FT                   VHKLKL"
FT   mRNA            complement(join(1844019..1846137,1847931..1848062))
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), transcript variant mCT174586"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174586.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(1845351..1846137,1847931..1848019))
FT                   /codon_start=1
FT                   /gene="Mphosph10"
FT                   /locus_tag="mCG_123989"
FT                   /product="M-phase phosphoprotein 10 (U3 small nucleolar
FT                   ribonucleoprotein), isoform CRA_c"
FT                   /note="gene_id=mCG123989.0 transcript_id=mCT174586.0
FT                   protein_id=mCP97504.0 isoform=CRA_c"
FT                   /protein_id="EDL07258.1"
FT                   /translation="MAPRVFRRQTLERCLREIRKATNRPECFLTIQNGLASNFTSLTKV
FT                   LYDFNKVLENGRISGSPLQKLEINSFDDEQIWQQLELQNEPVLQYFQNAVSETIEDEDI
FT                   SLLPECEDEECEEDASEVEADNQENLETDLEEEQLSDEGGDVPKGRDRAKSSRKSDPRK
FT                   SPVFSDEDSDLDFDIGKLEQQTKMQIKPPGKPREKSVVDDKFFKLSEMESFLEKVEKEE
FT                   EKRPDGEEEDEEDIDLFEDIDSDESEGGLFGRQKIKVMFWKKTKTVSLKYKSCFPTEKC
FT                   NVPQTSFEPK"
FT   gene            1848462..1869310
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /note="gene_id=mCG11820.2"
FT   mRNA            join(1848462..1848660,1855980..1856155,1869030..1869303)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT174583"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174583.0 created
FT                   on 18-OCT-2002"
FT   mRNA            join(1848463..1848660,1855980..1856317,1869030..1869310)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT12224"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT12224.1 created
FT                   on 18-OCT-2002"
FT   mRNA            join(1848570..1848660,1854504..1854724,1855980..1856317,
FT                   1869030..1869063)
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, transcript variant
FT                   mCT174582"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174582.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(1848615..1848660,1855980..1856317,1869030..1869182)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_a"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT12224.1
FT                   protein_id=mCP17342.1 isoform=CRA_a"
FT                   /protein_id="EDL07253.1"
FT                   /translation="MRRVVKAAALAAGATGLFSRVQTSVAIGRSFSTPQSQFQESSPVW
FT                   KLGRLNHVAVAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPL
FT                   GSDSPITGFLQKNKAGGMHHVCIEVDNISAAVMDLKKKKIRSLSDEAKIGAHGKPVIFL
FT                   HPKDCGGVLVELEQA"
FT   CDS             join(1848615..1848660,1855980..1856155,1869030..1869182)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_c"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174583.0
FT                   protein_id=mCP97502.0 isoform=CRA_c"
FT                   /protein_id="EDL07255.1"
FT                   /translation="MRRVVKAAALAAGATGLFSRVQTSVAIGRSFSTPQSQFQESSPVW
FT                   KLGRLNHVAVAVPDLEKASSFYRDVLGAQVDNISAAVMDLKKKKIRSLSDEAKIGAHGK
FT                   PVIFLHPKDCGGVLVELEQA"
FT   CDS             join(1848615..1848660,1854504..1854556)
FT                   /codon_start=1
FT                   /gene="Mcee"
FT                   /locus_tag="mCG_11820"
FT                   /product="methylmalonyl CoA epimerase, isoform CRA_b"
FT                   /note="gene_id=mCG11820.2 transcript_id=mCT174582.0
FT                   protein_id=mCP97501.0 isoform=CRA_b"
FT                   /protein_id="EDL07254.1"
FT                   /translation="MRRVVKAAALAAGATGKSPSLRKLKAGAQGRN"
FT   gap             1860378..1860397
FT                   /estimated_length=20
FT   gap             1862316..1862739
FT                   /estimated_length=424
FT   gap             1879269..1879541
FT                   /estimated_length=273
FT   gap             1881385..1881630
FT                   /estimated_length=246
FT   gap             1885439..1885458
FT                   /estimated_length=20
FT   gap             1894339..1894358
FT                   /estimated_length=20
FT   gap             1924580..1927563
FT                   /estimated_length=2984
FT   gap             1936555..1936574
FT                   /estimated_length=20
FT   gap             1941050..1941117
FT                   /estimated_length=68
FT   gap             1957222..1957241
FT                   /estimated_length=20
FT   gap             1966932..1970942
FT                   /estimated_length=4011
FT   gap             1972176..1972716
FT                   /estimated_length=541
FT   gap             1974594..1974613
FT                   /estimated_length=20
FT   gap             1978123..1978142
FT                   /estimated_length=20
FT   gap             1986358..1986860
FT                   /estimated_length=503
FT   gap             2015933..2016028
FT                   /estimated_length=96
FT   gap             2066708..2066727
FT                   /estimated_length=20
FT   gap             2076576..2076595
FT                   /estimated_length=20
FT   gap             2077637..2077656
FT                   /estimated_length=20
FT   gap             2080428..2080447
FT                   /estimated_length=20
FT   gap             2082570..2082589
FT                   /estimated_length=20
FT   gap             2086631..2086650
FT                   /estimated_length=20
FT   gap             2101859..2101878
FT                   /estimated_length=20
FT   gap             2108114..2108338
FT                   /estimated_length=225
FT   gap             2114512..2114531
FT                   /estimated_length=20
FT   gap             2115984..2116003
FT                   /estimated_length=20
FT   gene            2116278..2176321
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /note="gene_id=mCG11822.2"
FT   mRNA            join(2116278..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2158619..2158694,2176270..2176321)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT176331"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176331.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2116278..2116887,2175447..2175612)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT176332"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176332.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2116278..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2156393..2156428,2158619..2158705,
FT                   2161438..2161623,2165058..2165237,2166214..2166426,
FT                   2167503..2167622,2171787..2171927,2174814..2175113)
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, transcript variant mCT12226"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT12226.2 created
FT                   on 03-JAN-2003"
FT   CDS             join(2116323..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2158619..2158694,2176270..2176319)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_b"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176331.0
FT                   protein_id=mCP99253.0 isoform=CRA_b"
FT                   /protein_id="EDL07251.1"
FT                   /translation="MAHRKRQSTASSMLDHRARPGPIPHDQEPESEDTELPLESYVPTG
FT                   LELGTLRPESPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYC
FT                   PEDDSYLEGMDCNGEEYIAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDG
FT                   HLPIPEDDPTVLEVHDQEEDGHYCSSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEE
FT                   QEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGDSTEACPPSDTGHGPGRQEAR
FT                   PKSLNLPPEVKHPGDLQRGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDN
FT                   NNIPETKKVASFPSFVAVPGPCEAEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQ
FT                   EAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADPRKTSCILLINLKS"
FT   CDS             join(2116323..2116887,2175447..2175457)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_c"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT176332.0
FT                   protein_id=mCP99254.0 isoform=CRA_c"
FT                   /protein_id="EDL07252.1"
FT                   /translation="MAHRKRQSTASSMLDHRARPGPIPHDQEPESEDTELPLESYVPTG
FT                   LELGTLRPESPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYC
FT                   PEDDSYLEGMDCNGEEYIAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDG
FT                   HLPIPEDDPTVLEVHDQEEDGHYCSRVS"
FT   CDS             join(2116323..2117276,2136280..2136360,2137360..2137396,
FT                   2155251..2155396,2156393..2156428,2158619..2158705,
FT                   2161438..2161623,2165058..2165237,2166214..2166426,
FT                   2167503..2167622,2171787..2171927,2174814..2174885)
FT                   /codon_start=1
FT                   /gene="Apba2"
FT                   /locus_tag="mCG_11822"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 2, isoform CRA_a"
FT                   /note="gene_id=mCG11822.2 transcript_id=mCT12226.2
FT                   protein_id=mCP17331.2 isoform=CRA_a"
FT                   /protein_id="EDL07250.1"
FT                   /translation="MAHRKRQSTASSMLDHRARPGPIPHDQEPESEDTELPLESYVPTG
FT                   LELGTLRPESPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYC
FT                   PEDDSYLEGMDCNGEEYIAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDG
FT                   HLPIPEDDPTVLEVHDQEEDGHYCSSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEE
FT                   QEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGDSTEACPPSDTGHGPGRQEAR
FT                   PKSLNLPPEVKHPGDLQRGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDN
FT                   NNIPETKKVASFPSFVAVPGPCEAEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQ
FT                   EAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTI
FT                   SYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSI
FT                   GQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHK
FT                   GEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATC
FT                   QGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGG
FT                   VRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI"
FT   gap             2117916..2118175
FT                   /estimated_length=260
FT   gap             2119316..2123011
FT                   /estimated_length=3696
FT   gap             2128678..2128778
FT                   /estimated_length=101
FT   gap             2129498..2130311
FT                   /estimated_length=814
FT   gap             2133512..2133627
FT                   /estimated_length=116
FT   gap             2144893..2144952
FT                   /estimated_length=60
FT   gap             2162504..2162636
FT                   /estimated_length=133
FT   gap             2169221..2169632
FT                   /estimated_length=412
FT   gap             2174519..2174725
FT                   /estimated_length=207
FT   gene            complement(2177839..2243720)
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /note="gene_id=mCG11818.2"
FT   mRNA            complement(join(2177839..2181156,2183496..2183723,
FT                   2189368..2189443,2197421..2197556,2198430..2198590,
FT                   2208454..2208561,2243672..2243720))
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, transcript variant
FT                   mCT12222"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT12222.2 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(2179008..2181156,2183496..2183723,
FT                   2189368..2189443,2195133..2195370))
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, transcript variant
FT                   mCT182206"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT182206.0 created
FT                   on 27-MAY-2003"
FT   CDS             complement(join(2180840..2181156,2183496..2183723,
FT                   2189368..2189443,2197421..2197556,2198430..2198590,
FT                   2208454..2208495))
FT                   /codon_start=1
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, isoform CRA_a"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT12222.2
FT                   protein_id=mCP17339.2 isoform=CRA_a"
FT                   /protein_id="EDL07248.1"
FT                   /translation="MCCMQMVSADVLQMFFPHRSHSANAACVTPHGTILHQTLDFDEFI
FT                   APLPPPPYYPPEYTCTPTAEAHRGLHLDFASSPFSTLYDVAINSPGILYPAELPPPYEA
FT                   VVGQTPASQVASVDHQVVDSSSGDPNTAADFSTPVPASSTSLPTSEGATSLGPSHPSPD
FT                   GTLDTPTPLIPTPVPHHMSPEAASLSAQAQPSPGRVARSVSDPTSCTSSEAVSTSQPAM
FT                   AACQHQHSSTGDPDTWKTGQGTKPETLQTVSKERPHSLVESKAYADTRVLVAKFLEHAH
FT                   CSLPTEVRHVVGTIRSMATSEEPRVEEAIFGAGVLDQL"
FT   CDS             complement(join(2180840..2181156,2183496..2183598))
FT                   /codon_start=1
FT                   /gene="5730507A09Rik"
FT                   /locus_tag="mCG_11818"
FT                   /product="RIKEN cDNA 5730507A09, isoform CRA_b"
FT                   /note="gene_id=mCG11818.2 transcript_id=mCT182206.0
FT                   protein_id=mCP105107.0 isoform=CRA_b"
FT                   /db_xref="GOA:B2RVD7"
FT                   /db_xref="MGI:MGI:1917888"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVD7"
FT                   /protein_id="EDL07249.1"
FT                   /translation="MSPEAASLSAQAQPSPGRVARSVSDPTSCTSSEAVSTSQPAMAAC
FT                   QHQHSSTGDPDTWKTGQGTKPETLQTVSKERPHSLVESKAYADTRVLVAKFLEHAHCSL
FT                   PTEVRHVVGTIRSMATSEEPRVEEAIFGAGVLDQL"
FT   gap             2202902..2202921
FT                   /estimated_length=20
FT   gap             2212466..2212485
FT                   /estimated_length=20
FT   gap             2233047..2233066
FT                   /estimated_length=20
FT   gap             2235057..2235076
FT                   /estimated_length=20
FT   gap             2236121..2236140
FT                   /estimated_length=20
FT   gap             2243731..2244427
FT                   /estimated_length=697
FT   gap             2247951..2247970
FT                   /estimated_length=20
FT   gap             2249326..2249345
FT                   /estimated_length=20
FT   gap             2250405..2250424
FT                   /estimated_length=20
FT   gap             2259834..2259853
FT                   /estimated_length=20
FT   gap             2261820..2261839
FT                   /estimated_length=20
FT   gap             2277735..2277997
FT                   /estimated_length=263
FT   gap             2280773..2282538
FT                   /estimated_length=1766
FT   gap             2284084..2284103
FT                   /estimated_length=20
FT   gap             2285908..2286043
FT                   /estimated_length=136
FT   gene            complement(2296221..2297618)
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /note="gene_id=mCG11827.2"
FT   mRNA            complement(2296221..2297618)
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /product="necdin-like 2"
FT                   /note="gene_id=mCG11827.2 transcript_id=mCT12228.2 created
FT                   on 13-SEP-2002"
FT   CDS             complement(2296654..2297493)
FT                   /codon_start=1
FT                   /gene="Ndnl2"
FT                   /locus_tag="mCG_11827"
FT                   /product="necdin-like 2"
FT                   /note="gene_id=mCG11827.2 transcript_id=mCT12228.2
FT                   protein_id=mCP17334.1"
FT                   /protein_id="EDL07247.1"
FT                   /translation="MLQKPRGRGRPSTQADPERDWGGAGEEGPSTSRAAGGSSQGSRAS
FT                   LSAPTVGPRTQKQLELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLKLA
FT                   AERLQYVFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIVLGLIFMK
FT                   GNTITETEVWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEL
FT                   QWGPRTNLETSKMKVLKFVAKVHNQDPKDWPTQYCEALADEESRARPATASAPATSS"
FT   gap             2303879..2303976
FT                   /estimated_length=98
FT   gap             2316143..2316162
FT                   /estimated_length=20
FT   gap             2321799..2323053
FT                   /estimated_length=1255
FT   gap             2355881..2356294
FT                   /estimated_length=414
FT   gap             2371199..2372783
FT                   /estimated_length=1585
FT   gap             2379494..2379635
FT                   /estimated_length=142
FT   gap             2380274..2381197
FT                   /estimated_length=924
FT   gap             2399649..2399668
FT                   /estimated_length=20
FT   gap             2401390..2401409
FT                   /estimated_length=20
FT   gap             2402788..2402807
FT                   /estimated_length=20
FT   gap             2412957..2413504
FT                   /estimated_length=548
FT   gap             2414857..2415059
FT                   /estimated_length=203
FT   gap             2416480..2416955
FT                   /estimated_length=476
FT   gap             2418203..2418222
FT                   /estimated_length=20
FT   gap             2423629..2423648
FT                   /estimated_length=20
FT   gap             2427051..2427070
FT                   /estimated_length=20
FT   gap             2428762..2428913
FT                   /estimated_length=152
FT   gap             2431829..2432545
FT                   /estimated_length=717
FT   gap             2435238..2435274
FT                   /estimated_length=37
FT   gap             2462610..2463283
FT                   /estimated_length=674
FT   gap             2470373..2470392
FT                   /estimated_length=20
FT   gap             2498037..2498056
FT                   /estimated_length=20
FT   gap             2504647..2505719
FT                   /estimated_length=1073
FT   gap             2517926..2517945
FT                   /estimated_length=20
FT   gap             2542613..2542632
FT                   /estimated_length=20
FT   gap             2546199..2546218
FT                   /estimated_length=20
FT   gap             2559882..2560058
FT                   /estimated_length=177
FT   gap             2562258..2562277
FT                   /estimated_length=20
FT   gap             2563759..2563778
FT                   /estimated_length=20
FT   gap             2573437..2573456
FT                   /estimated_length=20
FT   gap             2575512..2575531
FT                   /estimated_length=20
FT   gap             2577914..2577933
FT                   /estimated_length=20
FT   gap             2582340..2582567
FT                   /estimated_length=228
FT   gap             2591684..2591703
FT                   /estimated_length=20
FT   gene            2605932..2607194
FT                   /pseudo
FT                   /locus_tag="mCG_64192"
FT                   /note="gene_id=mCG64192.2"
FT   mRNA            2605932..2607194
FT                   /pseudo
FT                   /locus_tag="mCG_64192"
FT                   /note="gene_id=mCG64192.2 transcript_id=mCT64375.2 created
FT                   on 25-NOV-2002"
FT   gap             2623676..2623940
FT                   /estimated_length=265
FT   gap             2626264..2626283
FT                   /estimated_length=20
FT   gap             2628088..2628263
FT                   /estimated_length=176
FT   gap             2629304..2631558
FT                   /estimated_length=2255
FT   gap             2635703..2635722
FT                   /estimated_length=20
FT   gene            complement(<2644423..2645037)
FT                   /locus_tag="mCG_147209"
FT                   /note="gene_id=mCG147209.0"
FT   mRNA            complement(join(<2644423..2644701,2644862..2645037))
FT                   /locus_tag="mCG_147209"
FT                   /product="mCG147209"
FT                   /note="gene_id=mCG147209.0 transcript_id=mCT187472.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<2644423..2644586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147209"
FT                   /product="mCG147209"
FT                   /note="gene_id=mCG147209.0 transcript_id=mCT187472.0
FT                   protein_id=mCP109616.0"
FT                   /protein_id="EDL07246.1"
FT                   /translation="MAAVSQILRALKTLSLQESIELSGVKLFRTLQPQVSSMPCPISKI
FT                   SLPIKPDLKG"
FT   gap             2647566..2647585
FT                   /estimated_length=20
FT   gap             2648884..2648903
FT                   /estimated_length=20
FT   gap             2651737..2651935
FT                   /estimated_length=199
FT   gap             2680846..2681420
FT                   /estimated_length=575
FT   gap             2682561..2683346
FT                   /estimated_length=786
FT   gap             2684338..2684645
FT                   /estimated_length=308
FT   gap             2687171..2687230
FT                   /estimated_length=60
FT   gap             2689233..2689252
FT                   /estimated_length=20
FT   gap             2690940..2690959
FT                   /estimated_length=20
FT   gap             2698792..2698811
FT                   /estimated_length=20
FT   gap             2708932..2710841
FT                   /estimated_length=1910
FT   gene            complement(2721155..2797074)
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /note="gene_id=mCG19683.1"
FT   mRNA            complement(join(2721155..2722654,2724716..2724799,
FT                   2726062..2726279,2727740..2728214,2731172..2731338,
FT                   2735814..2736041,2737144..2737241,2737365..2738234,
FT                   2738903..2739142,2739469..2739819,2742807..2742907,
FT                   2743184..2743394,2744070..2744152,2747103..2747198,
FT                   2747317..2747501,2747778..2747997,2748812..2748920,
FT                   2752098..2752248,2754760..2754865,2755462..2755601,
FT                   2761867..2762014,2762332..2762500,2762878..2762981,
FT                   2765976..2766252,2768443..2768545,2769441..2769565,
FT                   2780441..2780499,2796751..2797074))
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /product="tight junction protein 1"
FT                   /note="gene_id=mCG19683.1 transcript_id=mCT21104.2 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(2722560..2722654,2724716..2724799,
FT                   2726062..2726279,2727740..2728214,2731172..2731338,
FT                   2735814..2736041,2737144..2737241,2737365..2738234,
FT                   2738903..2739142,2739469..2739819,2742807..2742907,
FT                   2743184..2743394,2744070..2744152,2747103..2747198,
FT                   2747317..2747501,2747778..2747997,2748812..2748920,
FT                   2752098..2752248,2754760..2754865,2755462..2755601,
FT                   2761867..2762014,2762332..2762500,2762878..2762981,
FT                   2765976..2766252,2768443..2768545,2769441..2769565,
FT                   2780441..2780499,2796751..2796763))
FT                   /codon_start=1
FT                   /gene="Tjp1"
FT                   /locus_tag="mCG_19683"
FT                   /product="tight junction protein 1"
FT                   /note="gene_id=mCG19683.1 transcript_id=mCT21104.2
FT                   protein_id=mCP16516.2"
FT                   /protein_id="EDL07245.1"
FT                   /translation="MFMRKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQS
FT                   GETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRR
FT                   KKKVQIPVSHPDPEPVSDNEDDSYDEEVHDPRAGHGALANRRSEKSWARDRSASRERSL
FT                   SPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEG
FT                   DVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASE
FT                   RDDISEIQSLASDHSGRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEE
FT                   RMSKPGAISTPVKHVDDHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSP
FT                   SDGALPNSAHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLE
FT                   EGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYI
FT                   RTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRA
FT                   EQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLR
FT                   EAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQII
FT                   DQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYER
FT                   SHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLH
FT                   DDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAIT
FT                   RSSEPVREDSSGMHHENQTYPPYSPQAQPQAIHRIDSPGLKPASQQKAEASSPVPYLSP
FT                   ETTPASSASAVNHNVSVTNVSLEEPAPAPPTSHASQPGCLGAPSAEAAHVVLRGEGPPL
FT                   PPHADPAKVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPNLAYEPQLPYIEKQASR
FT                   DLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPYQPRPFENQQPR
FT                   DLDSRQHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQPAPAYEVHNRY
FT                   RPEAQPYSSTGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGHYEPLHGAAVVPPLIPSS
FT                   QQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLENKKDVNDTA
FT                   SFKPPEVASKLPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIVRSNHYDP
FT                   EEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSKGKPETD
FT                   AVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSKGAQGEGNSVSLDFQN
FT                   SYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKTITPVYNRF
FT                   TPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQPPEF
FT                   DSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSNGG
FT                   VLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHG
FT                   LKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF"
FT   gap             2750469..2750488
FT                   /estimated_length=20
FT   gap             2781320..2781342
FT                   /estimated_length=23
FT   gap             2784223..2784426
FT                   /estimated_length=204
FT   gap             2796480..2796750
FT                   /estimated_length=271
FT   gap             2818732..2818751
FT                   /estimated_length=20
FT   gap             2823516..2823535
FT                   /estimated_length=20
FT   gap             2829476..2829495
FT                   /estimated_length=20
FT   gap             2831062..2833073
FT                   /estimated_length=2012
FT   gap             2836856..2840465
FT                   /estimated_length=3610
FT   gap             2843604..2843623
FT                   /estimated_length=20
FT   gap             2851267..2851734
FT                   /estimated_length=468
FT   gap             2884718..2885880
FT                   /estimated_length=1163
FT   gap             2888380..2888399
FT                   /estimated_length=20
FT   gene            complement(2893737..>2902980)
FT                   /locus_tag="mCG_145071"
FT                   /note="gene_id=mCG145071.0"
FT   mRNA            complement(join(2893737..2894652,2895395..2895869,
FT                   2897667..2899420,2901868..>2902980))
FT                   /locus_tag="mCG_145071"
FT                   /product="mCG145071"
FT                   /note="gene_id=mCG145071.0 transcript_id=mCT184495.0
FT                   created on 05-JUN-2003"
FT   gap             2894818..2894837
FT                   /estimated_length=20
FT   gap             2895876..2895895
FT                   /estimated_length=20
FT   gap             2897309..2897328
FT                   /estimated_length=20
FT   CDS             complement(2897844..>2898182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145071"
FT                   /product="mCG145071"
FT                   /note="gene_id=mCG145071.0 transcript_id=mCT184495.0
FT                   protein_id=mCP106150.0"
FT                   /protein_id="EDL07244.1"
FT                   /translation="YTGGPGSDLQHHINLVWQHIYKPSTWEVKTEKSGVWGHTPLLTEP
FT                   RQRLCDTLSQGEEEEEEEREEEEVEEEEEITASATTFCVSREIAKEKTKGQESSFHPVL
FT                   YKWFGECK"
FT   gap             2899424..2899681
FT                   /estimated_length=258
FT   gap             2900402..2901356
FT                   /estimated_length=955
FT   gap             2915074..2915110
FT                   /estimated_length=37
FT   gap             2948021..2948050
FT                   /estimated_length=30
FT   gap             2950721..2950854
FT                   /estimated_length=134
FT   gap             2952112..2952479
FT                   /estimated_length=368
FT   gap             2956748..2957445
FT                   /estimated_length=698
FT   gap             2958693..2958712
FT                   /estimated_length=20
FT   gap             2959770..2959789
FT                   /estimated_length=20
FT   gap             2963661..2964472
FT                   /estimated_length=812
FT   gap             2965451..2966140
FT                   /estimated_length=690
FT   gap             2981754..2981838
FT                   /estimated_length=85
FT   gap             2988133..2988408
FT                   /estimated_length=276
FT   gene            complement(<3002786..3056882)
FT                   /locus_tag="mCG_64442"
FT                   /note="gene_id=mCG64442.2"
FT   mRNA            complement(join(<3002786..3002960,3051923..3052055,
FT                   3056481..3056882))
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, transcript variant mCT64625"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT64625.2 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(<3002786..3002960,3051923..3052055,
FT                   3056481..3056823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, isoform CRA_b"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT64625.2
FT                   protein_id=mCP37319.2 isoform=CRA_b"
FT                   /protein_id="EDL07241.1"
FT                   /translation="MLERGANSWFYSCETRTQREKEKRSQRLAEILRRYKEQLLKDFHL
FT                   ARVLPYLVYDGVFSLKEYREILSQARYPERVECFLLKLFSKGPSAFCAFCAHLEELSPY
FT                   LLTSLFLYYQEQTQRVLQDVLVAEETARSRNGAQWDSSTVSDPEDQEQRARLFNKEEVN
FT                   QGLCLRTANRDQDNERLVLTQVVASCLWETSGASTALLCLQLAQLCAHTNSPSK"
FT   gene            3002797..3039913
FT                   /locus_tag="mCG_1028441"
FT                   /note="gene_id=mCG1028441.2"
FT   mRNA            join(3002797..3002982,3028874..3029350)
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, transcript variant mCT146145"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT146145.2
FT                   created on 10-JUN-2003"
FT   mRNA            join(3002837..3002982,3028874..3029051,3030071..3030301,
FT                   3030459..3030715,3031026..3031133,3031483..3031630,
FT                   3031901..3031981,3037442..3039913)
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, transcript variant mCT176330"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT176330.1
FT                   created on 10-JUN-2003"
FT   gap             3003942..3004326
FT                   /estimated_length=385
FT   mRNA            complement(join(3024558..3025010,3025714..>3025991))
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, transcript variant mCT176338"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT176338.0 created
FT                   on 25-NOV-2002"
FT   CDS             complement(3025720..>3025965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64442"
FT                   /product="mCG64442, isoform CRA_a"
FT                   /note="gene_id=mCG64442.2 transcript_id=mCT176338.0
FT                   protein_id=mCP99260.0 isoform=CRA_a"
FT                   /protein_id="EDL07240.1"
FT                   /translation="IAPRSHAPYPSLGDKQHWFDPCLRLVTCPGSLITDYLSIMPSHTW
FT                   GDCVLLVAGASKGQDVDNLWPDLNCCKQASWVKVEV"
FT   gap             3028651..3028670
FT                   /estimated_length=20
FT   CDS             join(3028980..3029051,3030071..3030196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, isoform CRA_b"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT176330.1
FT                   protein_id=mCP99252.1 isoform=CRA_b"
FT                   /protein_id="EDL07243.1"
FT                   /translation="MWKEPELSPRLGSPDEEFLETTAERVGDIHTARSWGQPPTTANGA
FT                   RPLSQCLAELNASKKDMGEA"
FT   CDS             3028980..3029081
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028441"
FT                   /product="mCG1028441, isoform CRA_a"
FT                   /note="gene_id=mCG1028441.2 transcript_id=mCT146145.2
FT                   protein_id=mCP88649.2 isoform=CRA_a"
FT                   /protein_id="EDL07242.1"
FT                   /translation="MWKEPELSPRLGSPDEEFLETTAEVMTICSLVV"
FT   gap             3035747..3035766
FT                   /estimated_length=20
FT   gap             3052913..3052932
FT                   /estimated_length=20
FT   gap             3063417..3063735
FT                   /estimated_length=319
FT   gene            3065998..3112915
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /note="gene_id=mCG123165.1"
FT   mRNA            join(3065998..3066315,3067354..3067422,3068575..3068765,
FT                   3076656..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3104715)
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, transcript
FT                   variant mCT185126"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT185126.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(3066017..3066315,3067354..3067422,3068575..3068765,
FT                   3076656..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103804,
FT                   3104709..3104786,3104964..3105064,3107340..3107444,
FT                   3109781..3109853,3110870..3110984,3111998..3112915)
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, transcript
FT                   variant mCT124395"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT124395.2
FT                   created on 04-JUN-2003"
FT   gap             3070778..3073448
FT                   /estimated_length=2671
FT   gap             3075580..3075873
FT                   /estimated_length=294
FT   CDS             join(3076695..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103804,
FT                   3104709..3104786,3104964..3105064,3107340..3107444,
FT                   3109781..3109853,3110870..3110984,3111998..3112146)
FT                   /codon_start=1
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT124395.2
FT                   protein_id=mCP88685.2 isoform=CRA_b"
FT                   /protein_id="EDL07239.1"
FT                   /translation="MELYYGGHLCYGPPIENGFYYDMFIEDRVVSSTELSALENICKTI
FT                   IKEKQPFERLEVSKDTLLEMFKYNKFKCRILKEKVDTPTTTVYRCGPLIDLCKGPHVRH
FT                   TGKIKAIKIFKNSSTYWEGNPEMETLQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIG
FT                   KEQELFFFHDLSPGSCFFLPRGAFIYNALMDFIREEYHKRNFTEVLSPNMYNSKLWETS
FT                   GHWQHYSNNMFTFDVEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVLHRNEL
FT                   SGTLSGLTRVRRFQQDDAHIFCMVEQIEEEIKGCLHFLQSVYSTFGFSFQLNLSTRPEH
FT                   FLGEIEIWDEAERQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQL
FT                   DFQLPIRFNLTYVSKDGDDKNRPVIIHRAILGSVERMIAILSENYGGKWPLWLSPRQVM
FT                   VIPVGPACENYALQVSKECFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEK
FT                   INNAVNVRTRDNKIHGEISIASVIEKLKNLKKSRTLNAEEDF"
FT   CDS             join(3076695..3076777,3079835..3079952,3082094..3082158,
FT                   3083276..3083354,3084848..3084994,3085856..3085954,
FT                   3096925..3097091,3098965..3099127,3103667..3103843)
FT                   /codon_start=1
FT                   /gene="Tarsl2"
FT                   /locus_tag="mCG_123165"
FT                   /product="threonyl-tRNA synthetase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG123165.1 transcript_id=mCT185126.0
FT                   protein_id=mCP106384.0 isoform=CRA_a"
FT                   /protein_id="EDL07238.1"
FT                   /translation="MELYYGGHLCYGPPIENGFYYDMFIEDRVVSSTELSALENICKTI
FT                   IKEKQPFERLEVSKDTLLEMFKYNKFKCRILKEKVDTPTTTVYRCGPLIDLCKGPHVRH
FT                   TGKIKAIKIFKNSSTYWEGNPEMETLQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIG
FT                   KEQELFFFHDLSPGSCFFLPRGAFIYNALMDFIREEYHKRNFTEVLSPNMYNSKLWETS
FT                   GHWQHYSNNMFTFDVEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVLHRNEL
FT                   SGTLSGLTRVRRFQQDDAHIFCMVEQIEEEIKGCLHFLQSVYSTFGFSFQLNLSTRPEH
FT                   FLGEIEIWDEAERVSSRHETARLGV"
FT   gap             3111653..3111672
FT                   /estimated_length=20
FT   gene            3111996..3123505
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /note="gene_id=mCG145687.0"
FT   mRNA            join(3111996..3112117,3113889..3114396,3114678..3114770,
FT                   3115970..3116154,3119257..3119431,3120688..3120763,
FT                   3123190..3123505)
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, transcript variant
FT                   mCT174584"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT174584.0
FT                   created on 23-JUN-2003"
FT   mRNA            join(3114283..3114396,3115970..3116154,3119257..3119431,
FT                   3120688..3120763,3123190..3123497)
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, transcript variant
FT                   mCT186474"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT186474.0
FT                   created on 23-JUN-2003"
FT   CDS             join(3114306..3114396,3114678..3114770,3115970..3116154,
FT                   3119257..3119431,3120688..3120763,3123190..3123355)
FT                   /codon_start=1
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT174584.0
FT                   protein_id=mCP97503.1 isoform=CRA_a"
FT                   /protein_id="EDL07236.1"
FT                   /translation="MEAAAEPLRSVRHLSRVLLFLSQCYILSGDGSLNLEHSQPLAQAI
FT                   KDPGPTRTFSVVPRAAENQLFSHLTESTEIPPYMMKCPSNGLCSRLPADCIECATNVSC
FT                   TYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRFCWQLPETDYECSNSTTCMTVAC
FT                   PRQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALALSITLGGFGADRFYLGQ
FT                   WREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI"
FT   CDS             join(3114306..3114396,3115970..3116154,3119257..3119431,
FT                   3120688..3120763,3123190..3123355)
FT                   /codon_start=1
FT                   /gene="Tm2d3"
FT                   /locus_tag="mCG_145687"
FT                   /product="TM2 domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG145687.0 transcript_id=mCT186474.0
FT                   protein_id=mCP107178.0 isoform=CRA_b"
FT                   /protein_id="EDL07237.1"
FT                   /translation="MEAAAEPLRSVRHLSRVLLFLSQCYILSGDENQLFSHLTESTEIP
FT                   PYMMKCPSNGLCSRLPADCIECATNVSCTYGKPVTFDCTVKPSVTCVDQDLKPQRNFVI
FT                   NMTCRFCWQLPETDYECSNSTTCMTVACPRQRYFANCTVRDHIHCLGNRTFPKLLYCNW
FT                   TGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVG
FT                   PADGSLYI"
FT   gap             3129212..3129379
FT                   /estimated_length=168
FT   gap             3131739..3131758
FT                   /estimated_length=20
FT   gap             3135353..3135372
FT                   /estimated_length=20
FT   gap             3136398..3138105
FT                   /estimated_length=1708
FT   gap             3140003..3140022
FT                   /estimated_length=20
FT   gap             3141216..3141235
FT                   /estimated_length=20
FT   gap             3143611..3143630
FT                   /estimated_length=20
FT   gap             3145092..3145111
FT                   /estimated_length=20
FT   gap             3147927..3148480
FT                   /estimated_length=554
FT   gap             3149595..3149614
FT                   /estimated_length=20
FT   gap             3150749..3150768
FT                   /estimated_length=20
FT   gap             3176354..3176529
FT                   /estimated_length=176
FT   gap             3204317..3204712
FT                   /estimated_length=396
FT   gap             3209530..3209549
FT                   /estimated_length=20
FT   gap             3210677..3210696
FT                   /estimated_length=20
FT   gap             3212960..3212979
FT                   /estimated_length=20
FT   gap             3214012..3214031
FT                   /estimated_length=20
FT   gap             3215041..3215634
FT                   /estimated_length=594
FT   gap             3216690..3222835
FT                   /estimated_length=6146
FT   gap             3224378..3224397
FT                   /estimated_length=20
FT   gap             3225964..3226609
FT                   /estimated_length=646
FT   gap             3230236..3232453
FT                   /estimated_length=2218
FT   gap             3234513..3235795
FT                   /estimated_length=1283
FT   gene            <3237152..3245369
FT                   /locus_tag="mCG_1028439"
FT                   /note="gene_id=mCG1028439.0"
FT   mRNA            join(<3237152..3237433,3244970..3245369)
FT                   /locus_tag="mCG_1028439"
FT                   /product="mCG1028439"
FT                   /note="gene_id=mCG1028439.0 transcript_id=mCT146143.0
FT                   created on 18-OCT-2002"
FT   CDS             <3237152..3237400
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028439"
FT                   /product="mCG1028439"
FT                   /note="gene_id=mCG1028439.0 transcript_id=mCT146143.0
FT                   protein_id=mCP88635.0"
FT                   /protein_id="EDL07235.1"
FT                   /translation="HPGTSWGPEYPARLMCDLLGSRWLLSLAVSPQDAAEGLTLVRQEE
FT                   QLSCAELGLSPSSICGNHRLRDSLLLPGHSCGNFLGP"
FT   gap             3238625..3238644
FT                   /estimated_length=20
FT   gap             3239732..3239751
FT                   /estimated_length=20
FT   gap             3242369..3242388
FT                   /estimated_length=20
FT   gap             3244431..3244450
FT                   /estimated_length=20
FT   gap             3246662..3249990
FT                   /estimated_length=3329
FT   gap             3272880..3272899
FT                   /estimated_length=20
FT   gap             3290083..3290102
FT                   /estimated_length=20
FT   gap             3297747..3297766
FT                   /estimated_length=20
FT   gene            3300227..3493302
FT                   /locus_tag="mCG_19967"
FT                   /note="gene_id=mCG19967.2"
FT   mRNA            join(3300227..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407597,3410376..3410479,3411955..3412072,
FT                   3421568..3421756,3425150..3425286,3466639..3466818,
FT                   3473209..3473311,3475185..3475381,3476616..3476703,
FT                   3480447..3480550,3486431..3486560,3490473..3490585,
FT                   3491822..3493302)
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, transcript variant mCT18030"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT18030.2 created
FT                   on 27-MAY-2003"
FT   CDS             join(3300262..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407597,3410376..3410479,3411955..3412072,
FT                   3421568..3421756,3425150..3425286,3466639..3466818,
FT                   3473209..3473311,3475185..3475381,3476616..3476703,
FT                   3480447..3480550,3486431..3486560,3490473..3490585,
FT                   3491822..3491919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, isoform CRA_a"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT18030.2
FT                   protein_id=mCP16502.2 isoform=CRA_a"
FT                   /protein_id="EDL07233.1"
FT                   /translation="MPPRAPPAPGPRPPPRAADVARGAGAAGRHGLPPLALRPWRWLLL
FT                   LALPAACSALPPPRPVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHS
FT                   KTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHC
FT                   TDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDY
FT                   DPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKS
FT                   LGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR
FT                   EGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLR
FT                   QRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGA
FT                   GHKGAGAPGGLGKMLCNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGL
FT                   VDAEALVLEARKWTAVPSQHVCVATADKRPRSIPIVQVLRTTALTNACADHSDQRVVYL
FT                   EHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKA
FT                   EGEWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHPYRTFSSHQSRSRMLELSVPEQ
FT                   EPPKAAGQPPQAETPEDEEEYTGVCHPECGDKGCDGPNADQCLNCVHFSLGNSKTNRKC
FT                   VSECPLGYFGDAAARRCRRCHKGCETCTGRSPAQCLSCRRGFYHHQETNTCVTLCPAGL
FT                   YADESQRLCLRCHPSCQKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDSELVKCGE
FT                   CHHTCRTCVGPSREECIHCAKSFHFQDWKCVPACGEGFYPEEMPGLPHKVCRRCEENCL
FT                   SCEGSSRNCSRCKAGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTC
FT                   LLAG"
FT   mRNA            join(<3300304..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407560,3411955..3412072,3421568..3421756,
FT                   3425150..3425286,3466639..3466818,3473209..3473311,
FT                   3475185..3475381,3476616..3476703,3480447..3480550,
FT                   3486431..3486560,3490473..3490585,3491822..3492183)
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, transcript variant mCT189937"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT189937.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3300304..3300534,3349108..3349212,3366111..3366215,
FT                   3366733..3366876,3368023..3368099,3370589..3370677,
FT                   3391821..3391993,3397984..3398196,3401784..3401884,
FT                   3407457..3407560,3411955..3412072,3421568..3421756,
FT                   3425150..3425286,3466639..3466818,3473209..3473311,
FT                   3475185..3475381,3476616..3476703,3480447..3480550,
FT                   3486431..3486560,3490473..3490585,3491822..3491919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19967"
FT                   /product="mCG19967, isoform CRA_b"
FT                   /note="gene_id=mCG19967.2 transcript_id=mCT189937.0
FT                   protein_id=mCP110922.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q62030"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR010909"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="MGI:MGI:102897"
FT                   /db_xref="UniProtKB/TrEMBL:Q62030"
FT                   /protein_id="EDL07234.1"
FT                   /translation="PRAADVARGAGAAGRHGLPPLALRPWRWLLLLALPAACSALPPPR
FT                   PVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPH
FT                   TFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHCTDKNSRCRSEMNVQ
FT                   AAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKH
FT                   GTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSAS
FT                   WGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSI
FT                   YTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSA
FT                   PMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVD
FT                   AEALVLEARKWTAVPSQHVCVATADKRPRSIPIVQVLRTTALTNACADHSDQRVVYLEH
FT                   VVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEG
FT                   EWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHPYRTFSSHQSRSRMLELSVPEQEP
FT                   PKAAGQPPQAETPEDEEEYTGVCHPECGDKGCDGPNADQCLNCVHFSLGNSKTNRKCVS
FT                   ECPLGYFGDAAARRCRRCHKGCETCTGRSPAQCLSCRRGFYHHQETNTCVTLCPAGLYA
FT                   DESQRLCLRCHPSCQKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDSELVKCGECH
FT                   HTCRTCVGPSREECIHCAKSFHFQDWKCVPACGEGFYPEEMPGLPHKVCRRCEENCLSC
FT                   EGSSRNCSRCKAGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLL
FT                   AG"
FT   gap             3316534..3316553
FT                   /estimated_length=20
FT   gap             3408304..3408323
FT                   /estimated_length=20
FT   gap             3419776..3419795
FT                   /estimated_length=20
FT   gap             3470202..3470592
FT                   /estimated_length=391
FT   gap             3498487..3498635
FT                   /estimated_length=149
FT   gene            3503341..3517760
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /note="gene_id=mCG19965.2"
FT   mRNA            join(3503341..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..3513651,3517498..3517653)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT18026"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT18026.2 created
FT                   on 17-SEP-2002"
FT   mRNA            join(3503487..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513576..3513651,
FT                   3517498..3517760)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT173476"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173476.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(3503504..3503636,3505064..3505205,3506773..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..>3513651)
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   transcript variant mCT173477"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173477.0 created
FT                   on 12-SEP-2002"
FT   CDS             join(3503555..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..3513651,3517498..3517560)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT18026.2
FT                   protein_id=mCP16521.2 isoform=CRA_c"
FT                   /protein_id="EDL07232.1"
FT                   /translation="MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFD
FT                   AIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELG
FT                   DLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK
FT                   GKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSAGDVEAIKSGPSDEGEEEIEDDTVT
FT                   NGS"
FT   CDS             join(3503555..3503636,3505064..3505205,3506773..3506785,
FT                   3512151..3512197,3512409..3512511,3513105..3513184,
FT                   3513576..>3513651)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173477.0
FT                   protein_id=mCP96395.0 isoform=CRA_b"
FT                   /protein_id="EDL07231.1"
FT                   /translation="MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFD
FT                   AIDFSDNEIRKLDGFPLLRRLKTLLVNNNSLVELGDLDPLASLKSLTYLSILRNPVTNK
FT                   KHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGL
FT                   PTDKKKGGPSAGDVEAIK"
FT   CDS             join(3503555..3503636,3505064..3505211,3506707..3506785,
FT                   3512151..3512197,3512409..3512511,3513576..3513581)
FT                   /codon_start=1
FT                   /gene="Snrpa1"
FT                   /locus_tag="mCG_19965"
FT                   /product="small nuclear ribonucleoprotein polypeptide A',
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19965.2 transcript_id=mCT173476.0
FT                   protein_id=mCP96396.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E883"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="MGI:MGI:1916231"
FT                   /db_xref="UniProtKB/TrEMBL:G5E883"
FT                   /protein_id="EDL07230.1"
FT                   /translation="MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFD
FT                   AIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELG
FT                   DLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKF"
FT   gap             3514081..3516276
FT                   /estimated_length=2196
FT   gene            3522846..3532726
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /note="gene_id=mCG19973.1"
FT   mRNA            join(3522846..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530589,3532085..3532726)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT18135"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT18135.2 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522852..3522969,3523512..3523650,3532413..3532673)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT173118"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT173118.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522857..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530787)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT177765"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177765.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(3522887..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530586,3532085..3532718)
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, transcript variant
FT                   mCT177764"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177764.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(3522894..3522969,3523512..3523650,3532413..3532446)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_a"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT173118.0
FT                   protein_id=mCP96037.0 isoform=CRA_a"
FT                   /protein_id="EDL07226.1"
FT                   /translation="MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLY
FT                   IVIQRLSLRLRALRQRQLDQAETVLGYCLADFIKEAQ"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530589,3532085..3532164)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_c"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT18135.2
FT                   protein_id=mCP16507.2 isoform=CRA_c"
FT                   /protein_id="EDL07228.1"
FT                   /translation="MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLY
FT                   IVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKL
FT                   RQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGG
FT                   YNPLTGEGGGTCSWRPGRRGPSSGG"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530586,3532085..3532164)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_b"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177764.0
FT                   protein_id=mCP100686.0 isoform=CRA_b"
FT                   /protein_id="EDL07227.1"
FT                   /translation="MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLY
FT                   IVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKL
FT                   RQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGY
FT                   NPLTGEGGGTCSWRPGRRGPSSGG"
FT   CDS             join(3522894..3522969,3523512..3523646,3526727..3526833,
FT                   3530265..3530354,3530511..3530609)
FT                   /codon_start=1
FT                   /gene="H47"
FT                   /locus_tag="mCG_19973"
FT                   /product="histocompatibility 47, isoform CRA_d"
FT                   /note="gene_id=mCG19973.1 transcript_id=mCT177765.0
FT                   protein_id=mCP100687.0 isoform=CRA_d"
FT                   /protein_id="EDL07229.1"
FT                   /translation="MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLY
FT                   IVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKL
FT                   RQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGG
FT                   KNLAM"
FT   gap             3523801..3525541
FT                   /estimated_length=1741
FT   gap             3549472..3549510
FT                   /estimated_length=39
FT   gap             3552651..3552768
FT                   /estimated_length=118
FT   gap             3553040..3553219
FT                   /estimated_length=180
FT   gene            <3553329..3626899
FT                   /locus_tag="mCG_19971"
FT                   /note="gene_id=mCG19971.2"
FT   mRNA            join(<3553329..3553645,3568677..3569172,3623449..3623646,
FT                   3623965..3626899)
FT                   /locus_tag="mCG_19971"
FT                   /product="mCG19971"
FT                   /note="gene_id=mCG19971.2 transcript_id=mCT18032.2 created
FT                   on 20-NOV-2002"
FT   CDS             join(3553329..3553645,3568677..3569172,3623449..3623646,
FT                   3623965..3625554)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19971"
FT                   /product="mCG19971"
FT                   /note="gene_id=mCG19971.2 transcript_id=mCT18032.2
FT                   protein_id=mCP16511.2"
FT                   /protein_id="EDL07225.1"
FT                   /translation="MAARGRRAWLSMLLGLVLGFVLASRLVLPRASELKRVGPRRRPSP
FT                   EGCRPGQEASQPGGARGDARGAQLWPQGSAAEGVPRDRNFLFVGVMTAQKYLQTRAVAA
FT                   YRTWSKTIPGKVEFFSSEGSDTSIPIPVVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKY
FT                   EWFMRADDDVYIKGDRLESFLRSLNSSEPLFLGQTGLGTTEEMGKLALEPGENFCMGGP
FT                   GVILSREVLRRMAPHIGKCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYE
FT                   QNKKGYIRDLHSSKIHRAITLHPNKNPPYQYRLHSYMLSRKIAELRHRTIQLHREIMQQ
FT                   LFYENYEQNKKGYIRDLHSSKIHRAITLHPNKNPPYQYRLHSYMLSRKIAELRHRTIQL
FT                   HREIVLMSKYSSTEIQKEDLQLGIPPSFMRFQARQREEILEWEFLTGKYLYSATDGQPP
FT                   RRGMDSAQREALDDIVMQVMEMINANAKTRGRIIDFKEIQYGYRRVNPMYGAEYILDLL
FT                   LLYKKHKGKKMTVPVRRHAYLQQTFSKMQFVEHEELDAQELADRINQDSGSLSFLSNSL
FT                   KKLVAFQLPGSKTEHKEPKEKKINILIPLSGRFDMFVRFMGNFEKTCLIPNLNVKLVIL
FT                   LFNSDSNPDKAKQVELMRDYRVKYPKADMQVLPVSGGFSRALALEVGSSQFNNESLLFF
FT                   CDVDLVFTAEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSGKVPSDNHFAFTQKTGFW
FT                   RNYGFGITCIYKGDLVRVGGFDVSIQGWGLEDVDLFNKVVQAGLKTFRSQEVGVVHIHH
FT                   PVVCDPNLDPKQYKMCLGSKASTFGSTQQLAEMWLEKNDPSYSKGGSHGSARTA"
FT   gap             3590898..3590917
FT                   /estimated_length=20
FT   gap             3612209..3612979
FT                   /estimated_length=771
FT   gap             3614478..3614497
FT                   /estimated_length=20
FT   gap             3615929..3615948
FT                   /estimated_length=20
FT   gap             3620331..3620350
FT                   /estimated_length=20
FT   gap             3622469..3622488
FT                   /estimated_length=20
FT   gap             3623677..3623696
FT                   /estimated_length=20
FT   gap             3639857..3639876
FT                   /estimated_length=20
FT   gap             3641073..3641092
FT                   /estimated_length=20
FT   gap             3642196..3642215
FT                   /estimated_length=20
FT   gap             3643739..3643758
FT                   /estimated_length=20
FT   gene            <3646758..3694389
FT                   /locus_tag="mCG_123064"
FT                   /note="gene_id=mCG123064.1"
FT   mRNA            join(<3646758..3647042,3647210..3647678,3694329..3694389)
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, transcript variant mCT176333"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT176333.0
FT                   created on 20-NOV-2002"
FT   mRNA            join(<3646758..3647042,3647210..3647392,3693937..3693983,
FT                   3694089..3694387)
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, transcript variant mCT124292"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT124292.1
FT                   created on 20-NOV-2002"
FT   CDS             join(<3646876..3647042,3647210..3647231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, isoform CRA_a"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT124292.1
FT                   protein_id=mCP89074.1 isoform=CRA_a"
FT                   /protein_id="EDL07223.1"
FT                   /translation="SADFKTDLRFQSAAIGALQEASEADLVGLFEDTNLCAIHAKRVTV
FT                   MPKDIQLAAGPIHGERA"
FT   CDS             join(<3646876..3647042,3647210..3647231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123064"
FT                   /product="mCG123064, isoform CRA_a"
FT                   /note="gene_id=mCG123064.1 transcript_id=mCT176333.0
FT                   protein_id=mCP99255.0 isoform=CRA_a"
FT                   /protein_id="EDL07224.1"
FT                   /translation="SADFKTDLRFQSAAIGALQEASEADLVGLFEDTNLCAIHAKRVTV
FT                   MPKDIQLAAGPIHGERA"
FT   gap             3649261..3651283
FT                   /estimated_length=2023
FT   gap             3662460..3662479
FT                   /estimated_length=20
FT   gap             3677341..3677360
FT                   /estimated_length=20
FT   gap             3679148..3679167
FT                   /estimated_length=20
FT   gap             3685830..3685849
FT                   /estimated_length=20
FT   gap             3687106..3687125
FT                   /estimated_length=20
FT   gap             3693823..3693842
FT                   /estimated_length=20
FT   gene            complement(<3694697..>3777583)
FT                   /locus_tag="mCG_141689"
FT                   /note="gene_id=mCG141689.0"
FT   mRNA            complement(join(<3694697..3694984,3720118..3720234,
FT                   3721184..3721301,3725385..3725550,3729567..3729770,
FT                   3733327..3733493,3733999..3734248,3736373..3736512,
FT                   3736906..3737092,3739761..3739900,3740307..3740470,
FT                   3743357..3743528,3745549..3745825,3747193..3747352,
FT                   3747723..3747843,3748838..3749010,3750367..3750484,
FT                   3751561..3751733,3752568..3752732,3755107..3755312,
FT                   3755726..3755838,3756434..3756563,3761201..3761277,
FT                   3769234..3769460,3770740..3770813,3772921..3772997,
FT                   3774728..3774840,3777455..>3777583))
FT                   /locus_tag="mCG_141689"
FT                   /product="mCG141689"
FT                   /note="gene_id=mCG141689.0 transcript_id=mCT176335.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(3694697..3694984,3720118..3720234,
FT                   3721184..3721301,3725385..3725550,3729567..3729770,
FT                   3733327..3733493,3733999..3734248,3736373..3736512,
FT                   3736906..3737092,3739761..3739900,3740307..3740470,
FT                   3743357..3743528,3745549..3745825,3747193..3747352,
FT                   3747723..3747843,3748838..3749010,3750367..3750484,
FT                   3751561..3751733,3752568..3752732,3755107..3755312,
FT                   3755726..3755838,3756434..3756563,3761201..3761277,
FT                   3769234..3769460,3770740..3770813,3772921..3772997,
FT                   3774728..3774840,3777455..3777583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141689"
FT                   /product="mCG141689"
FT                   /note="gene_id=mCG141689.0 transcript_id=mCT176335.0
FT                   protein_id=mCP99257.0"
FT                   /protein_id="EDL07222.1"
FT                   /translation="MAVFWKSHLRDADFSENSLKEVPLGLFQLDVSPMALHFSLSTVAL
FT                   MFLRLQGNQLLSLPPQEKWTCTQLKTLDLSRNQLGKNEDGLKTKRISLFTTRGRQRSGT
FT                   ETVVHPSSSTQMKREIKTGGELSVGRAALRVKWSHLKLPWVDLDWLLDISCQITELDLS
FT                   ANCLPSLPSIIPWGLINLKKLNLSNNQLGELPCVQSSDEIICSRNEDGLKTKRISLFTT
FT                   RGRQRSGTETASMLEFPAFLSESLEVLCLNDNHLDAVPPSVCLLKNLSELYLGNNPGLR
FT                   ELPPELGQLGNLWQLDIEDLNISNVPAEVRKEATLSFLRAQLRKAEKCKLMKMILVGPP
FT                   RQGKSTLLEILQTGKAPQLAHSEATIRTTKWELQRPAGSKAKVESVEFNVWDIGGPASM
FT                   ATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAK
FT                   FRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHMATVNQCFFTDKALYVVVWNLA
FT                   LGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPS
FT                   GSRATGFPDITFKHLHEISCKNLEGQEGLRQLIFHVTCNMKDVGSTIGCQKLAGRLIPR
FT                   SYISLQEAVLAEQQRRSLGDQVQYLTDRQLDQLVEQTPGNDIKDYEDLQSAISFLIETG
FT                   TLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGF
FT                   TQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHSMRHPMANTIQRVFKMSF
FT                   VPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGSQRNRCSTFRVRRN
FT                   QTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITDHVNSL
FT                   IDQWFPGPFSLVFQLFENKKNTKSRNRKVTIYSFTGSQRNRCSTFRVRRNQTIYWQEGL
FT                   LVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITDHVNSLIDQWFPALT
FT                   ATESDGTPLMEQYVPCPVCEASWAQHADPNERSESVQYFDMEDCVLTAIERDFISCPRH
FT                   PDLPVPLQELVPELFMTDFPARLFLENSKLEHTEGENSILGQGGSGTVIYQARYQGQPV
FT                   AVKRFHIKKFKNSANAPAERMALLCPADTMLRHLRAMDAMKNFSDFRQEASMLHALQHP
FT                   CIVSLIGISIHPLCFALGAGPAGQSQHHMFSYGMVLYELLSGQRPALGHHQLQIVKKLS
FT                   KGIRPVLGQPEEVQFHRLQALMMENYTVVNTEKGLLEVQRMTCPGMKLSCQLKVQSSVW
FT                   IATEDQKIYIYSLKGMCPLSVPQQALDTPAVVTCFLAVPVIKKIISIAVPRDPAVQLLG
FT                   TDWKEPGQGVNGTVGFQALGAAQATSFAPVLSPVPTATCRDTLFEPLSQELSQCQDLSP
FT                   GTQIYIKAMRPASCSHSTPS"
FT   gap             3695923..3700045
FT                   /estimated_length=4123
FT   gap             3701289..3701308
FT                   /estimated_length=20
FT   gap             3710175..3710194
FT                   /estimated_length=20
FT   gap             3711317..3712039
FT                   /estimated_length=723
FT   gap             3713337..3718870
FT                   /estimated_length=5534
FT   gap             3724237..3725367
FT                   /estimated_length=1131
FT   gap             3726884..3728107
FT                   /estimated_length=1224
FT   gap             3729371..3729488
FT                   /estimated_length=118
FT   gap             3732412..3732599
FT                   /estimated_length=188
FT   gap             3737918..3737937
FT                   /estimated_length=20
FT   gap             3738967..3738986
FT                   /estimated_length=20
FT   gap             3751341..3751360
FT                   /estimated_length=20
FT   gap             3761854..3767801
FT                   /estimated_length=5948
FT   gap             3771953..3771972
FT                   /estimated_length=20
FT   gap             3778751..3782230
FT                   /estimated_length=3480
FT   gap             3785120..3785139
FT                   /estimated_length=20
FT   gene            complement(<3792275..3850573)
FT                   /locus_tag="mCG_1028437"
FT                   /note="gene_id=mCG1028437.1"
FT   mRNA            complement(join(<3792275..3792300,3792957..3793128,
FT                   3803131..3803294,3843731..3843945,3850465..3850573))
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, transcript variant mCT173107"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT173107.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(<3792275..3792300,3792957..3793128,
FT                   3803131..3803294,3843731..3843827))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, isoform CRA_b"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT173107.0
FT                   protein_id=mCP96026.0 isoform=CRA_b"
FT                   /protein_id="EDL07221.1"
FT                   /translation="MAGTSQRPPSMYWCVGTEGLAVCPGPAMETHNGAEDMGSKLSLPG
FT                   GSSTVQCPSMEEIHTAYKQRNLSRARDLLRGVCEESESSQEKGQLLSIAAAHGDLETVQ
FT                   FLLTEKRVELPTEPTDDNPAVVAAHFGHAEVVRELLESLPGPCTPQRLL"
FT   gap             3794787..3794806
FT                   /estimated_length=20
FT   mRNA            complement(join(3801870..3802375,3803131..3803294,
FT                   3803382..3803636))
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, transcript variant mCT146141"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT146141.1
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(3802328..3802375,3803131..3803294,
FT                   3803382..3803481))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028437"
FT                   /product="mCG1028437, isoform CRA_a"
FT                   /note="gene_id=mCG1028437.1 transcript_id=mCT146141.1
FT                   protein_id=mCP88622.1 isoform=CRA_a"
FT                   /protein_id="EDL07220.1"
FT                   /translation="MPSRMAGGPQRYRSLLTGAFQDSLPNPQPCDVMGAEDMGSKLSLP
FT                   GGSSTVQCPSMEEIHTAYKQRNLSRARDLLRGVCEESESSQEKGLQACPSLPGLRCWG"
FT   gap             3820844..3820863
FT                   /estimated_length=20
FT   gap             3822464..3822483
FT                   /estimated_length=20
FT   gap             3823857..3824110
FT                   /estimated_length=254
FT   gap             3825436..3825455
FT                   /estimated_length=20
FT   gene            complement(3853139..3889616)
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /note="gene_id=mCG123072.1"
FT   mRNA            complement(join(3853139..3855005,3860936..3861010,
FT                   3862326..3862483,3864219..3864383,3868222..3868406,
FT                   3870049..3870151,3871247..3871360,3873641..3873769,
FT                   3874497..3874558,3875040..3875169,3881243..3881383,
FT                   3884351..3884455,3889460..3889616))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173110"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173110.0
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(3854933..3855005,3860936..3861010,
FT                   3862326..3862483,3864219..3864383,3868222..3868406,
FT                   3870049..3870151,3871247..3871360,3873641..3873769,
FT                   3874497..3874558,3875040..3875169,3881243..3881383,
FT                   3884351..3884455,3889460..3889558))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173110.0
FT                   protein_id=mCP96029.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UIA4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="MGI:MGI:1861722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UIA4"
FT                   /protein_id="EDL07219.1"
FT                   /translation="MATTNGAVENGQPDGKPPALPRPIRNLEVKFTKIFINNDWHESKS
FT                   GRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLA
FT                   DLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVV
FT                   CFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKE
FT                   VGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVREAASRSNLKRVTLEL
FT                   GGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKK
FT                   RPVGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFS
FT                   DVTDNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAAL
FT                   ESGTVWINCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLEEKNP"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3889460..3889616))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT124300"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT124300.1
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3888576..3888737))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173111"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173111.1
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(3870859..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3887672..3887849))
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   transcript variant mCT173112"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173112.1
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3889460..3889558))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT124300.1
FT                   protein_id=mCP88619.2 isoform=CRA_a"
FT                   /protein_id="EDL07216.1"
FT                   /translation="MATTNGAVENGQPDGKPPALPRPIRNLEVKFTKIFINNDWHESKS
FT                   GRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLA
FT                   DLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVV
FT                   CFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKE
FT                   VGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVSPLCELLAETTTCSII"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875169,
FT                   3881243..3881383,3884351..3884455,3887672..3887806))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173112.1
FT                   protein_id=mCP96031.1 isoform=CRA_c"
FT                   /protein_id="EDL07218.1"
FT                   /translation="MFQEILAPAAWCLATPFIPLLVPTCSLWASCAPLQRPLRTMKKAK
FT                   IFINNDWHESKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLD
FT                   ALSRGQLLHQLADLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAGWADKI
FT                   QGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTP
FT                   LTALYLASLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVSPLCELLA
FT                   ETTTCSII"
FT   CDS             complement(join(3871164..3871178,3871208..3871360,
FT                   3873641..3873769,3874497..3874558,3875040..3875157))
FT                   /codon_start=1
FT                   /gene="Aldh1a3"
FT                   /locus_tag="mCG_123072"
FT                   /product="aldehyde dehydrogenase family 1, subfamily A3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123072.1 transcript_id=mCT173111.1
FT                   protein_id=mCP96030.1 isoform=CRA_b"
FT                   /protein_id="EDL07217.1"
FT                   /translation="MDTGKPFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVVC
FT                   FTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEV
FT                   GFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVSPLCELLAETTTCSII"
FT   gap             3893692..3893711
FT                   /estimated_length=20
FT   gap             3933374..3933393
FT                   /estimated_length=20
FT   gap             3952926..3952945
FT                   /estimated_length=20
FT   gap             3976148..3977404
FT                   /estimated_length=1257
FT   gap             3979413..3979626
FT                   /estimated_length=214
FT   gap             3980679..3980698
FT                   /estimated_length=20
FT   gap             3998840..3998859
FT                   /estimated_length=20
FT   gap             4003130..4003149
FT                   /estimated_length=20
FT   gap             4009987..4011772
FT                   /estimated_length=1786
FT   gap             4015931..4015950
FT                   /estimated_length=20
FT   gap             4017803..4017996
FT                   /estimated_length=194
FT   gap             4020888..4021140
FT                   /estimated_length=253
FT   gap             4034245..4034338
FT                   /estimated_length=94
FT   gap             4040543..4040562
FT                   /estimated_length=20
FT   gap             4060938..4060957
FT                   /estimated_length=20
FT   gap             4100065..4100084
FT                   /estimated_length=20
FT   gene            complement(4101645..4147368)
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /note="gene_id=mCG2185.3"
FT   mRNA            complement(join(4101645..4104997,4116722..4117327,
FT                   4136934..4137195,4139559..4139662,4145738..4145812,
FT                   4146677..4146774,4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT1799"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT1799.3 created on
FT                   10-JUN-2004"
FT   mRNA            complement(join(4101645..4104997,4116722..4117327,
FT                   4136011..4136099,4136934..4137195,4139559..4139662,
FT                   4145738..4145812,4146677..4146774,4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT194449"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT194449.0 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(4104858..4104997,4116722..4117327,
FT                   4136934..4137144))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT1799.3
FT                   protein_id=mCP16501.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q91ZU0"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91ZU0"
FT                   /protein_id="EDL07214.1"
FT                   /translation="MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDA
FT                   NGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESE
FT                   YRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERS
FT                   SCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSA
FT                   LRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQDVTRQPRTLQDL
FT                   CRIKIRQCIGLQNLKLLDELPIAKVMKDYLKHKFDDI"
FT   CDS             complement(join(4104858..4104997,4116722..4117327,
FT                   4136011..4136044))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT194449.0
FT                   protein_id=mCP115478.0 isoform=CRA_c"
FT                   /db_xref="GOA:C0H5Y0"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/TrEMBL:C0H5Y0"
FT                   /protein_id="EDL07215.1"
FT                   /translation="MIDVPQLSERPSDPTVKDLIGGFTALHYAAMHGRARIARLMLESE
FT                   YRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERS
FT                   SCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSA
FT                   LRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQDVTRQPRTLQDL
FT                   CRIKIRQCIGLQNLKLLDELPIAKVMKDYLKHKFDDI"
FT   gap             4129499..4129518
FT                   /estimated_length=20
FT   mRNA            complement(join(4134877..4136099,4136934..4137195,
FT                   4139559..4139662,4145738..4145812,4146677..4146774,
FT                   4146954..4147368))
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   transcript variant mCT173119"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT173119.1 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(4136041..4136099,4136934..4137144))
FT                   /codon_start=1
FT                   /gene="Asb7"
FT                   /locus_tag="mCG_2185"
FT                   /product="ankyrin repeat and SOCS box-containing protein 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2185.3 transcript_id=mCT173119.1
FT                   protein_id=mCP96038.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BQC5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2152835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQC5"
FT                   /protein_id="EDL07213.1"
FT                   /translation="MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDA
FT                   NGWTLLHFSAARGKERCVRVFLEHGGVYFVKRLARLACLLKYRR"
FT   gap             4144782..4144801
FT                   /estimated_length=20
FT   gene            4147737..4175659
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /note="gene_id=mCG2192.2"
FT   mRNA            join(4147737..4147876,4168963..>4169280)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174605"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174605.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(<4147800..4147876,4153850..4153980,4168963..4169476,
FT                   4169562..4169651,4170218..4170826)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT189935"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT189935.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4147808..4147876,4153850..4153980,4168963..4169476,
FT                   4169562..4169651,4170218..4170359,4171154..4171670,
FT                   4172791..4172962,4174707..4175659)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT1793"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT1793.2 created on
FT                   17-JUN-2003"
FT   mRNA            join(4147814..4147876,4153850..4153980,4163411..4163463,
FT                   4164603..4164639,4168963..>4169336)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174603"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174603.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4147822..4147876,4153850..4153980,4165409..4165552,
FT                   4168963..>4169318)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174604"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174604.0 created
FT                   on 17-JUN-2003"
FT   gap             4165965..4165984
FT                   /estimated_length=20
FT   gap             4167998..4168017
FT                   /estimated_length=20
FT   CDS             join(<4168973..4169476,4169562..4169651,4170218..4170535)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_f"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT189935.0
FT                   protein_id=mCP110926.0 isoform=CRA_f"
FT                   /protein_id="EDL07212.1"
FT                   /translation="GNILEIHCISKSSIFTPVAVDSLMRYILDIKMEIVQEILDQLYRK
FT                   VLLGTTLEDDVHGYIFYLNPDLSEQDGCPAFPVAQSNASGVLDGMAGQHGPSSHEVATL
FT                   PGAQECPKRQLQMDRTREMKLLQLTVIDTMLSQVLSDETETHAKEGYRELTEVLLQSVE
FT                   LDSKLMRMLQNSDKLLSHMAAKCLASLLYFQLREKKMLSNSWVTFCQKHLSESSESGEA
FT                   VRCLWILTAVIKEILKDTHSQRAGRDGLSTKDYHLRGWAFIMKSKTHVILISLEVWKNL
FT                   RSCPIFLLNITLEWRVVYVLGV"
FT   CDS             4169042..>4169336
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174603.0
FT                   protein_id=mCP97522.0 isoform=CRA_a"
FT                   /protein_id="EDL07207.1"
FT                   /translation="MRYILDIKMEIVQEILDQLYRKVLLGTTLEDDVHGYIFYLNPDLS
FT                   EQDGCPAFPVAQSNASGVLDGMAGQHGPSSHEVATLPGAQECPKRQLQMDRTR"
FT   CDS             4169042..>4169318
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174604.0
FT                   protein_id=mCP97525.0 isoform=CRA_b"
FT                   /protein_id="EDL07208.1"
FT                   /translation="MRYILDIKMEIVQEILDQLYRKVLLGTTLEDDVHGYIFYLNPDLS
FT                   EQDGCPAFPVAQSNASGVLDGMAGQHGPSSHEVATLPGAQECPKRQL"
FT   CDS             4169042..>4169280
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174605.0
FT                   protein_id=mCP97523.0 isoform=CRA_c"
FT                   /protein_id="EDL07209.1"
FT                   /translation="MRYILDIKMEIVQEILDQLYRKVLLGTTLEDDVHGYIFYLNPDLS
FT                   EQDGCPAFPVAQSNASGVLDGMAGQHGPSSHEVAT"
FT   mRNA            join(4169057..4169440,4174942..>4175007)
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), transcript variant
FT                   mCT174606"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174606.0 created
FT                   on 17-JUN-2003"
FT   CDS             join(4169066..4169440,4174942..>4175007)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT174606.0
FT                   protein_id=mCP97524.0 isoform=CRA_d"
FT                   /protein_id="EDL07210.1"
FT                   /translation="MEIVQEILDQLYRKVLLGTTLEDDVHGYIFYLNPDLSEQDGCPAF
FT                   PVAQSNASGVLDGMAGQHGPSSHEVATLPGAQECPKRQLQMDRTREMKLLQLTVIDTML
FT                   SQVLSDETETHAKEGYRELTEFFAAVESQCGMLVHDPVPSPAR"
FT   CDS             join(4171274..4171670,4172791..4172962,4174707..4175445)
FT                   /codon_start=1
FT                   /gene="Lins2"
FT                   /locus_tag="mCG_2192"
FT                   /product="lines homolog 2 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG2192.2 transcript_id=mCT1793.2
FT                   protein_id=mCP16522.3 isoform=CRA_e"
FT                   /protein_id="EDL07211.1"
FT                   /translation="MLFLKPHALDILAWPIPAFIKRKLVILVKKCLLCKVGEDLCREPA
FT                   PSLMSPDHLLDSDMLTLADTLLHAVHVGLWKALAVSGKPSCFGGDEVQPGCRLRTGPDH
FT                   VTLRAASLITVKSLEIKSQNCTSAAKMKVALQTFMSELLAFLKPHLQPSLQPHNPCEWL
FT                   SRVFIEQDDDMLEAAKASLSIYLQLTREWDASASLTQEKEAWIRSTHGHGCNPHCVFLF
FT                   FLKNVAFDSTVLLDFLISSETCFLEYFVKYLKLLQKDWAHFLSICKFFAAVESQCGMLV
FT                   HDPVPSPARGRSTSLTVPHAPASPVGENTCPWLPWASDASSESQSQVMMPKETLPVPAS
FT                   GPPSRTPQSLVDYDSSEASEEETTSEHLANSKQTSLCQERSEEIQGLPRTWEEQKEHSL
FT                   EPQRLCSLQSPVLPSLPRVELLQTGLSGKWDCFFVQ"
FT   gap             4183283..4183302
FT                   /estimated_length=20
FT   gap             4200883..4200985
FT                   /estimated_length=103
FT   gap             4206242..4206944
FT                   /estimated_length=703
FT   gap             4251928..4252018
FT                   /estimated_length=91
FT   gap             4274520..4274539
FT                   /estimated_length=20
FT   gap             4281552..4281680
FT                   /estimated_length=129
FT   gap             4292516..4293588
FT                   /estimated_length=1073
FT   gene            4300720..4500893
FT                   /locus_tag="mCG_141698"
FT                   /note="gene_id=mCG141698.0"
FT   mRNA            join(4300720..4300859,4301196..4301566,4310659..4310824,
FT                   4349619..4349788,4370008..4370091,4370746..4370903,
FT                   4377274..4377317,4430302..4430407,4473847..4473987,
FT                   4475729..4475879,4500568..4500893)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176379"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176379.0
FT                   created on 20-NOV-2002"
FT   CDS             join(4300784..4300859,4301196..4301566,4310659..4310824,
FT                   4349619..4349788,4370008..4370091,4370746..4370903,
FT                   4377274..4377317,4430302..4430407,4473847..4473987,
FT                   4475729..4475879,4500568..4500780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_c"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176379.0
FT                   protein_id=mCP99300.0 isoform=CRA_c"
FT                   /db_xref="GOA:B2RUI7"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:3588195"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUI7"
FT                   /protein_id="EDL07206.1"
FT                   /translation="MCDGTLLPPLVLSLLLLVWGLDPGTAVGDAAADVEVVLPRRLRPE
FT                   DVHLQLLPGAAGLRRWRRPRASPGGHRAGQGERALLLHLPAFGRDLYLQLHRDLRFLSP
FT                   GFEVEEAGVSGRSGHPAELCFYSGRVLGHPGSLVSLSACGAAGGLVGLIQLEQEQVFIQ
FT                   PLNSSGGPFIGREHLIRRKWASTPSPATEVEGLRQRCKVVTEKKPRKDHLSRDWRERRN
FT                   AIRLTNEHTVETLVVADADMVQYHGAEAAQRFILTVMNMVYNMFQHRSLGIKINIQVTK
FT                   LVLLRQRPAKLSIGHHGERSLESFCHWQNEEYGGARYLGNNQVPGGKDDTPPVDAAVFV
FT                   TRTDFCVHKDEPCDTVGIAYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDD
FT                   DHSSCAGRSHIMSGEWVKGRNPSDLSWSSCSRDDLENFLKSKVSTCLLITDPRSQHALR
FT                   LPHKLPGMHYSANEQCQILFGTNATFCKNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGT
FT                   ECGADKVTPSLWHSQQVASHLLNTEPLSIWKAVYTLKHPGAL"
FT   gap             4318096..4318358
FT                   /estimated_length=263
FT   gap             4337921..4339214
FT                   /estimated_length=1294
FT   mRNA            join(<4377272..4377317,4430302..4430407,4430703..4431047)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176378"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176378.0
FT                   created on 20-NOV-2002"
FT   gap             4416891..4416910
FT                   /estimated_length=20
FT   CDS             <4430825..4431040
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_b"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176378.0
FT                   protein_id=mCP99301.0 isoform=CRA_b"
FT                   /protein_id="EDL07205.1"
FT                   /translation="SPKVPPPGEYGAVSSILRGGSWVLGGCYHLQEASGADSQSLLQTW
FT                   PQSLPFLLERMSVLCFSEGKNCDMTM"
FT   gap             4431568..4431587
FT                   /estimated_length=20
FT   gap             4433711..4433730
FT                   /estimated_length=20
FT   gap             4435122..4435141
FT                   /estimated_length=20
FT   gap             4437210..4438672
FT                   /estimated_length=1463
FT   gap             4448620..4448753
FT                   /estimated_length=134
FT   gap             4450126..4450641
FT                   /estimated_length=516
FT   gap             4453690..4453709
FT                   /estimated_length=20
FT   gap             4455135..4455754
FT                   /estimated_length=620
FT   mRNA            join(<4457543..4457622,4467850..>4468292)
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, transcript variant mCT176377"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176377.0
FT                   created on 20-NOV-2002"
FT   gap             4458078..4458097
FT                   /estimated_length=20
FT   gap             4460339..4466541
FT                   /estimated_length=6203
FT   CDS             <4468065..>4468292
FT                   /codon_start=1
FT                   /locus_tag="mCG_141698"
FT                   /product="mCG141698, isoform CRA_a"
FT                   /note="gene_id=mCG141698.0 transcript_id=mCT176377.0
FT                   protein_id=mCP99299.0 isoform=CRA_a"
FT                   /protein_id="EDL07204.1"
FT                   /translation="HSGQACFSWAHSSEDILAASRTTGVLGHRKVGDVRIFFFLWLWMP
FT                   FSTAFLAFKAFALASALGGAGASFFAFSADF"
FT   gap             4468911..4468930
FT                   /estimated_length=20
FT   gap             4476525..4477848
FT                   /estimated_length=1324
FT   gap             4489423..4489442
FT                   /estimated_length=20
FT   gap             4501364..4503095
FT                   /estimated_length=1732
FT   gap             4519572..4519591
FT                   /estimated_length=20
FT   gene            <4520423..4554351
FT                   /locus_tag="mCG_2186"
FT                   /note="gene_id=mCG2186.2"
FT   mRNA            join(<4520423..4520522,4521485..4521612,4525941..4526061,
FT                   4544384..4544541,4549128..4549287,4549635..4549760,
FT                   4551885..4551995,4552067..4552202,4553687..4554351)
FT                   /locus_tag="mCG_2186"
FT                   /product="mCG2186"
FT                   /note="gene_id=mCG2186.2 transcript_id=mCT1794.2 created on
FT                   20-NOV-2002"
FT   CDS             join(4520423..4520522,4521485..4521612,4525941..4526061,
FT                   4544384..4544541,4549128..4549287,4549635..4549760,
FT                   4551885..4551995,4552067..4552202,4553687..4553699)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2186"
FT                   /product="mCG2186"
FT                   /note="gene_id=mCG2186.2 transcript_id=mCT1794.2
FT                   protein_id=mCP16503.2"
FT                   /protein_id="EDL07203.1"
FT                   /translation="MKGSPPLTPAVKPWCPTCLSLEGAICRVAQSESDKPCELYCSPLG
FT                   KESPLLVADRVLDGTPCGPYEADLCVYGRCQKIGCDGIIGSAAKEDRCGVCSGDGKTCR
FT                   VVKGDFSHSRGTALKDSSKRSINSDWKIELPGEFQIAGTTVRYVRRGLWEKFSAKGPTT
FT                   VPLHLMVLLFHDQNYGIHYEYTIPVNQSSENQSEPAKPQDALFLWTHSGWEGCSVQCGG
FT                   ATVSRVQREVRVLWTKQSTLCPPLFLTSKCDVCPHTPTVKTTDCGTWSTLLCYDLSTLS
FT                   LFDKCDMAHLVIDKCTHTPLRERRTIVSCTRIVNKTTTLVNDSDCPQASRPEPQVRRCN
FT                   SHPCQSRVSN"
FT   gap             4541738..4541757
FT                   /estimated_length=20
FT   gap             4546133..4546152
FT                   /estimated_length=20
FT   gap             4571602..4571621
FT                   /estimated_length=20
FT   gap             4584903..4585079
FT                   /estimated_length=177
FT   gap             4587851..4589693
FT                   /estimated_length=1843
FT   gap             4591462..4591481
FT                   /estimated_length=20
FT   gap             4593084..4593343
FT                   /estimated_length=260
FT   gap             4595445..4595464
FT                   /estimated_length=20
FT   gap             4627316..4627335
FT                   /estimated_length=20
FT   gap             4628498..4628517
FT                   /estimated_length=20
FT   gap             4629643..4629662
FT                   /estimated_length=20
FT   gap             4653904..4654436
FT                   /estimated_length=533
FT   gap             4656500..4656720
FT                   /estimated_length=221
FT   gap             4667684..4667874
FT                   /estimated_length=191
FT   gene            complement(4670449..>4688830)
FT                   /locus_tag="mCG_144579"
FT                   /note="gene_id=mCG144579.0"
FT   mRNA            complement(join(4670449..4671769,4685869..4686551,
FT                   4688615..>4688830))
FT                   /locus_tag="mCG_144579"
FT                   /product="mCG144579"
FT                   /note="gene_id=mCG144579.0 transcript_id=mCT184003.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(4670797..>4671042)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144579"
FT                   /product="mCG144579"
FT                   /note="gene_id=mCG144579.0 transcript_id=mCT184003.0
FT                   protein_id=mCP106148.0"
FT                   /protein_id="EDL07202.1"
FT                   /translation="DPVFLFDSKRRREAIVKTTRQKEHLLALGSITLHCLLKTSGLTGG
FT                   GRSSLRRSFSFNHSTNLNIDLTQNISHANPESVHLS"
FT   gene            4688914..4771514
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /note="gene_id=mCG2184.2"
FT   mRNA            join(4688914..4689000,4689980..4690262,4708112..4708200,
FT                   4771314..4771514)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT174602"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174602.0 created
FT                   on 18-OCT-2002"
FT   mRNA            join(4688914..4689000,4689980..4690262,4692235..4693049)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT1804"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT1804.1 created on
FT                   18-OCT-2002"
FT   mRNA            join(4689980..4690262,4690747..4690772,4691397..4694827)
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, transcript variant mCT174601"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174601.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(4689990..4690262,4708112..4708126)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174602.0
FT                   protein_id=mCP97521.0 isoform=CRA_b"
FT                   /protein_id="EDL07199.1"
FT                   /translation="MRQKEVLAKSFQGPAAVCRTPNSHVYMFNNGSGDSGDSSEEESHQ
FT                   VVLRPRGKEHQKNSSQRPGAGTMVLLQRELAQEDSLNKLALQYGCKKALE"
FT   CDS             join(4689990..4690262,4692235..4692843)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_c"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT1804.1
FT                   protein_id=mCP16500.2 isoform=CRA_c"
FT                   /protein_id="EDL07200.1"
FT                   /translation="MRQKEVLAKSFQGPAAVCRTPNSHVYMFNNGSGDSGDSSEEESHQ
FT                   VVLRPRGKEHQKNSSQRPGAGTMVLLQRELAQEDSLNKLALQYGCKVADIKKANNFIRE
FT                   QDLYALKSIKIPVRNHGILTETHQELMPLGASSSETRVTLVDLPEDEDAGGATTQGNQL
FT                   TDFFKGIDENIERAVHSDVFHGDSCCVEAPDQLLLPITQKPVADGADCGIQWWNAVFLM
FT                   LLIGIVLPVFYLVYFKIQATGEPSNGLNATVVPNGSMTLSPVPGQAPRLAIPVPTLPAS
FT                   DSQVSPTTQAGA"
FT   CDS             join(4689990..4690262,4690747..4690758)
FT                   /codon_start=1
FT                   /gene="Lysmd4"
FT                   /locus_tag="mCG_2184"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG2184.2 transcript_id=mCT174601.0
FT                   protein_id=mCP97520.0 isoform=CRA_a"
FT                   /protein_id="EDL07198.1"
FT                   /translation="MRQKEVLAKSFQGPAAVCRTPNSHVYMFNNGSGDSGDSSEEESHQ
FT                   VVLRPRGKEHQKNSSQRPGAGTMVLLQRELAQEDSLNKLALQYGCKHSE"
FT   gap             4694904..4694923
FT                   /estimated_length=20
FT   gene            complement(4698484..>4814039)
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /note="gene_id=mCG2191.2"
FT   mRNA            complement(join(4698484..4698675,4701204..4701628,
FT                   4702924..4703050,4706807..4706933,4711014..4711037,
FT                   4718150..4718337,4731183..4731242,4732263..4732482,
FT                   4734589..4734720,4761126..4761329,4780976..4781166,
FT                   4813986..>4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT189932"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189932.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4698484..4698675,4701204..4701628,
FT                   4702924..4703050,4706807..4706933,4711014..4711037,
FT                   4718150..4718337,4731183..4731242,4732263..4732482,
FT                   4734589..4734720,4761126..4761329,4780976..4781166,
FT                   4813966..4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT1800"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT1800.1 created on
FT                   04-JUN-2003"
FT   mRNA            complement(join(4700233..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..4781166,4813986..>4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT189933"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189933.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4700233..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734387..>4735035))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT185138"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185138.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(4700547..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734589..4734720,4759345..4759491,
FT                   4761126..4761329,4780976..4781166,4813986..4814039))
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, transcript variant
FT                   mCT185139"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185139.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..>4781035))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_d"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189932.0
FT                   protein_id=mCP110924.0 isoform=CRA_d"
FT                   /protein_id="EDL07196.1"
FT                   /translation="LKMGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEI
FT                   ALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD
FT                   DYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSL
FT                   VSPSLAASSTLADSSMLSPPPATLHRNVSPGAPQRPPSTGSASGMLSTTDLTVPNGAGN
FT                   SPVGNGFVNSRASPNLIGNTGANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVVIPPSS
FT                   KGMMPPLSEEEELELNAQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDY
FT                   SLTSADLSALQGFTSPGMLSLGQASAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQN
FT                   INIKSEPISPPRDRMTPSGFQQQQQQPQQQPPPQPPQPQPRQEMGRSPVDSLSSSSSSY
FT                   DGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDTWVT"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..>4781035))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_d"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT189933.0
FT                   protein_id=mCP110925.0 isoform=CRA_d"
FT                   /protein_id="EDL07197.1"
FT                   /translation="LKMGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEI
FT                   ALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD
FT                   DYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSL
FT                   VSPSLAASSTLADSSMLSPPPATLHRNVSPGAPQRPPSTGSASGMLSTTDLTVPNGAGN
FT                   SPVGNGFVNSRASPNLIGNTGANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVVIPPSS
FT                   KGMMPPLSEEEELELNAQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDY
FT                   SLTSADLSALQGFTSPGMLSLGQASAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQN
FT                   INIKSEPISPPRDRMTPSGFQQQQQQPQQQPPPQPPQPQPRQEMGRSPVDSLSSSSSSY
FT                   DGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDTWVT"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4711014..4711037,4718150..4718337,
FT                   4731183..4731242,4732263..4732482,4734589..4734720,
FT                   4761126..4761329,4780976..4781029))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_a"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT1800.1
FT                   protein_id=mCP16517.1 isoform=CRA_a"
FT                   /protein_id="EDL07193.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDADDY
FT                   FEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVS
FT                   PSLAASSTLADSSMLSPPPATLHRNVSPGAPQRPPSTGSASGMLSTTDLTVPNGAGNSP
FT                   VGNGFVNSRASPNLIGNTGANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVVIPPSSKG
FT                   MMPPLSEEEELELNAQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSL
FT                   TSADLSALQGFTSPGMLSLGQASAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNIN
FT                   IKSEPISPPRDRMTPSGFQQQQQQPQQQPPPQPPQPQPRQEMGRSPVDSLSSSSSSYDG
FT                   SDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDTWVT"
FT   CDS             complement(join(4701268..4701628,4702924..4703050,
FT                   4706807..4706933,4718150..4718337,4731183..4731242,
FT                   4732263..4732482,4734387..>4734524))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_b"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185138.0
FT                   protein_id=mCP106396.0 isoform=CRA_b"
FT                   /protein_id="EDL07194.1"
FT                   /translation="ALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKI
FT                   APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLADSSMLSPPPATLHRN
FT                   VSPGAPQRPPSTGSASGMLSTTDLTVPNGAGNSPVGNGFVNSRASPNLIGNTGANSLGK
FT                   VMPTKSPPPPGGGSLGMNSRKPDLRVVIPPSSKGMMPPLNAQRISSSQATQPLATPVVS
FT                   VTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFTSPGMLSLGQASAWQQHHLGQA
FT                   ALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQQQQQQPQQQPPPQP
FT                   PQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRM
FT                   RMDTWVT"
FT   gap             4705817..4706516
FT                   /estimated_length=700
FT   gap             4720735..4721231
FT                   /estimated_length=497
FT   gene            complement(4735226..4738597)
FT                   /locus_tag="mCG_147199"
FT                   /note="gene_id=mCG147199.0"
FT   mRNA            complement(join(4735226..4735956,4735995..4738597))
FT                   /locus_tag="mCG_147199"
FT                   /product="mCG147199"
FT                   /note="gene_id=mCG147199.0 transcript_id=mCT187462.0
FT                   created on 13-JAN-2004"
FT   gap             4735967..4735986
FT                   /estimated_length=20
FT   CDS             complement(4736783..4736989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147199"
FT                   /product="mCG147199"
FT                   /note="gene_id=mCG147199.0 transcript_id=mCT187462.0
FT                   protein_id=mCP109606.0"
FT                   /protein_id="EDL07201.1"
FT                   /translation="MSSLSTKLILPLTFPPCARNASEVKGCRAEDAAALCFLISTNRVK
FT                   PSFLEFRTACDFKANSFRFALCI"
FT   gap             4743968..4746250
FT                   /estimated_length=2283
FT   CDS             complement(join(4759447..4759491,4761126..4761329,
FT                   4780976..4781029))
FT                   /codon_start=1
FT                   /gene="Mef2a"
FT                   /locus_tag="mCG_2191"
FT                   /product="myocyte enhancer factor 2A, isoform CRA_c"
FT                   /note="gene_id=mCG2191.2 transcript_id=mCT185139.0
FT                   protein_id=mCP106397.0 isoform=CRA_c"
FT                   /db_xref="GOA:S4R2H4"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="MGI:MGI:99532"
FT                   /db_xref="UniProtKB/TrEMBL:S4R2H4"
FT                   /protein_id="EDL07195.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVECGLGLWKLRVLRTT"
FT   gap             4768555..4768574
FT                   /estimated_length=20
FT   gap             4787838..4788291
FT                   /estimated_length=454
FT   gap             4810689..4810708
FT                   /estimated_length=20
FT   gap             4836523..4837358
FT                   /estimated_length=836
FT   gap             4847908..4848019
FT                   /estimated_length=112
FT   gap             4864284..4864303
FT                   /estimated_length=20
FT   gene            complement(4890368..>4905307)
FT                   /locus_tag="mCG_1028426"
FT                   /note="gene_id=mCG1028426.0"
FT   mRNA            complement(join(4890368..4890542,4890802..4890950,
FT                   4905212..>4905307))
FT                   /locus_tag="mCG_1028426"
FT                   /product="mCG1028426"
FT                   /note="gene_id=mCG1028426.0 transcript_id=mCT146130.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(4890391..4890542,4890802..4890950,
FT                   4905212..>4905306))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028426"
FT                   /product="mCG1028426"
FT                   /note="gene_id=mCG1028426.0 transcript_id=mCT146130.1
FT                   protein_id=mCP88896.1"
FT                   /protein_id="EDL07192.1"
FT                   /translation="EEDDHVPHEPQGSLLLWGASETMPGGPLKMCRFYLLLACESTHMQ
FT                   ICAPGSTVVRIWQAEDNCCEVLNPQYRIQGRGPTSSAGSTGCWTITVLGHLHTLPCHHG
FT                   SRSSPHAIWQSRFSAIGTGCPGSPYYT"
FT   gap             4891341..4891482
FT                   /estimated_length=142
FT   gap             4935414..4935433
FT                   /estimated_length=20
FT   gap             4946691..4947510
FT                   /estimated_length=820
FT   gap             4950809..4950828
FT                   /estimated_length=20
FT   gap             4956114..4956133
FT                   /estimated_length=20
FT   gap             4957955..4957974
FT                   /estimated_length=20
FT   gene            complement(4972143..5104758)
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /note="gene_id=mCG13837.2"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5076492..5076629,5077573..5077610,5100571..5100807,
FT                   5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185127"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185127.0 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT179038"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT179038.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT17542"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT17542.3 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003849,5018250..5018456,
FT                   5076561..5076629,5077573..5077610,5081068..5081094,
FT                   5086795..5086835,5100571..5100807,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185129"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185129.0 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5038101..5038161,5076492..5076629,5077573..5077610,
FT                   5086795..5086835,5100571..5100809,5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174589"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174589.2 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5076492..5076629,5077573..5077610,
FT                   5078451..>5078526))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174587"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174587.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(4972143..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5065600..>5065795))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT174588"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174588.1 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018456,
FT                   5076492..5076629,5077573..5077610,5086795..5086835,
FT                   5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_d"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT17542.3
FT                   protein_id=mCP6643.2 isoform=CRA_d"
FT                   /protein_id="EDL07187.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVC
FT                   PEIGGLRALRHLRLANNQLQFLPPEVGDLKELQTLDISSNRLLALPERLHLCLSLQYLT
FT                   VDRNRLCCVPRHLCQLPSLNELSMAGNHLASLPIDLGRSRELQYVYVDNNIQLKGLPSY
FT                   LYNKVIGCNGCGIPIQLSEVRLLTFSSGQLTVFLPAEVKTIGTEKDHVLPLQELTMRSL
FT                   YRTYHGLWKDLNFLSPISLPRSLLELLHCPLGHCHLCSEPMFTFVYPKIFPLRETPMAG
FT                   LHQRRTSIGFVAYCCSTQCLRTFNLLC"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5076492..>5076514))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_a"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174587.1
FT                   protein_id=mCP97506.1 isoform=CRA_a"
FT                   /protein_id="EDL07184.1"
FT                   /translation="PATVPTSSCGIPIQLSEVRLLTFSSGQLTVFLPAEVKTIGTEKDH
FT                   VLPLQELTMRSLYRTYHGLWKDLNFLSPISLPRSLLELLHCPLGHCHLCSEPMFTFVYP
FT                   KIFPLRETPMAGLHQRRTSIGFVAYCCSTQCLRTFNLLC"
FT   CDS             complement(join(4973837..4973909,4988309..4988468,
FT                   4990339..4990514,5003746..5003848,5018250..5018361,
FT                   5065600..>5065617))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_b"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174588.1
FT                   protein_id=mCP97507.1 isoform=CRA_b"
FT                   /protein_id="EDL07185.1"
FT                   /translation="ALLSKTYLTVDRNRLCCVPRHLCQLPSLNELSMAGNHLASLPIDL
FT                   GRSRELQYVYVDNNIQLKGLPSYLYNKVIGCNGCGIPIQLSEVRLLTFSSGQLTVFLPA
FT                   EVKTIGTEKDHVLPLQELTMRSLYRTYHGLWKDLNFLSPISLPRSLLELLHCPLGHCHL
FT                   CSEPMFTFVYPKIFPLRETPMAGLHQRRTSIGFVAYCCSTQCLRTFNLLC"
FT   CDS             complement(join(5003806..5003849,5018250..5018456,
FT                   5076561..5076629,5077573..5077610,5081068..5081094,
FT                   5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_h"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185129.0
FT                   protein_id=mCP106386.0 isoform=CRA_h"
FT                   /protein_id="EDL07191.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLPENLAQKLPNLVELLGLFSSLGWYLHSNNIVVVPEAIGSLVKLQCLDL
FT                   SDNALEIVCPEVGDLKELQTLDISSNRLLALPERLHLCLSLQYLTVDRNRLCCVPRHLC
FT                   QLPSLNELSMAGNHLASLPIGFRSLPRTAVRVCG"
FT   CDS             complement(join(5018291..5018361,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_e"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT179038.1
FT                   protein_id=mCP101960.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8C1S3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="MGI:MGI:1915689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1S3"
FT                   /protein_id="EDL07188.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVC
FT                   PEIGGLRALRHLRLANNQLQFLPPVPHCGPQSAMLCAAPSLPAAQPQ"
FT   gap             5034598..5034617
FT                   /estimated_length=20
FT   CDS             complement(join(5038154..5038161,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_c"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT174589.2
FT                   protein_id=mCP97508.1 isoform=CRA_c"
FT                   /protein_id="EDL07186.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVC
FT                   PEIGGLRALRHLRLANNQLQFLPPGT"
FT   gap             5044200..5044219
FT                   /estimated_length=20
FT   gap             5045223..5045479
FT                   /estimated_length=257
FT   mRNA            complement(join(5052913..5054245,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100807,
FT                   5104643..5104758))
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, transcript
FT                   variant mCT185128"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185128.0 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(5054166..5054245,5076492..5076629,
FT                   5077573..5077610,5086795..5086835,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_g"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185128.0
FT                   protein_id=mCP106385.0 isoform=CRA_g"
FT                   /db_xref="GOA:Q9D7Y1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:1915689"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D7Y1"
FT                   /protein_id="EDL07190.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVC
FT                   PEIGGLRALRHLRLANNQLQFLPPDFGSETLSTFLTHEDDMATSVPLHVV"
FT   gap             5057372..5057391
FT                   /estimated_length=20
FT   CDS             complement(join(5077593..5077610,5100571..5100738))
FT                   /codon_start=1
FT                   /gene="Lrrc28"
FT                   /locus_tag="mCG_13837"
FT                   /product="leucine rich repeat containing 28, isoform CRA_f"
FT                   /note="gene_id=mCG13837.2 transcript_id=mCT185127.0
FT                   protein_id=mCP106387.0 isoform=CRA_f"
FT                   /protein_id="EDL07189.1"
FT                   /translation="MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLER
FT                   LYMKRNSLTTLVPSLK"
FT   gap             5090719..5090738
FT                   /estimated_length=20
FT   gap             5098182..5098201
FT                   /estimated_length=20
FT   gap             5106808..5106827
FT                   /estimated_length=20
FT   gap             5107969..5107988
FT                   /estimated_length=20
FT   gene            5108626..5224530
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /note="gene_id=mCG13838.3"
FT   mRNA            join(5108626..5109062,5123583..5123782,5131964..5132089,
FT                   5140791..5140968,5159940..5160045,5171030..5171157,
FT                   5173060..5173209,5213303..5213430,5222661..5224530)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT185298"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185298.0 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108658..5109062,5113173..5113221,5129130..5129253,
FT                   5131606..>5131727)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT185296"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185296.0 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108666..5109062,5129130..5129253,5131606..5131757,
FT                   5131964..5132089,5140791..5140968,5159940..5160045,
FT                   5171030..5171157,5173060..5173209,5186867..5186949,
FT                   5187661..5188210)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT17543"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT17543.2 created
FT                   on 15-JUL-2003"
FT   mRNA            join(5108739..5109062,5123583..5123782,5129130..5129253,
FT                   5131606..>5131706)
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, transcript
FT                   variant mCT173114"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT173114.0 created
FT                   on 15-JUL-2003"
FT   gap             5124106..5124125
FT                   /estimated_length=20
FT   gap             5125251..5125936
FT                   /estimated_length=686
FT   CDS             join(5131630..5131757,5131964..5132089,5140791..5140968,
FT                   5159940..5160045,5171030..5171157,5173060..5173209,
FT                   5186867..5186949,5187661..5187775)
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT17543.2
FT                   protein_id=mCP6644.2 isoform=CRA_d"
FT                   /protein_id="EDL07178.1"
FT                   /translation="MQRKPRRSWPTPSRVPVTTKQISSSVPWSFSIPWGRALLSLQKFK
FT                   DASENLIKAERLSKEMLQCGNIVKEEWIEIQSRIKLSFAQLYQGQKRSKEAFPFYQKAL
FT                   EYTEITKDEKSLECVQVLRELAGVEQALGLYAAAISHFSRAHLIILSKDPSPEEAADSA
FT                   HFIARAAAASGMHDHRDVAEKYFQESMTSIKDSEGAERAKFLSIQDEFCSFLQTTGQKE
FT                   RAAMILRESLEAKVGAFGDFSPEVAETYRALGRADLAQGNNSGAYAKLKKCVQIETFLY
FT                   GSQDKKTLATQHTIDTLSKISEAAGKSRQSVKAKVAFCTSAPQYGMPGKGRHSVAD"
FT   CDS             5131630..>5131727
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185296.0
FT                   protein_id=mCP106554.0 isoform=CRA_c"
FT                   /protein_id="EDL07177.1"
FT                   /translation="MQRKPRRSWPTPSRVPVTTKQISSSVPWSFSIP"
FT   CDS             5131630..>5131706
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT173114.0
FT                   protein_id=mCP96033.1 isoform=CRA_b"
FT                   /protein_id="EDL07176.1"
FT                   /translation="MQRKPRRSWPTPSRVPVTTKQISSSV"
FT   CDS             join(5132016..5132089,5140791..5140968,5159940..5160045,
FT                   5171030..5171157,5173060..5173209,5213303..5213371)
FT                   /codon_start=1
FT                   /gene="Ttc23"
FT                   /locus_tag="mCG_13838"
FT                   /product="tetratricopeptide repeat domain 23, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13838.3 transcript_id=mCT185298.0
FT                   protein_id=mCP106555.0 isoform=CRA_a"
FT                   /protein_id="EDL07175.1"
FT                   /translation="MLQCGNIVKEEWIEIQSRIKLSFAQLYQGQKRSKEAFPFYQKALE
FT                   YTEITKDEKSLECVQVLRELAGVEQALGLYAAAISHFSRAHLIILSKDPSPEEAADSAH
FT                   FIARAAAASGMHDHRDVAEKYFQESMTSIKDSEGAERAKFLSIQDEFCSFLQTTGQKER
FT                   AAMILRESLEAKVGAFGDFSPEVAETYRALGRADLAQGNNSGAYAKLKKSHRDSSKATW
FT                   RQTLTCRWLPPS"
FT   gap             5136014..5136132
FT                   /estimated_length=119
FT   gap             5138447..5138963
FT                   /estimated_length=517
FT   gap             5178234..5178504
FT                   /estimated_length=271
FT   gap             5188555..5189007
FT                   /estimated_length=453
FT   gene            complement(5192184..5193207)
FT                   /locus_tag="mCG_147202"
FT                   /note="gene_id=mCG147202.0"
FT   mRNA            complement(5192184..5193207)
FT                   /locus_tag="mCG_147202"
FT                   /product="mCG147202"
FT                   /note="gene_id=mCG147202.0 transcript_id=mCT187465.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5192807..5193130)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147202"
FT                   /product="mCG147202"
FT                   /note="gene_id=mCG147202.0 transcript_id=mCT187465.0
FT                   protein_id=mCP109609.0"
FT                   /db_xref="GOA:Q8BQ62"
FT                   /db_xref="MGI:MGI:2661187"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQ62"
FT                   /protein_id="EDL07183.1"
FT                   /translation="MPSSGRGGAFFPDPCVFHGAYLPSGSSRWAKESTMFFIAKYKRNT
FT                   ERLKMIFSNALHGVQEGSGFEWKAFVTLMPTELRVVSLSQELLRLWLVISYTVRDVRTY
FT                   FFP"
FT   gene            complement(5194101..5221784)
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /note="gene_id=mCG50168.2"
FT   mRNA            complement(join(5194101..5194749,5197432..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221293))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT185583"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT185583.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194102..5198405,5200604..5200674,
FT                   5213347..5213471,5220428..5221784))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT50351"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT50351.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194249..5195052,5195959..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221293))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT176337"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176337.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5194249..5195052,5195959..5198405,
FT                   5200604..5200674,5202034..>5202100))
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, transcript variant mCT176336"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176336.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(5194726..5194749,5197432..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_d"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT185583.0
FT                   protein_id=mCP106841.0 isoform=CRA_d"
FT                   /protein_id="EDL07182.1"
FT                   /translation="MLSWRLQTGSEKAELQELNARLYDYVCRVRELERENLLLEEELRS
FT                   RLSREDRWAEDQALYAEEARSLRQQLDELNWSTALAEGERDALRRELLELQREGVEAGT
FT                   ARSRLDAELGAQRRELEEALGARAALEALLGRLETDPAAPPPRLRDVHDSYALLVAESW
FT                   RESVQLYEDEVRELEQALRRGQESRLQAEDEARLCAQEADALRNQALELEQLRARLEDE
FT                   LLRMREEYGMQAEERQRVIDSLEDEKEALTLAMADRLRDYQELLQVKTGLSLEVATYRA
FT                   LLEGESNPEILIWTENIENVPQEPRNTSYRYTNSVLQRKNEKNLFPRRKTPWAAVNHSS
FT                   ASYSNWPGHLDSQTTTAVGSAARRGLLTSRHSSSATTSGQQKPLEKTISSRANLRPVTP
FT                   THGFLRNTDAQMKTLPHRSKVEGTGDTHARRATESVITRESYRGHQGHVAAGAVSSTPS
FT                   NERTVILGKKLEAQATKEQERDRSGVIRIKPEEKMFDSKEKASEERNLRWEELTKLDRD
FT                   ARKRESRHLRDEAREKEALKERSVKEREVPISLEVSRGSRAEVSTIHLQSPGRKDVSHS
FT                   GGREAETKETRFRLDTQDTASSLQSDSTTETIAESIVTTILKQFTQSPGAEEEEGEGWF
FT                   "
FT   CDS             complement(join(5194726..5195052,5195959..5198405,
FT                   5200604..5200674,5213347..5213471,5220428..5220722,
FT                   5220819..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_c"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176337.1
FT                   protein_id=mCP99259.1 isoform=CRA_c"
FT                   /protein_id="EDL07181.1"
FT                   /translation="MLSWRLQTGSEKAELQELNARLYDYVCRVRELERENLLLEEELRS
FT                   RLSREDRWAEDQALYAEEARSLRQQLDELNWSTALAEGERDALRRELLELQREGVEAGT
FT                   ARSRLDAELGAQRRELEEALGARAALEALLGRLETDPAAPPPRLRDVHDSYALLVAESW
FT                   RESVQLYEDEVRELEQALRRGQESRLQAEDEARLCAQEADALRNQALELEQLRARLEDE
FT                   LLRMREEYGMQAEERQRVIDSLEDEKEALTLAMADRLRDYQELLQVKTGLSLEVATYRA
FT                   LLEGESNPEILIWTENIENVPQEPRNTSYRYTNSVLQRKNEKNLFPRRKTPWAAVNHSS
FT                   ASYSNWPGHLDSQTTTAVGSAARRGLLTSRHSSSATTSGQQKPLEKTISSRANLRPVTP
FT                   THGFLRNTDAQMKTLPHRSKVEGTGDTHARRATESVITRESYRGHQGHVAAGAVSSTPS
FT                   NERTVILGKKLEAQATKEQERDRSGVIRIKPEEKMFDSKEKASEERNLRWEELTKLDRD
FT                   ARKRESRHLRDEAREKEALKERSVKEREVPISLEVSRGSRAEVSTIHLQSPGRKDVSHS
FT                   GGREAETKETRFRLDTQDTASSLQSDSTTETIAESIVTTILKQFTQSPGAEEEATSFPD
FT                   TKVTYVDRKEFPGDGKTKTEIVVESKLTDVVDVSDEAGLDYLLSKDVKEVGLKGKSTET
FT                   MIGEMINLGLKGREGRAKVVNVEIVEEPMSYIGGGKIDFSTPFQVEEVDDVSPSPKGFV
FT                   EEEDGEGETHMAFSMRPHQTKQPQGTIPHVEEVTEAGDSEGEQSYFVSTSDEYPGGHDR
FT                   EDDGSVYGQIHIEEESTIRYSWQDEIAQGTWRRKMRGDVGGEKPVKVLEVPALSLGGAI
FT                   GSAHLKEEASGELRAEPTVIEKEIKIPHEFHTSIKGVFSSEPRHQLVEVIGQLEETLPE
FT                   RMKEELSALTRQSQGESGSVSVDVKKVQSAAGGSVTLMAEVNLSQTVDADQLDLEQLSR
FT                   DEAGEIERAVESVVRESLAKRSSPVPRSPDREDGEEVPAGGILFKRWATRELYSPSGER
FT                   DDAGQVSPSSDQRVTQGPVSATVEVTSPTGFVQSHVLEDVSQSVRHVKLGPTEMWRTEQ
FT                   VTFGGPTAQVVEMDLSDTRAIRSWTRDTGSEVEAHGVSHRGGWRIAHSRDERVASTGSG
FT                   ASPGDAHQAPGEKGTEQAGFDKTVQLQRMVDQRSVASDEKKVALLYLDNEEEEEEEGEG
FT                   WF"
FT   CDS             complement(join(5194726..5198405,5200604..5200674,
FT                   5213347..5213471,5220428..5221237))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_b"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT50351.1
FT                   protein_id=mCP29141.2 isoform=CRA_b"
FT                   /protein_id="EDL07180.1"
FT                   /translation="MLSWRLQTGSEKAELQELNARLYDYVCRVRELERENLLLEEELRS
FT                   RLSREDRWAEDQALYAEEARSLRQQLDELNWSTALAEGERDALRRELLELQREGVEAGT
FT                   ARSRLDAELGAQRRELEEALGARAALEALLGRLETERRDLDAAHERQVRDLRARAASLT
FT                   MHFRARATSPAAPPPRLRDVHDSYALLVAESWRESVQLYEDEVRELEQALRRGQESRLQ
FT                   AEDEARLCAQEADALRNQALELEQLRARLEDELLRMREEYGMQAEERQRVIDSLEDEKE
FT                   ALTLAMADRLRDYQELLQVKTGLSLEVATYRALLEGESNPEILIWTENIENVPQEPRNT
FT                   SYRYTNSVLQRKNEKNLFPRRKTPWAAVNHSSASYSNWPGHLDSQTTTAVGSAARRGLL
FT                   TSRHSSSATTSGQQKPLEKTISSRANLRPVTPTHGFLRNTDAQMKTLPHRSKVEGTGDT
FT                   HARRATESVITRESYRGHQGHVAAGAVSSTPSNERTVILGKKLEAQATKEQERDRSGVI
FT                   RIKPEEKMFDSKEKASEERNLRWEELTKLDRDARKRESRHLRDEAREKEALKERSVKER
FT                   EVPISLEVSRGSRAEVSTIHLQSPGRKDVSHSGGREAETKETRFRLDTQDTASSLQSDS
FT                   TTETIAESIVTTILKQFTQSPGAEEEATSFPDTKVTYVDRKEFPGDGKTKTEIVVESKL
FT                   TDVVDVSDEAGLDYLLSKDVKEVGLKGKSTETMIGEMINLGLKGREGRAKVVNVEIVEE
FT                   PMSYIGGGKIDFSTPFQVEEVDDVSPSPKGFVEEEDGEGETHMAFSMRPHQTKQPQGTI
FT                   PHVEEVTEAGDSEGEQSYFVSTSDEYPGGHDREDDGSVYGQIHIEEESTIRYSWQDEIA
FT                   QGTWRRKMRGDVGGEKPVKVLEVPALSLGGAIGSAHLKEEASGELRAEPTVIEKEIKIP
FT                   HEFHTSIKGVFSSEPRHQLVEVIGQLEETLPERMKEELSALTRQSQGESGSVSVDVKKV
FT                   QSAAGGSVTLMAEVNLSQTVDADQLDLEQLSRDEAGEIERAVESVVRESLAKRSSPVPR
FT                   SPDREDGEEVPAGGILFKRWATRELYSPSGERDDAGQVSPSSDQRVTQGPVSATVEVTS
FT                   PTGFVQSHVLEDVSQSVRHVKLGPTEMWRTEQVTFGGPTAQVVEVSGDFSEAVSSEGAS
FT                   RSVRHITLGPHQSQVSTEVIFRGSVPTWQETGDTEKPGPVVLSVGADISGSGRMPGSER
FT                   SHTEKEIRFQGPVSGTAQVGGNFATEESVGSQTFVRSLQLGPKEGFREEIQFIAPIPDK
FT                   VGWGEEDSEHTKVSLERATSIQRIDIVPQRYLASKQMAPQTLEFRDSEDMVMVEGSAGT
FT                   IQATHNFTSDREILQNKENTFQRVISGSPPDSVGDTGAEVTANVSRSFRHIQIGPTEEE
FT                   PSEYFVTGRPVSKTFVLDGSVASPGLVGGADGGSTPCRIALGPKETSFTFQMDLSDTRA
FT                   IRSWTRDTGSEVEAHGVSHRGGWRIAHSRDERVASTGSGASPGDAHQAPGEKGTEQAGF
FT                   DKTVQLQRMVDQRSVASDEKKVALLYLDNEEEEEEEGEGWF"
FT   CDS             complement(join(5194726..5195052,5195959..5198405,
FT                   5200604..5200674,5202034..>5202098))
FT                   /codon_start=1
FT                   /gene="Dmn"
FT                   /locus_tag="mCG_50168"
FT                   /product="desmuslin, isoform CRA_a"
FT                   /note="gene_id=mCG50168.2 transcript_id=mCT176336.1
FT                   protein_id=mCP99258.1 isoform=CRA_a"
FT                   /protein_id="EDL07179.1"
FT                   /translation="ALVFLSLHTCVFQWLLLWVGHRALLEGESNPEILIWTENIENVPQ
FT                   EPRNTSYRYTNSVLQRKNEKNLFPRRKTPWAAVNHSSASYSNWPGHLDSQTTTAVGSAA
FT                   RRGLLTSRHSSSATTSGQQKPLEKTISSRANLRPVTPTHGFLRNTDAQMKTLPHRSKVE
FT                   GTGDTHARRATESVITRESYRGHQGHVAAGAVSSTPSNERTVILGKKLEAQATKEQERD
FT                   RSGVIRIKPEEKMFDSKEKASEERNLRWEELTKLDRDARKRESRHLRDEAREKEALKER
FT                   SVKEREVPISLEVSRGSRAEVSTIHLQSPGRKDVSHSGGREAETKETRFRLDTQDTASS
FT                   LQSDSTTETIAESIVTTILKQFTQSPGAEEEATSFPDTKVTYVDRKEFPGDGKTKTEIV
FT                   VESKLTDVVDVSDEAGLDYLLSKDVKEVGLKGKSTETMIGEMINLGLKGREGRAKVVNV
FT                   EIVEEPMSYIGGGKIDFSTPFQVEEVDDVSPSPKGFVEEEDGEGETHMAFSMRPHQTKQ
FT                   PQGTIPHVEEVTEAGDSEGEQSYFVSTSDEYPGGHDREDDGSVYGQIHIEEESTIRYSW
FT                   QDEIAQGTWRRKMRGDVGGEKPVKVLEVPALSLGGAIGSAHLKEEASGELRAEPTVIEK
FT                   EIKIPHEFHTSIKGVFSSEPRHQLVEVIGQLEETLPERMKEELSALTRQSQGESGSVSV
FT                   DVKKVQSAAGGSVTLMAEVNLSQTVDADQLDLEQLSRDEAGEIERAVESVVRESLAKRS
FT                   SPVPRSPDREDGEEVPAGGILFKRWATRELYSPSGERDDAGQVSPSSDQRVTQGPVSAT
FT                   VEVTSPTGFVQSHVLEDVSQSVRHVKLGPTEMWRTEQVTFGGPTAQVVEMDLSDTRAIR
FT                   SWTRDTGSEVEAHGVSHRGGWRIAHSRDERVASTGSGASPGDAHQAPGEKGTEQAGFDK
FT                   TVQLQRMVDQRSVASDEKKVALLYLDNEEEEEEEGEGWF"
FT   gap             5235064..5235169
FT                   /estimated_length=106
FT   gap             5239832..5239851
FT                   /estimated_length=20
FT   gene            complement(5245405..5246400)
FT                   /pseudo
FT                   /locus_tag="mCG_13844"
FT                   /note="gene_id=mCG13844.1"
FT   mRNA            complement(5245405..5246400)
FT                   /pseudo
FT                   /locus_tag="mCG_13844"
FT                   /note="gene_id=mCG13844.1 transcript_id=mCT17548.1 created
FT                   on 20-NOV-2002"
FT   gene            complement(5247348..>5265892)
FT                   /locus_tag="mCG_49110"
FT                   /note="gene_id=mCG49110.2"
FT   mRNA            complement(join(5247348..5247915,5249022..5249217,
FT                   5265760..>5265892))
FT                   /locus_tag="mCG_49110"
FT                   /product="mCG49110"
FT                   /note="gene_id=mCG49110.2 transcript_id=mCT49293.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(5247452..>5247700)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49110"
FT                   /product="mCG49110"
FT                   /note="gene_id=mCG49110.2 transcript_id=mCT49293.2
FT                   protein_id=mCP29136.2"
FT                   /protein_id="EDL07174.1"
FT                   /translation="GQPSLQREFQNSQEYIMKPCVKTQPTNSVGLEWLLYVLASWSTNL
FT                   LCQCHVAFHAIPSAWSRVLASGTTVLHQCFSEIKCCS"
FT   gap             5250933..5250952
FT                   /estimated_length=20
FT   gap             5254200..5254522
FT                   /estimated_length=323
FT   gap             5266521..5266683
FT                   /estimated_length=163
FT   gap             5272233..5272252
FT                   /estimated_length=20
FT   gap             5274139..5274600
FT                   /estimated_length=462
FT   gap             5276716..5277654
FT                   /estimated_length=939
FT   gap             5279000..5279019
FT                   /estimated_length=20
FT   gap             5285598..5285617
FT                   /estimated_length=20
FT   gap             5316000..5316136
FT                   /estimated_length=137
FT   gap             5331668..5331850
FT                   /estimated_length=183
FT   gap             5344371..5344495
FT                   /estimated_length=125
FT   gene            complement(5349176..5349619)
FT                   /pseudo
FT                   /locus_tag="mCG_53844"
FT                   /note="gene_id=mCG53844.2"
FT   mRNA            complement(5349176..5349619)
FT                   /pseudo
FT                   /locus_tag="mCG_53844"
FT                   /note="gene_id=mCG53844.2 transcript_id=mCT54027.2 created
FT                   on 20-NOV-2002"
FT   gap             5371815..5371834
FT                   /estimated_length=20
FT   gap             5383242..5383261
FT                   /estimated_length=20
FT   gap             5414150..5414509
FT                   /estimated_length=360
FT   gene            5415317..>5482953
FT                   /locus_tag="mCG_13841"
FT                   /note="gene_id=mCG13841.2"
FT   mRNA            join(5415317..5415894,5467075..5467620,5482754..>5482953)
FT                   /locus_tag="mCG_13841"
FT                   /product="mCG13841"
FT                   /note="gene_id=mCG13841.2 transcript_id=mCT17546.1 created
FT                   on 20-NOV-2002"
FT   CDS             join(5415801..5415894,5467075..5467620,5482754..5482953)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13841"
FT                   /product="mCG13841"
FT                   /note="gene_id=mCG13841.2 transcript_id=mCT17546.1
FT                   protein_id=mCP6636.1"
FT                   /protein_id="EDL07173.1"
FT                   /translation="MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQ
FT                   LKRLENCTVIEGFLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLT
FT                   VIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDA
FT                   VSNNYIVGNKPPKECGDLCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKNLVIQGRVA
FT                   IGTVEKAAPGVEFSDRVCVPQHFLGNSFMCPLHPQKSHRKPERTLARIEPPPVYQRT"
FT   gap             5416971..5417008
FT                   /estimated_length=38
FT   gap             5441929..5442042
FT                   /estimated_length=114
FT   gap             5451550..5451569
FT                   /estimated_length=20
FT   gap             5453815..5453834
FT                   /estimated_length=20
FT   gap             5458222..5458635
FT                   /estimated_length=414
FT   gap             5460149..5460168
FT                   /estimated_length=20
FT   gap             5462820..5462839
FT                   /estimated_length=20
FT   gap             5471124..5471463
FT                   /estimated_length=340
FT   gap             5491116..5491295
FT                   /estimated_length=180
FT   gap             5499364..5499383
FT                   /estimated_length=20
FT   gap             5513529..5513789
FT                   /estimated_length=261
FT   gap             5523062..5523091
FT                   /estimated_length=30
FT   gap             5528545..5528913
FT                   /estimated_length=369
FT   gap             5547690..5547729
FT                   /estimated_length=40
FT   gap             5561867..5561886
FT                   /estimated_length=20
FT   gap             5569720..5570258
FT                   /estimated_length=539
FT   gap             5592283..5592425
FT                   /estimated_length=143
FT   gene            5628420..5692340
FT                   /locus_tag="mCG_13842"
FT                   /note="gene_id=mCG13842.2"
FT   mRNA            join(5628420..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653877..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5673195..5673287,5676276..5676438,5679201..5679330,
FT                   5682692..5682826,5690310..5692340)
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, transcript variant mCT176334"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT176334.0 created
FT                   on 20-NOV-2002"
FT   mRNA            join(5628421..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653895..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5676276..5676438,5679201..5679330,5682692..5682826,
FT                   5690310..5692340)
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, transcript variant mCT17549"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT17549.2 created
FT                   on 20-NOV-2002"
FT   CDS             join(5628697..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653877..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5673195..5673287,5676276..5676438,5679201..5679330,
FT                   5682692..5682826,5690310..5690703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, isoform CRA_b"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT176334.0
FT                   protein_id=mCP99256.0 isoform=CRA_b"
FT                   /protein_id="EDL07172.1"
FT                   /translation="MQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSA
FT                   QMLQGCTILKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLR
FT                   LILGEEQLEGNYSFYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEV
FT                   TGTKGRQSKGDINTRNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFT
FT                   VYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKA
FT                   VTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLS
FT                   YYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCA
FT                   CPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVA
FT                   DTYNITDPEEFETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASN
FT                   FVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRE
FT                   CVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLI
FT                   IALPVAILLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAR
FT                   EKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMK
FT                   EFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEVEPRLSWNSLRRPGWPR
FT                   TLRDSLASVSQVLALKQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNC
FT                   MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
FT                   VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
FT                   LEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELEMEPENMESVPLDPSASSASL
FT                   PLPERHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC"
FT   CDS             join(5628697..5628740,5633332..5633483,5637521..5637665,
FT                   5647648..5647862,5649035..5649161,5651294..5651532,
FT                   5653895..5654044,5654250..5654454,5657651..5657934,
FT                   5659274..5659410,5659895..5660054,5665549..5665651,
FT                   5666207..5666277,5671536..5671765,5672049..5672159,
FT                   5676276..5676438,5679201..5679330,5682692..5682826,
FT                   5690310..5690703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13842"
FT                   /product="mCG13842, isoform CRA_a"
FT                   /note="gene_id=mCG13842.2 transcript_id=mCT17549.2
FT                   protein_id=mCP6638.2 isoform=CRA_a"
FT                   /protein_id="EDL07171.1"
FT                   /translation="MQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSA
FT                   QMLQGCTILKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLR
FT                   LILGEEQLEGNYSFYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEV
FT                   TGTKGRQSKGDINTRNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFT
FT                   VYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKA
FT                   VTLTMVENDHIRGAKSEILYIRTNASDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRW
FT                   QRQPQDGYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEA
FT                   EKQAEKEEAEYRKVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNIT
FT                   DPEEFETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFART
FT                   MPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQE
FT                   YRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVA
FT                   ILLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMN
FT                   RELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHH
FT                   VVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEI
FT                   ADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRW
FT                   MSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNC
FT                   PDMLFELMRMCWQYNPKMRPSFLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEME
FT                   LEMEPENMESVPLDPSASSASLPLPERHSGHKAENGPGPGVLVLRASFDERQPYAHMNG
FT                   GRANERALPLPQSSTC"
FT   gap             5636827..5636846
FT                   /estimated_length=20
FT   gap             5700658..5700750
FT                   /estimated_length=93
FT   gene            complement(5700752..>5728710)
FT                   /locus_tag="mCG_13840"
FT                   /note="gene_id=mCG13840.1"
FT   mRNA            complement(join(5700752..5701191,5701711..5701937,
FT                   5703141..5703263,5728619..>5728710))
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, transcript variant mCT17545"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT17545.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5701008..5701191,5701711..5701937,
FT                   5703141..5703263,5728619..>5728621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, isoform CRA_b"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT17545.1
FT                   protein_id=mCP6635.0 isoform=CRA_b"
FT                   /protein_id="EDL07170.1"
FT                   /translation="PELSKLGLGVDTDIELRTLQLPVDYREVKRRLTTIWEDFQPQLVV
FT                   HVGMDSSAKAIFLEQCGKNRGYRDSDVRGFQPEDGVCLPGGPEVRLSVVNMKEVCRRVA
FT                   VENVEVAFSRDAGRYICDYTYYLSLHLGTGHAALIHVPPLSHWLSASLLGKALRVIIQE
FT                   MLEEIGKVQTQSTAA"
FT   mRNA            complement(join(<5701770..5701937,5703141..5703263,
FT                   5713610..>5713773))
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, transcript variant mCT174590"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT174590.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(<5701770..5701937,5703141..5703263,
FT                   5713610..>5713621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13840"
FT                   /product="mCG13840, isoform CRA_a"
FT                   /note="gene_id=mCG13840.1 transcript_id=mCT174590.0
FT                   protein_id=mCP97509.0 isoform=CRA_a"
FT                   /protein_id="EDL07169.1"
FT                   /translation="TSETELSKLGLGVDTDIELRTLQLPVDYREVKRRLTTIWEDFQPQ
FT                   LVVHVGMDSSAKAIFLEQCGKNRGYRDSDVRGFQPEDGVCLPGGPEVRLSVVNMKE"
FT   gap             5706605..5706924
FT                   /estimated_length=320
FT   gap             5708097..5708145
FT                   /estimated_length=49
FT   gap             5716735..5716754
FT                   /estimated_length=20
FT   gene            complement(5731375..>5741063)
FT                   /locus_tag="mCG_1028421"
FT                   /note="gene_id=mCG1028421.0"
FT   mRNA            complement(join(5731375..5731575,5734585..5734691,
FT                   5739626..5739805,5740986..>5741063))
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, transcript variant mCT146125"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT146125.0
FT                   created on 20-NOV-2002"
FT   mRNA            complement(join(5731375..5731575,5734585..5734691,
FT                   5739374..>5739474))
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, transcript variant mCT176329"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT176329.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(5731384..5731575,5734585..>5734638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, isoform CRA_b"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT176329.0
FT                   protein_id=mCP99251.0 isoform=CRA_b"
FT                   /protein_id="EDL07168.1"
FT                   /translation="WNQMPSAAVSEDCTHIYKEFDQFDEISLMSTLQLSVPYQKLFASK
FT                   TINSPCDPFSCLSRKSPLNRKEFKTNPTKFRVWYKM"
FT   CDS             complement(join(5734607..5734691,5739626..5739805,
FT                   5740986..>5741005))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028421"
FT                   /product="mCG1028421, isoform CRA_a"
FT                   /note="gene_id=mCG1028421.0 transcript_id=mCT146125.0
FT                   protein_id=mCP88650.0 isoform=CRA_a"
FT                   /protein_id="EDL07167.1"
FT                   /translation="NWAGRGMASRNLFCRFQSPNSLLETVMCLRFTKKPSRSSFDKAIF
FT                   KVDNSSPVYTAVSKRCFGRMQRGPEFNSHQPHGGSQPSVMESDAFCRCV"
FT   gene            5738296..5827249
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /note="gene_id=mCG13843.2"
FT   mRNA            join(5738296..5738348,5765127..5765257,5768932..5769031,
FT                   5786195..5786280,5793609..5793786,5814613..5814795,
FT                   5817989..5818123,5822600..5822703,5825402..5827249)
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /product="hypothetical protein LOC434197"
FT                   /note="gene_id=mCG13843.2 transcript_id=mCT17547.2 created
FT                   on 27-MAY-2003"
FT   CDS             join(5738333..5738348,5765127..5765257,5768932..5769031,
FT                   5786195..5786280,5793609..5793786,5814613..5814795,
FT                   5817989..5818123,5822600..5822703,5825402..5825482)
FT                   /codon_start=1
FT                   /gene="LOC434197"
FT                   /locus_tag="mCG_13843"
FT                   /product="hypothetical protein LOC434197"
FT                   /note="gene_id=mCG13843.2 transcript_id=mCT17547.2
FT                   protein_id=mCP6640.2"
FT                   /protein_id="EDL07165.1"
FT                   /translation="MAVYKEAYPVDILEDDAEGYQAAAEAYYEMLREGAQTSAEVISLS
FT                   TGEQVRLETSSLCFCTIYRDEPQHKILGLVNPQDTKTVVAVYLKESWWSIEDILRTSDP
FT                   TREGLMKVQSFGERIVLFVLNVIVFGRLERRLHIDDMFFLPHPAKEQAKILWKDGAAVA
FT                   FYSVKMKGSLCGDGTGTCYLLPVLDTVFVRRKNRCQGLGTAMLRDFCDTFQGDEALGIS
FT                   CPISPAMYRVLRQFLLTCPGERGRLWEVEPPGAWGQQRVNIWLKVYLQERRLQDGSTVH
FT                   PKCSEEDTDTPGQASQEDGPTQFNHGESHKEWAVGEPERTQNGRRCAQVCEEARQV"
FT   gap             5754066..5754085
FT                   /estimated_length=20
FT   gap             5768414..5768517
FT                   /estimated_length=104
FT   gap             5791792..5791811
FT                   /estimated_length=20
FT   gap             5818887..5818906
FT                   /estimated_length=20
FT   gene            complement(5825863..>5827241)
FT                   /locus_tag="mCG_1028420"
FT                   /note="gene_id=mCG1028420.0"
FT   mRNA            complement(join(5825863..5826192,5826334..5826731,
FT                   5826961..>5827241))
FT                   /locus_tag="mCG_1028420"
FT                   /product="mCG1028420"
FT                   /note="gene_id=mCG1028420.0 transcript_id=mCT146124.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(5826187..5826192,5826334..>5826624))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028420"
FT                   /product="mCG1028420"
FT                   /note="gene_id=mCG1028420.0 transcript_id=mCT146124.1
FT                   protein_id=mCP88636.1"
FT                   /protein_id="EDL07166.1"
FT                   /translation="KNFFNWGWLTGSEVQSIIIKVGAWQHPGRHGAGRAESSTSSSEGC
FT                   YQNTRFQAARMRVLKPDTHSDTPTPTGPHLLKVPFPGPSIYKQSQRVCVCVCK"
FT   gap             5828105..5828205
FT                   /estimated_length=101
FT   gap             5834168..5834316
FT                   /estimated_length=149
FT   gap             5839169..5839312
FT                   /estimated_length=144
FT   gap             5847674..5847693
FT                   /estimated_length=20
FT   gap             5862449..5862468
FT                   /estimated_length=20
FT   gene            <5881729..5890438
FT                   /locus_tag="mCG_13839"
FT                   /note="gene_id=mCG13839.1"
FT   mRNA            join(<5881729..5881835,5888898..5890038,5890154..5890438)
FT                   /locus_tag="mCG_13839"
FT                   /product="mCG13839"
FT                   /note="gene_id=mCG13839.1 transcript_id=mCT17544.1 created
FT                   on 20-NOV-2002"
FT   CDS             <5889171..5889674
FT                   /codon_start=1
FT                   /locus_tag="mCG_13839"
FT                   /product="mCG13839"
FT                   /note="gene_id=mCG13839.1 transcript_id=mCT17544.1
FT                   protein_id=mCP6645.1"
FT                   /protein_id="EDL07164.1"
FT                   /translation="LKCTQIARRWLSIFGHFQSYNEEQQRATHRELLFLPPSHPLLSPS
FT                   PSTYTCSQFLYLMEAPGLHIAIHSLCLPINAFLLCIYVPVFTFSRFLKATDQFDLRTTL
FT                   HDLILLYIAEMIHCPGKFPFPGSGSGSLPANCIWRRTGEVTTGYVSVGVLSESHWSHLL
FT                   KGCK"
FT   gap             5901031..5901070
FT                   /estimated_length=40
FT   gap             5944089..5944108
FT                   /estimated_length=20
FT   gap             5959982..5960127
FT                   /estimated_length=146
FT   gap             5965193..5965212
FT                   /estimated_length=20
FT   gap             5974016..5974035
FT                   /estimated_length=20
FT   gap             5976774..5976793
FT                   /estimated_length=20
FT   gap             6005447..6005466
FT                   /estimated_length=20
FT   gap             6036483..6036812
FT                   /estimated_length=330
FT   gene            <6083274..>6084020
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /note="gene_id=mCG63318.2"
FT   mRNA            <6083274..>6084020
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /product="similar to Transmembrane 4 superfamily member 2
FT                   (Cell surface glycoprotein A15) (PE31) (TALLA homolog)"
FT                   /note="gene_id=mCG63318.2 transcript_id=mCT63501.2 created
FT                   on 20-NOV-2002"
FT   CDS             6083274..6084020
FT                   /codon_start=1
FT                   /gene="LOC384639"
FT                   /locus_tag="mCG_63318"
FT                   /product="similar to Transmembrane 4 superfamily member 2
FT                   (Cell surface glycoprotein A15) (PE31) (TALLA homolog)"
FT                   /note="gene_id=mCG63318.2 transcript_id=mCT63501.2
FT                   protein_id=mCP29146.2"
FT                   /protein_id="EDL07163.1"
FT                   /translation="METKFVVSCLKIFLLIYCFGFWSTGVILLVFGVWGQLTLGVYLSL
FT                   LAIDVPTVLIGTGIVIIIFGLFGCFSTCRGSPRMLKLYSLFLSLVFLAELAASISGVLL
FT                   HREIKNRFLKIYTNAVRNYNSNDRKSQAVDQVQYSLMCCGVKNYTDWNDNPYFLNHGIP
FT                   PSCCKDEADCSLQDRQNLTAVATKVNQRGCYVLMVGFLEANMVIIIGVLFTVTFSQLIG
FT                   VRLSCCLSRLIMTQHYETVCKVYQEK"
FT   gap             6111177..6112515
FT                   /estimated_length=1339
FT   gap             6117057..6117386
FT                   /estimated_length=330
FT   gap             6167343..6167362
FT                   /estimated_length=20
FT   gene            complement(6183210..>6186271)
FT                   /locus_tag="mCG_1028418"
FT                   /note="gene_id=mCG1028418.1"
FT   mRNA            complement(join(6183210..6183742,6186182..>6186271))
FT                   /locus_tag="mCG_1028418"
FT                   /product="mCG1028418"
FT                   /note="gene_id=mCG1028418.1 transcript_id=mCT146122.1
FT                   created on 28-MAY-2003"
FT   CDS             complement(join(6183616..6183742,6186182..>6186270))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028418"
FT                   /product="mCG1028418"
FT                   /note="gene_id=mCG1028418.1 transcript_id=mCT146122.1
FT                   protein_id=mCP88623.1"
FT                   /protein_id="EDL07162.1"
FT                   /translation="ARSSEFLNKYANRRDSWKLHESCNPDLPMMSTKLHLHENLTQTET
FT                   LPEFLLAGFGETTSRGCQALSQKVPL"
FT   gap             6189920..6190222
FT                   /estimated_length=303
FT   gene            complement(6201128..6214046)
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /note="gene_id=mCG11874.2"
FT   mRNA            complement(join(6201128..6203666,6204018..6204172,
FT                   6205088..6205250,6205778..6206034,6206705..6206807,
FT                   6208915..6209062,6209278..6209344,6213615..6214046))
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /product="arrestin domain containing 4"
FT                   /note="gene_id=mCG11874.2 transcript_id=mCT12159.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(6203610..6203666,6204018..6204172,
FT                   6205088..6205250,6205778..6206034,6206705..6206807,
FT                   6208915..6209062,6209278..6209344,6213615..6213912))
FT                   /codon_start=1
FT                   /gene="Arrdc4"
FT                   /locus_tag="mCG_11874"
FT                   /product="arrestin domain containing 4"
FT                   /note="gene_id=mCG11874.2 transcript_id=mCT12159.2
FT                   protein_id=mCP6634.2"
FT                   /protein_id="EDL07161.1"
FT                   /translation="MGGEAGADGPRGRVKSLGLVFEDESKGCYSSGETVAGHVLLEAAE
FT                   PVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASSEVEYLNLRLSLLEAPAGEGVT
FT                   LLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVLERPQVPDQSVRRELQVVSHV
FT                   DVNTPPLLTPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNGEAIPIYAEIENCSSRL
FT                   VVPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGKMLKIPPVTPSILDC
FT                   CIIRVDYSLAVYIHIPGAKRLMLELPLVIGTIPYSGFGRRNSSVASQFSMDMCWLALAL
FT                   PEQPEAPPNYADVVSEEEFSRHVPPYPQPSDCDGEACYSMFACIQEFRFQPPPLYSEVD
FT                   PHPGDAQETQPVSFIL"
FT   gap             6209851..6210705
FT                   /estimated_length=855
FT   gap             6212651..6212670
FT                   /estimated_length=20
FT   gap             6251506..6251959
FT                   /estimated_length=454
FT   gap             6253041..6253060
FT                   /estimated_length=20
FT   gap             6264018..6264231
FT                   /estimated_length=214
FT   gap             6270228..6270339
FT                   /estimated_length=112
FT   gap             6286833..6286852
FT                   /estimated_length=20
FT   gap             6293910..6293929
FT                   /estimated_length=20
FT   gap             6300335..6300401
FT                   /estimated_length=67
FT   gap             6347380..6347508
FT                   /estimated_length=129
FT   gap             6352963..6353116
FT                   /estimated_length=154
FT   gap             6354407..6354426
FT                   /estimated_length=20
FT   gap             6389463..6389537
FT                   /estimated_length=75
FT   gap             6400702..6400721
FT                   /estimated_length=20
FT   gap             6415338..6415638
FT                   /estimated_length=301
FT   gap             6417283..6417457
FT                   /estimated_length=175
FT   gap             6431970..6431989
FT                   /estimated_length=20
FT   gap             6433038..6433057
FT                   /estimated_length=20
FT   gap             6434344..6434363
FT                   /estimated_length=20
FT   gap             6437671..6437892
FT                   /estimated_length=222
FT   gap             6481772..6482203
FT                   /estimated_length=432
FT   gap             6483507..6483964
FT                   /estimated_length=458
FT   gap             6485745..6485874
FT                   /estimated_length=130
FT   gap             6489946..6490087
FT                   /estimated_length=142
FT   gap             6525310..6525329
FT                   /estimated_length=20
FT   gap             6561653..6561672
FT                   /estimated_length=20
FT   gap             6572843..6573038
FT                   /estimated_length=196
FT   gap             6590699..6591172
FT                   /estimated_length=474
FT   gap             6617752..6618186
FT                   /estimated_length=435
FT   gap             6625281..6625300
FT                   /estimated_length=20
FT   gap             6634278..6634477
FT                   /estimated_length=200
FT   gene            6669011..6670035
FT                   /pseudo
FT                   /locus_tag="mCG_11875"
FT                   /note="gene_id=mCG11875.0"
FT   mRNA            6669011..6670035
FT                   /pseudo
FT                   /locus_tag="mCG_11875"
FT                   /note="gene_id=mCG11875.0 transcript_id=mCT12160.1 created
FT                   on 19-NOV-2002"
FT   gap             6676053..6676652
FT                   /estimated_length=600
FT   gap             6681570..6681589
FT                   /estimated_length=20
FT   gap             6682839..6682858
FT                   /estimated_length=20
FT   gap             6688148..6688167
FT                   /estimated_length=20
FT   gap             6689863..6689882
FT                   /estimated_length=20
FT   gap             6728345..6728364
FT                   /estimated_length=20
FT   gap             6746457..6746729
FT                   /estimated_length=273
FT   gap             6756683..6756740
FT                   /estimated_length=58
FT   gap             6776857..6776876
FT                   /estimated_length=20
FT   gap             6782466..6782606
FT                   /estimated_length=141
FT   gap             6803860..6803879
FT                   /estimated_length=20
FT   gap             6805379..6805417
FT                   /estimated_length=39
FT   gap             6809781..6809800
FT                   /estimated_length=20
FT   gap             6825783..6825984
FT                   /estimated_length=202
FT   gap             6836674..6836693
FT                   /estimated_length=20
FT   gap             6846155..6846174
FT                   /estimated_length=20
FT   gap             6861575..6861594
FT                   /estimated_length=20
FT   gap             6897767..6897786
FT                   /estimated_length=20
FT   gap             6912831..6912850
FT                   /estimated_length=20
FT   gap             6923568..6923587
FT                   /estimated_length=20
FT   gap             6924949..6924968
FT                   /estimated_length=20
FT   gap             6947606..6947625
FT                   /estimated_length=20
FT   gene            <6954544..6958284
FT                   /locus_tag="mCG_144577"
FT                   /note="gene_id=mCG144577.0"
FT   mRNA            join(<6954544..6954617,6955114..6955178,6957422..6958284)
FT                   /locus_tag="mCG_144577"
FT                   /product="mCG144577"
FT                   /note="gene_id=mCG144577.0 transcript_id=mCT184001.0
FT                   created on 05-JUN-2003"
FT   gap             6956791..6956810
FT                   /estimated_length=20
FT   CDS             <6957781..6957963
FT                   /codon_start=1
FT                   /locus_tag="mCG_144577"
FT                   /product="mCG144577"
FT                   /note="gene_id=mCG144577.0 transcript_id=mCT184001.0
FT                   protein_id=mCP106147.0"
FT                   /protein_id="EDL07160.1"
FT                   /translation="DLVRYKNVTCILFLHSELCFFLFMLLLLLLSLLESPKKCSKWKLY
FT                   PAPLKKLSLPQRLLS"
FT   gap             6986354..6986394
FT                   /estimated_length=41
FT   gap             6993960..6994055
FT                   /estimated_length=96
FT   gap             7020878..7021083
FT                   /estimated_length=206
FT   gap             7022341..7022569
FT                   /estimated_length=229
FT   gap             7064429..7064448
FT                   /estimated_length=20
FT   gene            complement(7064563..>7065577)
FT                   /locus_tag="mCG_7742"
FT                   /note="gene_id=mCG7742.2"
FT   mRNA            complement(7064563..>7065577)
FT                   /locus_tag="mCG_7742"
FT                   /product="mCG7742"
FT                   /note="gene_id=mCG7742.2 transcript_id=mCT6768.2 created on
FT                   19-NOV-2002"
FT   CDS             complement(7064685..>7065290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7742"
FT                   /product="mCG7742"
FT                   /note="gene_id=mCG7742.2 transcript_id=mCT6768.2
FT                   protein_id=mCP6642.1"
FT                   /protein_id="EDL07159.1"
FT                   /translation="DPANIKWGDAGAEYIVESTDIFTTTEKTRGPLKGRTKMVICIPSA
FT                   NAPMFVMSMNHKKYDNSFKIVSNASCTTNCLDTLAKVIQDNCGIIEGLMTMIHAITATQ
FT                   KIVDGPSRKLWYGVCGAAKNIPASTGASKAVGKVIPQLNRKLTGMAFHVPTTIVSVVDL
FT                   TCCLVKPAKYDNIKRVVKQASEGPLKGILGYTEDQVVS"
FT   gap             7091845..7091864
FT                   /estimated_length=20
FT   gap             7096813..7097285
FT                   /estimated_length=473
FT   gap             7115782..7116684
FT                   /estimated_length=903
FT   gap             7140505..7140831
FT                   /estimated_length=327
FT   gap             7142122..7142284
FT                   /estimated_length=163
FT   gap             7159704..7159749
FT                   /estimated_length=46
FT   gap             7167393..7167412
FT                   /estimated_length=20
FT   gap             7171762..7171783
FT                   /estimated_length=22
FT   gap             7217289..7218021
FT                   /estimated_length=733
FT   gap             7252296..7252329
FT                   /estimated_length=34
FT   gap             7260223..7260242
FT                   /estimated_length=20
FT   gap             7286181..7286594
FT                   /estimated_length=414
FT   gap             7323962..7323981
FT                   /estimated_length=20
FT   gap             7351626..7351654
FT                   /estimated_length=29
FT   gap             7378970..7379298
FT                   /estimated_length=329
FT   gap             7464153..7464338
FT                   /estimated_length=186
FT   gap             7478524..7478734
FT                   /estimated_length=211
FT   gap             7483890..7484122
FT                   /estimated_length=233
FT   gap             7508607..7508626
FT                   /estimated_length=20
FT   gap             7535979..7536109
FT                   /estimated_length=131
FT   gap             7544614..7544633
FT                   /estimated_length=20
FT   gap             7586460..7586790
FT                   /estimated_length=331
FT   gap             7588418..7588437
FT                   /estimated_length=20
FT   gap             7623786..7623887
FT                   /estimated_length=102
FT   gap             7626260..7626404
FT                   /estimated_length=145
FT   gap             7659130..7662075
FT                   /estimated_length=2946
FT   gap             7668028..7668178
FT                   /estimated_length=151
FT   gap             7671058..7671077
FT                   /estimated_length=20
FT   gap             7706370..7706472
FT                   /estimated_length=103
FT   gap             7712694..7712713
FT                   /estimated_length=20
FT   gap             7714838..7714857
FT                   /estimated_length=20
FT   gene            complement(7736271..7800856)
FT                   /locus_tag="mCG_141100"
FT                   /note="gene_id=mCG141100.0"
FT   mRNA            complement(join(7736271..7736507,7747598..7747758,
FT                   7748114..7748229,7800720..7800856))
FT                   /locus_tag="mCG_141100"
FT                   /product="mCG141100"
FT                   /note="gene_id=mCG141100.0 transcript_id=mCT173106.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(7736423..7736507,7747598..7747734))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141100"
FT                   /product="mCG141100"
FT                   /note="gene_id=mCG141100.0 transcript_id=mCT173106.0
FT                   protein_id=mCP96025.0"
FT                   /protein_id="EDL07158.1"
FT                   /translation="MTCGLLKSNWLTFNPGCIAQTPLPVHLYPGRITGYMSHKEEMTKQ
FT                   RMRNNIPMEGVTETKFGAETEGMAIQRL"
FT   gap             7737728..7737747
FT                   /estimated_length=20
FT   gap             7745541..7745560
FT                   /estimated_length=20
FT   gap             7750086..7750129
FT                   /estimated_length=44
FT   gap             7758569..7759016
FT                   /estimated_length=448
FT   gap             7797384..7797403
FT                   /estimated_length=20
FT   gap             7797737..7797855
FT                   /estimated_length=119
FT   gene            <7814969..7815414
FT                   /locus_tag="mCG_1028256"
FT                   /note="gene_id=mCG1028256.0"
FT   mRNA            join(<7814969..7815176,7815228..7815414)
FT                   /locus_tag="mCG_1028256"
FT                   /product="mCG1028256"
FT                   /note="gene_id=mCG1028256.0 transcript_id=mCT145960.0
FT                   created on 12-SEP-2002"
FT   CDS             join(<7814996..7815176,7815228..7815229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028256"
FT                   /product="mCG1028256"
FT                   /note="gene_id=mCG1028256.0 transcript_id=mCT145960.0
FT                   protein_id=mCP88735.0"
FT                   /protein_id="EDL07157.1"
FT                   /translation="FNANNNLQQMAVYNKLTQSKQGKGPVFYLVEKLHTLTWVALARGE
FT                   NKQPTKPPSTGQMLC"
FT   gene            complement(7816453..7828847)
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /note="gene_id=mCG9458.2"
FT   mRNA            complement(join(7816453..7817943,7820775..7821304,
FT                   7824095..7824122))
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   transcript variant mCT8980"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT8980.2 created on
FT                   12-SEP-2002"
FT   mRNA            complement(join(7817359..7817943,7820775..7821302,
FT                   7828814..7828847))
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   transcript variant mCT173135"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT173135.0 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(7817669..7817943,7820775..7821285))
FT                   /codon_start=1
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT173135.0
FT                   protein_id=mCP96054.0 isoform=CRA_a"
FT                   /protein_id="EDL07155.1"
FT                   /translation="MPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGS
FT                   QCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNA
FT                   AQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLK
FT                   AIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSS
FT                   SVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ"
FT   CDS             complement(join(7817669..7817943,7820775..7821285))
FT                   /codon_start=1
FT                   /gene="Nr2f2"
FT                   /locus_tag="mCG_9458"
FT                   /product="nuclear receptor subfamily 2, group F, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9458.2 transcript_id=mCT8980.2
FT                   protein_id=mCP7348.2 isoform=CRA_a"
FT                   /protein_id="EDL07156.1"
FT                   /translation="MPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGS
FT                   QCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNA
FT                   AQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLK
FT                   AIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSS
FT                   SVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ"
FT   gap             7822523..7823916
FT                   /estimated_length=1394
FT   gene            <7828106..7873756
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /note="gene_id=mCG145717.0"
FT   mRNA            join(<7828106..7828212,7849170..7849225,7850853..7851005,
FT                   7851250..7851431,7852743..7852871,7861880..7862018,
FT                   7864711..7864806,7865043..7865164,7866866..7867002,
FT                   7869219..7869349,7873201..7873756)
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, transcript variant
FT                   mCT185289"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185289.0
FT                   created on 11-JUN-2003"
FT   mRNA            join(<7828106..7828212,7849170..7849225,7850853..7851005,
FT                   7851250..7851431,7852743..7852871,7861880..7862018,
FT                   7864711..7864806,7865038..7865137)
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, transcript variant
FT                   mCT185290"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185290.0
FT                   created on 11-JUN-2003"
FT   gap             7842460..7842483
FT                   /estimated_length=24
FT   gap             7847427..7847452
FT                   /estimated_length=26
FT   CDS             join(<7849182..7849225,7850853..7851005,7851250..7851388)
FT                   /codon_start=1
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, isoform CRA_a"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185289.0
FT                   protein_id=mCP106548.0 isoform=CRA_a"
FT                   /protein_id="EDL07153.1"
FT                   /translation="PRGDREVITMQTVPRFCNNQEHVDTYLWEEAWGKHCFWLLLKPAF
FT                   WRWTAAQGNEGRFCKLQILSRTRTVASLSWPAFPEYLKRSLETNKILRTSGTVTDSVLL
FT                   LALNSPS"
FT   CDS             join(<7849182..7849225,7850853..7851005,7851250..7851388)
FT                   /codon_start=1
FT                   /gene="B130024G19Rik"
FT                   /locus_tag="mCG_145717"
FT                   /product="RIKEN cDNA B130024G19, isoform CRA_a"
FT                   /note="gene_id=mCG145717.0 transcript_id=mCT185290.0
FT                   protein_id=mCP106547.0 isoform=CRA_a"
FT                   /protein_id="EDL07154.1"
FT                   /translation="PRGDREVITMQTVPRFCNNQEHVDTYLWEEAWGKHCFWLLLKPAF
FT                   WRWTAAQGNEGRFCKLQILSRTRTVASLSWPAFPEYLKRSLETNKILRTSGTVTDSVLL
FT                   LALNSPS"
FT   gap             7849583..7849716
FT                   /estimated_length=134
FT   gap             7857112..7857286
FT                   /estimated_length=175
FT   gene            complement(7883523..7915863)
FT                   /locus_tag="mCG_147208"
FT                   /note="gene_id=mCG147208.0"
FT   mRNA            complement(join(7883523..7886044,7915791..7915863))
FT                   /locus_tag="mCG_147208"
FT                   /product="mCG147208"
FT                   /note="gene_id=mCG147208.0 transcript_id=mCT187471.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7885451..7885630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147208"
FT                   /product="mCG147208"
FT                   /note="gene_id=mCG147208.0 transcript_id=mCT187471.0
FT                   protein_id=mCP109615.0"
FT                   /protein_id="EDL07152.1"
FT                   /translation="MPNTIWSLLHMHSFPDPFFFIFEEIIKILKRKKNIPLLGMMAHTL
FT                   ESQHWVRSNWTSVN"
FT   gap             7935034..7935466
FT                   /estimated_length=433
FT   gap             7938975..7939103
FT                   /estimated_length=129
FT   gene            <7953661..7954568
FT                   /locus_tag="mCG_49664"
FT                   /note="gene_id=mCG49664.2"
FT   mRNA            <7953661..7954568
FT                   /locus_tag="mCG_49664"
FT                   /product="mCG49664"
FT                   /note="gene_id=mCG49664.2 transcript_id=mCT49847.2 created
FT                   on 19-NOV-2002"
FT   CDS             7953661..7953987
FT                   /codon_start=1
FT                   /locus_tag="mCG_49664"
FT                   /product="mCG49664"
FT                   /note="gene_id=mCG49664.2 transcript_id=mCT49847.2
FT                   protein_id=mCP29890.2"
FT                   /protein_id="EDL07151.1"
FT                   /translation="MHNPFMDLSYMVYMFQYDSTHGKFNITGKANNGKLIINGNAITIV
FT                   QEQDPANSNWGNAGDEYIVELTGIFTTMKKVGAHLKGEVNKVIISAPSADAPKFCDGSE
FT                   PREV"
FT   gap             7965065..7965248
FT                   /estimated_length=184
FT   gap             7980000..7980408
FT                   /estimated_length=409
FT   gap             7985664..7985683
FT                   /estimated_length=20
FT   gap             7988814..7989256
FT                   /estimated_length=443
FT   gap             8014662..8014687
FT                   /estimated_length=26
FT   gap             8032737..8038201
FT                   /estimated_length=5465
FT   gap             8097964..8098545
FT                   /estimated_length=582
FT   gap             8105377..8105396
FT                   /estimated_length=20
FT   gap             8113500..8113519
FT                   /estimated_length=20
FT   gap             8149009..8149165
FT                   /estimated_length=157
FT   gap             8154666..8154685
FT                   /estimated_length=20
FT   gap             8173803..8174030
FT                   /estimated_length=228
FT   gap             8185008..8185027
FT                   /estimated_length=20
FT   gap             8210288..8210451
FT                   /estimated_length=164
FT   gap             8239960..8239982
FT                   /estimated_length=23
FT   gap             8248180..8248228
FT                   /estimated_length=49
FT   gap             8296801..8297024
FT                   /estimated_length=224
FT   gene            <8328246..8369314
FT                   /locus_tag="mCG_1028254"
FT                   /note="gene_id=mCG1028254.1"
FT   mRNA            join(<8328246..8328503,8369229..8369314)
FT                   /locus_tag="mCG_1028254"
FT                   /product="mCG1028254"
FT                   /note="gene_id=mCG1028254.1 transcript_id=mCT145958.1
FT                   created on 19-NOV-2002"
FT   CDS             join(<8328280..8328503,8369229..8369241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028254"
FT                   /product="mCG1028254"
FT                   /note="gene_id=mCG1028254.1 transcript_id=mCT145958.1
FT                   protein_id=mCP88994.1"
FT                   /protein_id="EDL07150.1"
FT                   /translation="ETCFALEGVHQLILTQRRRKCRLTGKPGSPLTQFRRSLRTKSCCK
FT                   VHLSSSDDSDNQGAESGAACSPLTNTHPLWVTH"
FT   gap             8329888..8329907
FT                   /estimated_length=20
FT   gap             8354668..8355622
FT                   /estimated_length=955
FT   gap             8357780..8357799
FT                   /estimated_length=20
FT   gap             8361344..8361363
FT                   /estimated_length=20
FT   gap             8383073..8383166
FT                   /estimated_length=94
FT   gap             8404904..8404923
FT                   /estimated_length=20
FT   gap             8435520..8435539
FT                   /estimated_length=20
FT   gap             8442357..8442376
FT                   /estimated_length=20
FT   gap             8472791..8472810
FT                   /estimated_length=20
FT   gap             8477251..8477309
FT                   /estimated_length=59
FT   gap             8478535..8479309
FT                   /estimated_length=775
FT   gap             8482750..8483196
FT                   /estimated_length=447
FT   gap             8500760..8500793
FT                   /estimated_length=34
FT   gap             8518529..8518548
FT                   /estimated_length=20
FT   gap             8521951..8521970
FT                   /estimated_length=20
FT   gene            complement(8542300..>8570447)
FT                   /locus_tag="mCG_145070"
FT                   /note="gene_id=mCG145070.0"
FT   mRNA            complement(join(8542300..8544623,8548779..8548866,
FT                   8549234..8549328,8562580..8562667,8570198..8570285,
FT                   8570413..>8570447))
FT                   /locus_tag="mCG_145070"
FT                   /product="mCG145070"
FT                   /note="gene_id=mCG145070.0 transcript_id=mCT184494.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(8543313..>8543585)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145070"
FT                   /product="mCG145070"
FT                   /note="gene_id=mCG145070.0 transcript_id=mCT184494.0
FT                   protein_id=mCP106149.0"
FT                   /protein_id="EDL07149.1"
FT                   /translation="SVVVPPNMGAGNQTQVLCKQAQHQSPRKGFLSRTSMEQQLKDFIL
FT                   FNKNMNCKFTVRKCQTHNSWVMFKILHLLNDQVLGSRSVKISVRK"
FT   gap             8574593..8574796
FT                   /estimated_length=204
FT   gap             8592441..8592512
FT                   /estimated_length=72
FT   gap             8593968..8594011
FT                   /estimated_length=44
FT   gap             8611514..8611533
FT                   /estimated_length=20
FT   gap             8618870..8618943
FT                   /estimated_length=74
FT   gap             8622889..8623031
FT                   /estimated_length=143
FT   gap             8636736..8636755
FT                   /estimated_length=20
FT   gap             8644546..8644565
FT                   /estimated_length=20
FT   gap             8647377..8647396
FT                   /estimated_length=20
FT   gap             8678955..8681131
FT                   /estimated_length=2177
FT   gap             8709697..8709716
FT                   /estimated_length=20
FT   gap             8721549..8726369
FT                   /estimated_length=4821
FT   gap             8745594..8745613
FT                   /estimated_length=20
FT   gap             8746702..8746902
FT                   /estimated_length=201
FT   gap             8748413..8748432
FT                   /estimated_length=20
FT   gap             8751297..8751316
FT                   /estimated_length=20
FT   gap             8752758..8753032
FT                   /estimated_length=275
FT   gap             8754167..8754186
FT                   /estimated_length=20
FT   gap             8755350..8755369
FT                   /estimated_length=20
FT   gap             8757085..8757104
FT                   /estimated_length=20
FT   gap             8760241..8760260
FT                   /estimated_length=20
FT   gap             8826544..8826658
FT                   /estimated_length=115
FT   gap             8842563..8842582
FT                   /estimated_length=20
FT   gap             8866890..8866909
FT                   /estimated_length=20
FT   gap             8878852..8884358
FT                   /estimated_length=5507
FT   gap             8895769..8896350
FT                   /estimated_length=582
FT   gap             8916244..8917319
FT                   /estimated_length=1076
FT   gap             8923788..8923807
FT                   /estimated_length=20
FT   gap             8973022..8973041
FT                   /estimated_length=20
FT   gap             9012357..9014395
FT                   /estimated_length=2039
FT   gap             9016008..9016027
FT                   /estimated_length=20
FT   gap             9021084..9022722
FT                   /estimated_length=1639
FT   gap             9024741..9025238
FT                   /estimated_length=498
FT   gap             9038341..9038400
FT                   /estimated_length=60
FT   gap             9050332..9050366
FT                   /estimated_length=35
FT   gap             9064831..9065390
FT                   /estimated_length=560
FT   gap             9080447..9080956
FT                   /estimated_length=510
FT   gap             9099993..9100019
FT                   /estimated_length=27
FT   gene            9163715..9164422
FT                   /pseudo
FT                   /locus_tag="mCG_50813"
FT                   /note="gene_id=mCG50813.2"
FT   mRNA            9163715..9164422
FT                   /pseudo
FT                   /locus_tag="mCG_50813"
FT                   /note="gene_id=mCG50813.2 transcript_id=mCT50996.2 created
FT                   on 19-NOV-2002"
FT   gap             9166393..9166540
FT                   /estimated_length=148
FT   gap             9178846..9178865
FT                   /estimated_length=20
FT   gap             9193381..9193400
FT                   /estimated_length=20
FT   gap             9226139..9226158
FT                   /estimated_length=20
FT   gap             9234910..9235008
FT                   /estimated_length=99
FT   gap             9261097..9261129
FT                   /estimated_length=33
FT   gap             9269113..9269299
FT                   /estimated_length=187
FT   gap             9275904..9275923
FT                   /estimated_length=20
FT   gap             9276934..9276953
FT                   /estimated_length=20
FT   gap             9283729..9283748
FT                   /estimated_length=20
FT   gap             9290384..9290403
FT                   /estimated_length=20
FT   gap             9322485..9322777
FT                   /estimated_length=293
FT   gap             9323602..9323886
FT                   /estimated_length=285
FT   gap             9343502..9343785
FT                   /estimated_length=284
FT   gap             9349702..9349721
FT                   /estimated_length=20
FT   gap             9352861..9352950
FT                   /estimated_length=90
FT   gene            9375744..9404578
FT                   /locus_tag="mCG_63065"
FT                   /note="gene_id=mCG63065.1"
FT   mRNA            join(9375744..9376004,9400552..9400700,9404488..9404578)
FT                   /locus_tag="mCG_63065"
FT                   /product="mCG63065"
FT                   /note="gene_id=mCG63065.1 transcript_id=mCT63248.2 created
FT                   on 15-JAN-2003"
FT   gap             9381917..9381936
FT                   /estimated_length=20
FT   gap             9382958..9382977
FT                   /estimated_length=20
FT   CDS             join(9400570..9400700,9404488..9404497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63065"
FT                   /product="mCG63065"
FT                   /note="gene_id=mCG63065.1 transcript_id=mCT63248.2
FT                   protein_id=mCP29891.2"
FT                   /protein_id="EDL07148.1"
FT                   /translation="MKTIRNPVVPMASQRTSPACGSPSGLCGIWSSTRTTLELTLPYSN
FT                   N"
FT   gene            complement(9413033..>9427392)
FT                   /locus_tag="mCG_1028389"
FT                   /note="gene_id=mCG1028389.1"
FT   mRNA            complement(join(9413033..9413124,9422159..9422268,
FT                   9422467..9422583,9423925..9424068,9427328..>9427392))
FT                   /locus_tag="mCG_1028389"
FT                   /product="mCG1028389"
FT                   /note="gene_id=mCG1028389.1 transcript_id=mCT146093.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(9422504..9422583,9423925..>9424057))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028389"
FT                   /product="mCG1028389"
FT                   /note="gene_id=mCG1028389.1 transcript_id=mCT146093.1
FT                   protein_id=mCP89035.1"
FT                   /protein_id="EDL07147.1"
FT                   /translation="LPCECSILQMDLECFPVELTELISIEQICAVTDDSNPNCIVISKA
FT                   ISYMYNLGKVTESLKVSARTSSVAG"
FT   gene            <9426545..9488332
FT                   /locus_tag="mCG_145908"
FT                   /note="gene_id=mCG145908.0"
FT   mRNA            join(<9426545..9426628,9434817..9434874,9488110..9488332)
FT                   /locus_tag="mCG_145908"
FT                   /product="mCG145908"
FT                   /note="gene_id=mCG145908.0 transcript_id=mCT186016.0
FT                   created on 04-JUL-2003"
FT   gap             9431159..9432510
FT                   /estimated_length=1352
FT   CDS             join(<9434861..9434874,9488110..9488290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145908"
FT                   /product="mCG145908"
FT                   /note="gene_id=mCG145908.0 transcript_id=mCT186016.0
FT                   protein_id=mCP107704.0"
FT                   /protein_id="EDL07146.1"
FT                   /translation="PLWNLGNNKRSSDECCRSPWLRFRDAAKSNYGGREEGNAPLCQNF
FT                   IAAVTTREHPNECRITEIL"
FT   gap             9439095..9445535
FT                   /estimated_length=6441
FT   gap             9458518..9458582
FT                   /estimated_length=65
FT   gene            complement(9541408..>9675579)
FT                   /locus_tag="mCG_119297"
FT                   /note="gene_id=mCG119297.1"
FT   mRNA            complement(join(9541408..9541766,9541784..9541852,
FT                   9541903..9541990,9564242..9564351,9571629..9571685,
FT                   9574393..9574542,9582793..9582834,9588241..9588363,
FT                   9621694..9621751,9625084..9625203,9626261..9626390,
FT                   9627142..9627216,9628554..9628655,9647770..9647872,
FT                   9649728..9649830,9664303..9664396,9666246..9666432,
FT                   9675515..>9675579))
FT                   /locus_tag="mCG_119297"
FT                   /product="mCG119297"
FT                   /note="gene_id=mCG119297.1 transcript_id=mCT120467.1
FT                   created on 19-NOV-2002"
FT   gap             9542504..9543222
FT                   /estimated_length=719
FT   gap             9549508..9549527
FT                   /estimated_length=20
FT   gap             9585970..9586333
FT                   /estimated_length=364
FT   gap             9593019..9593038
FT                   /estimated_length=20
FT   gap             9594181..9594200
FT                   /estimated_length=20
FT   gap             9595383..9595402
FT                   /estimated_length=20
FT   gap             9599787..9600006
FT                   /estimated_length=220
FT   gap             9603525..9603803
FT                   /estimated_length=279
FT   gap             9606282..9606301
FT                   /estimated_length=20
FT   CDS             complement(join(9626376..9626390,9627142..9627216,
FT                   9628554..9628655,9647770..9647872,9649728..9649830,
FT                   9664303..9664396,9666246..9666432,9675515..9675579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119297"
FT                   /product="mCG119297"
FT                   /note="gene_id=mCG119297.1 transcript_id=mCT120467.1
FT                   protein_id=mCP88664.1"
FT                   /protein_id="EDL07145.1"
FT                   /translation="MGILDIEVWGKDSKKHEERLGTCKVDISALPLKQDNCLELPLESC
FT                   QGALLMLITLTPCTGVSISDLCVCPFEDPSERQQISQRYAFQNSLKDVKDVGILQVKVL
FT                   KASDLLAADFSGKSDPFCLLELGNDRLQTHTIYKNLNPEWNKVFTFPIKDIHDVLEVTV
FT                   FDEDGDKAPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGLIYLELDLIYNPVKAS
FT                   IRTFTPREKRFVEDSRKLSKKLPLG"
FT   gap             9672629..9672693
FT                   /estimated_length=65
FT   gap             9685482..9685660
FT                   /estimated_length=179
FT   gene            complement(9689475..>9693467)
FT                   /locus_tag="mCG_144575"
FT                   /note="gene_id=mCG144575.0"
FT   mRNA            complement(join(9689475..9692198,9692578..9692654,
FT                   9693434..>9693467))
FT                   /locus_tag="mCG_144575"
FT                   /product="mCG144575"
FT                   /note="gene_id=mCG144575.0 transcript_id=mCT183999.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(9689634..>9689900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144575"
FT                   /product="mCG144575"
FT                   /note="gene_id=mCG144575.0 transcript_id=mCT183999.0
FT                   protein_id=mCP106145.0"
FT                   /protein_id="EDL07144.1"
FT                   /translation="NQSDNDILEMCSLCLCWLSSRVNLALTGRLREREKNRVIIRIVGF
FT                   VGKCLCLAPGSTETLSNLQAYLTSLRCFPHMWVRVRAPSWALA"
FT   gap             9700580..9700914
FT                   /estimated_length=335
FT   gap             9714829..9714930
FT                   /estimated_length=102
FT   gap             9746649..9746799
FT                   /estimated_length=151
FT   gap             9750756..9750775
FT                   /estimated_length=20
FT   gap             9788750..9788785
FT                   /estimated_length=36
FT   gap             9789883..9789920
FT                   /estimated_length=38
FT   gap             9812841..9812860
FT                   /estimated_length=20
FT   gap             9821426..9821445
FT                   /estimated_length=20
FT   gap             9824894..9824913
FT                   /estimated_length=20
FT   gap             9826059..9826078
FT                   /estimated_length=20
FT   gap             9827405..9827424
FT                   /estimated_length=20
FT   gap             9843032..9843388
FT                   /estimated_length=357
FT   gap             9874122..9874141
FT                   /estimated_length=20
FT   gap             9880217..9880236
FT                   /estimated_length=20
FT   gap             9926892..9927646
FT                   /estimated_length=755
FT   gap             9928372..9928917
FT                   /estimated_length=546
FT   gap             9957419..9960018
FT                   /estimated_length=2600
FT   gap             9968935..9968954
FT                   /estimated_length=20
FT   gap             9987300..9987319
FT                   /estimated_length=20
FT   gap             9990864..9990883
FT                   /estimated_length=20
FT   gap             9993441..9993568
FT                   /estimated_length=128
FT   gap             10012033..10012075
FT                   /estimated_length=43
FT   gap             10070231..10070534
FT                   /estimated_length=304
FT   gap             10077899..10078065
FT                   /estimated_length=167
FT   gap             10088113..10088220
FT                   /estimated_length=108
FT   gap             10095102..10095121
FT                   /estimated_length=20
FT   gap             10109634..10109653
FT                   /estimated_length=20
FT   gap             10121592..10127525
FT                   /estimated_length=5934
FT   gap             10128110..10128840
FT                   /estimated_length=731
FT   gene            complement(10129460..>10131565)
FT                   /locus_tag="mCG_141645"
FT                   /note="gene_id=mCG141645.0"
FT   mRNA            complement(join(10129460..10130628,10130731..>10131565))
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, transcript variant mCT176115"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176115.0
FT                   created on 19-NOV-2002"
FT   mRNA            complement(join(10129460..10129926,10130040..10130377,
FT                   10130731..>10131134))
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, transcript variant mCT176116"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176116.0
FT                   created on 19-NOV-2002"
FT   CDS             complement(10129546..>10129788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, isoform CRA_b"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176116.0
FT                   protein_id=mCP99037.0 isoform=CRA_b"
FT                   /protein_id="EDL07143.1"
FT                   /translation="GISSSMFGTERHPIFLLGLWGSTGAPFSILRRDVTTLFEGCILVF
FT                   KNVLNAELLPLQPRLRARAVSERTGKGLLRPGHWG"
FT   CDS             complement(10130965..>10131459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141645"
FT                   /product="mCG141645, isoform CRA_a"
FT                   /note="gene_id=mCG141645.0 transcript_id=mCT176115.0
FT                   protein_id=mCP99038.0 isoform=CRA_a"
FT                   /protein_id="EDL07142.1"
FT                   /translation="VRRAQTCELLFSVTVHKETNGLCIAQLCRAEERLRYRPLDTASQT
FT                   LRANACRAPSRAQPAWTSMWGSVRGLGVPLQNVSLPGSLQYALYPKGRDYLTFFLEKKN
FT                   PKTYILNIHSTQTWIMFVYSALKPQRKQCGLSCPCSGRDDQRYTCLKNGKFKSKGKQFP
FT                   E"
FT   gap             10144926..10144945
FT                   /estimated_length=20
FT   gene            complement(10169320..10170307)
FT                   /pseudo
FT                   /locus_tag="mCG_19746"
FT                   /note="gene_id=mCG19746.1"
FT   mRNA            complement(10169320..10170307)
FT                   /pseudo
FT                   /locus_tag="mCG_19746"
FT                   /note="gene_id=mCG19746.1 transcript_id=mCT21805.1 created
FT                   on 19-NOV-2002"
FT   gap             10180611..10180844
FT                   /estimated_length=234
FT   gap             10202858..10202877
FT                   /estimated_length=20
FT   gap             10205519..10213168
FT                   /estimated_length=7650
FT   gap             10215422..10215870
FT                   /estimated_length=449
FT   gap             10219178..10219197
FT                   /estimated_length=20
FT   gap             10242743..10246344
FT                   /estimated_length=3602
FT   gap             10274086..10278616
FT                   /estimated_length=4531
FT   gap             10282758..10283227
FT                   /estimated_length=470
FT   gap             10284425..10284444
FT                   /estimated_length=20
FT   gap             10285449..10285468
FT                   /estimated_length=20
FT   gap             10286655..10286674
FT                   /estimated_length=20
FT   gap             10287831..10287850
FT                   /estimated_length=20
FT   gap             10289439..10290440
FT                   /estimated_length=1002
FT   gap             10324731..10325450
FT                   /estimated_length=720
FT   gap             10353750..10353769
FT                   /estimated_length=20
FT   gap             10354803..10354822
FT                   /estimated_length=20
FT   gap             10355799..10355818
FT                   /estimated_length=20
FT   gap             10380293..10380410
FT                   /estimated_length=118
FT   gap             10383434..10383843
FT                   /estimated_length=410
FT   gap             10385532..10390174
FT                   /estimated_length=4643
FT   gap             10391189..10395184
FT                   /estimated_length=3996
FT   gap             10396951..10397108
FT                   /estimated_length=158
FT   gap             10429525..10429544
FT                   /estimated_length=20
FT   gap             10440581..10440600
FT                   /estimated_length=20
FT   gap             10442515..10442534
FT                   /estimated_length=20
FT   gene            complement(10453634..10454624)
FT                   /pseudo
FT                   /locus_tag="mCG_19748"
FT                   /note="gene_id=mCG19748.2"
FT   mRNA            complement(10453634..10454624)
FT                   /pseudo
FT                   /locus_tag="mCG_19748"
FT                   /note="gene_id=mCG19748.2 transcript_id=mCT21807.2 created
FT                   on 19-NOV-2002"
FT   gap             10489853..10489872
FT                   /estimated_length=20
FT   gap             10494569..10494588
FT                   /estimated_length=20
FT   gap             10499905..10499924
FT                   /estimated_length=20
FT   gap             10507680..10509439
FT                   /estimated_length=1760
FT   gap             10526774..10527601
FT                   /estimated_length=828
FT   gap             10533882..10533901
FT                   /estimated_length=20
FT   gap             10535239..10535387
FT                   /estimated_length=149
FT   gap             10536470..10537197
FT                   /estimated_length=728
FT   gene            complement(10554751..>10559064)
FT                   /locus_tag="mCG_145074"
FT                   /note="gene_id=mCG145074.0"
FT   mRNA            complement(join(10554751..10555271,10556218..10556369,
FT                   10557649..>10559064))
FT                   /locus_tag="mCG_145074"
FT                   /product="mCG145074"
FT                   /note="gene_id=mCG145074.0 transcript_id=mCT184498.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10555020..10555271,10556218..10556369,
FT                   10557649..>10557691))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145074"
FT                   /product="mCG145074"
FT                   /note="gene_id=mCG145074.0 transcript_id=mCT184498.0
FT                   protein_id=mCP106153.0"
FT                   /protein_id="EDL07141.1"
FT                   /translation="RKQQRDGPVLRWPSALAPLGHRGEVCLTQREVCLTLLTVLKGVVK
FT                   KSPWSISLSARPEQQVLWALARGPWRTRLPFNTLKMSSDKQPTHWHSSPSFHRMLRIRS
FT                   APGHHTDVIMAASYPLLTAFCSFPPERSSEWASASIRPACWTGP"
FT   gap             10576277..10576296
FT                   /estimated_length=20
FT   gap             10580984..10581003
FT                   /estimated_length=20
FT   gap             10582012..10582031
FT                   /estimated_length=20
FT   gap             10592856..10592875
FT                   /estimated_length=20
FT   gap             10596833..10596852
FT                   /estimated_length=20
FT   gap             10609019..10609038
FT                   /estimated_length=20
FT   gap             10618666..10619699
FT                   /estimated_length=1034
FT   gene            <10636584..10640260
FT                   /locus_tag="mCG_59835"
FT                   /note="gene_id=mCG59835.2"
FT   mRNA            join(<10636584..10636811,10637911..10638026,
FT                   10639448..10640260)
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, transcript variant mCT60018"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT60018.2 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<10636645..10636811,10639448..10640260)
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, transcript variant mCT176121"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT176121.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(<10636763..10636811,10637911..10638026,
FT                   10639448..10639558)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, isoform CRA_b"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT60018.2
FT                   protein_id=mCP29852.2 isoform=CRA_b"
FT                   /protein_id="EDL07140.1"
FT                   /translation="LRSRLSSATLHNDSGQGASEHYPSMALSWTAWGSFFILNGQEPLP
FT                   TGAQGGQRIQASLFLMEQKEYQEINGDARLDLRQHWKHLQAFITPD"
FT   CDS             <10639998..10640228
FT                   /codon_start=1
FT                   /locus_tag="mCG_59835"
FT                   /product="mCG59835, isoform CRA_a"
FT                   /note="gene_id=mCG59835.2 transcript_id=mCT176121.0
FT                   protein_id=mCP99043.0 isoform=CRA_a"
FT                   /protein_id="EDL07139.1"
FT                   /translation="LVNHSLQFLLKQVCPASACLQELRDTLALYGRAKTKVRSRSSSNG
FT                   EDSISSARAVINEAKDSSHKLSLNLHTRAYI"
FT   gap             10663045..10663640
FT                   /estimated_length=596
FT   gap             10665282..10667086
FT                   /estimated_length=1805
FT   gap             10668636..10669536
FT                   /estimated_length=901
FT   gap             10675559..10675654
FT                   /estimated_length=96
FT   gap             10679021..10680791
FT                   /estimated_length=1771
FT   gap             10687601..10687620
FT                   /estimated_length=20
FT   gap             10688484..10688910
FT                   /estimated_length=427
FT   gap             10690019..10690038
FT                   /estimated_length=20
FT   gap             10693861..10694401
FT                   /estimated_length=541
FT   gap             10715205..10715224
FT                   /estimated_length=20
FT   gap             10730417..10730588
FT                   /estimated_length=172
FT   gap             10749220..10749493
FT                   /estimated_length=274
FT   gene            10761852..>10763275
FT                   /locus_tag="mCG_147207"
FT                   /note="gene_id=mCG147207.0"
FT   mRNA            join(10761852..10762035,10762977..>10763275)
FT                   /locus_tag="mCG_147207"
FT                   /product="mCG147207"
FT                   /note="gene_id=mCG147207.0 transcript_id=mCT187470.0
FT                   created on 13-JAN-2004"
FT   CDS             10763111..>10763275
FT                   /codon_start=1
FT                   /locus_tag="mCG_147207"
FT                   /product="mCG147207"
FT                   /note="gene_id=mCG147207.0 transcript_id=mCT187470.0
FT                   protein_id=mCP109614.0"
FT                   /protein_id="EDL07138.1"
FT                   /translation="MPSLTPPSRICIASANWALIYTKVKSRFVNGDGLYKHGEFVYSLV
FT                   HINIFTFTFM"
FT   gap             10776428..10779473
FT                   /estimated_length=3046
FT   gap             10787955..10788542
FT                   /estimated_length=588
FT   gap             10794650..10794853
FT                   /estimated_length=204
FT   gap             10801889..10801950
FT                   /estimated_length=62
FT   gap             10803595..10803694
FT                   /estimated_length=100
FT   gap             10812494..10812513
FT                   /estimated_length=20
FT   gap             10827520..10827539
FT                   /estimated_length=20
FT   gene            10828711..10829190
FT                   /pseudo
FT                   /locus_tag="mCG_1028161"
FT                   /note="gene_id=mCG1028161.1"
FT   mRNA            10828711..10829190
FT                   /pseudo
FT                   /locus_tag="mCG_1028161"
FT                   /note="gene_id=mCG1028161.1 transcript_id=mCT145865.1
FT                   created on 13-NOV-2002"
FT   gap             10830597..10830727
FT                   /estimated_length=131
FT   gene            <10830728..10875229
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /note="gene_id=mCG50423.3"
FT   mRNA            join(<10830728..10831093,10864565..10865082,
FT                   10872648..10875228)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT189927"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT189927.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<10830784..10831093,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_b"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT189927.0
FT                   protein_id=mCP110927.0 isoform=CRA_b"
FT                   /protein_id="EDL07136.1"
FT                   /translation="PGPPYSAGVSELQATPPEPCAREALASRPLLRLAPPGARRHAAGE
FT                   QAERPGSLLSPLSCGDQRQPGPSHLTQGPTSDRPTPSLRAQPRQRQPPAGWRGSCSRQA
FT                   ISPCKILKCNSEFWSATSSGSHAPASDDVPEFCAALRTYALCTRRTARTCRGDLAYHSA
FT                   VHGIEDLMSQHNCSKDGPTSQPRVRTLPPAGDSQERSDSPEICHYEKSFHKHSAAPNYT
FT                   HCGLFGDPHLRTFTDHFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIF
FT                   KNFQECVDQKVYQAEMDELPSAFADGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGT
FT                   TIVVRQVGRYLTFAVRMPEEVVNAVEDRDSQGLYLCLRGCPLNQQIDFQAFRANAESPR
FT                   RPAAASPSPVVPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALE
FT                   DGKMLHSNKDKLHLFERTRELPGAVAAAAAAATTFPLAPQILLGTIPLLVLLPVLW"
FT   mRNA            join(10830893..10831093,10846718..10846833,
FT                   10864565..10865082,10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT50606"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT50606.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(10831080..10831093,10846718..10846833,
FT                   10864565..10865082,10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_c"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT50606.2
FT                   protein_id=mCP29916.2 isoform=CRA_c"
FT                   /protein_id="EDL07137.1"
FT                   /translation="MQPPRERLVVTGRAGWMGMGRGAGRSALGLWPTLAFLLCSFPAAI
FT                   SPCKILKCNSEFWSATSSGSHAPASDDVPEFCAALRTYALCTRRTARTCRGDLAYHSAV
FT                   HGIEDLMSQHNCSKDGPTSQPRVRTLPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTH
FT                   CGLFGDPHLRTFTDHFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFK
FT                   NFQECVDQKVYQAEMDELPSAFADGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT
FT                   IVVRQVGRYLTFAVRMPEEVVNAVEDRDSQGLYLCLRGCPLNQQIDFQAFRANAESPRR
FT                   PAAASPSPVVPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALED
FT                   GKMLHSNKDKLHLFERTRELPGAVAAAAAAATTFPLAPQILLGTIPLLVLLPVLW"
FT   gap             10846224..10846392
FT                   /estimated_length=169
FT   mRNA            join(10846493..10846537,10846718..10846833,
FT                   10864565..10865082,10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT176118"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176118.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(10846554..10846833,10864565..10865082,
FT                   10872648..10875229)
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, transcript variant
FT                   mCT176117"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176117.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(10846752..10846833,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176117.0
FT                   protein_id=mCP99040.0 isoform=CRA_a"
FT                   /protein_id="EDL07134.1"
FT                   /translation="MGMGRGAGRSALGLWPTLAFLLCSFPAAISPCKILKCNSEFWSAT
FT                   SSGSHAPASDDVPEFCAALRTYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG
FT                   PTSQPRVRTLPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHF
FT                   QTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMD
FT                   ELPSAFADGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRM
FT                   PEEVVNAVEDRDSQGLYLCLRGCPLNQQIDFQAFRANAESPRRPAAASPSPVVPETFPY
FT                   ETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDGKMLHSNKDKLHLFER
FT                   TRELPGAVAAAAAAATTFPLAPQILLGTIPLLVLLPVLW"
FT   CDS             join(10846752..10846833,10864565..10865082,
FT                   10872648..10873364)
FT                   /codon_start=1
FT                   /gene="Rgma"
FT                   /locus_tag="mCG_50423"
FT                   /product="RGM domain family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG50423.3 transcript_id=mCT176118.0
FT                   protein_id=mCP99039.0 isoform=CRA_a"
FT                   /protein_id="EDL07135.1"
FT                   /translation="MGMGRGAGRSALGLWPTLAFLLCSFPAAISPCKILKCNSEFWSAT
FT                   SSGSHAPASDDVPEFCAALRTYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG
FT                   PTSQPRVRTLPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHF
FT                   QTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMD
FT                   ELPSAFADGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRM
FT                   PEEVVNAVEDRDSQGLYLCLRGCPLNQQIDFQAFRANAESPRRPAAASPSPVVPETFPY
FT                   ETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDGKMLHSNKDKLHLFER
FT                   TRELPGAVAAAAAAATTFPLAPQILLGTIPLLVLLPVLW"
FT   gap             10862110..10862129
FT                   /estimated_length=20
FT   gap             10866159..10866388
FT                   /estimated_length=230
FT   gap             10870488..10870589
FT                   /estimated_length=102
FT   gap             10881542..10881567
FT                   /estimated_length=26
FT   gene            complement(<10891050..10997329)
FT                   /locus_tag="mCG_19747"
FT                   /note="gene_id=mCG19747.2"
FT   mRNA            complement(join(<10891050..10891293,10896901..10897114,
FT                   10899550..10899649,10902450..10902628,10904472..10904606,
FT                   10907014..10907154,10908414..10908542,10909644..10909766,
FT                   10910806..10910956,10911089..10911227,10918956..10919095,
FT                   10919668..10919709,10923764..10923939,10924866..10925036,
FT                   10927105..10927197,10928320..10928416,10929816..10929964,
FT                   10930654..10930803,10933969..10934040,10935711..10935863,
FT                   10936271..10936433,10940029..10940217,10946099..10946289,
FT                   10946955..10947044,10949045..10949261,10953328..10953452,
FT                   10955215..10955393,10955560..10955604,10956556..10956656,
FT                   10957530..10957776,10959001..10959134,10960608..10960748,
FT                   10963343..10963450,10969627..10969688,10971263..10971349,
FT                   10975013..10975244,10996354..10996486,10996828..10997329))
FT                   /locus_tag="mCG_19747"
FT                   /product="mCG19747"
FT                   /note="gene_id=mCG19747.2 transcript_id=mCT21806.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(<10891050..10891293,10896901..10897114,
FT                   10899550..10899649,10902450..10902628,10904472..10904606,
FT                   10907014..10907154,10908414..10908542,10909644..10909766,
FT                   10910806..10910956,10911089..10911227,10918956..10919095,
FT                   10919668..10919709,10923764..10923939,10924866..10925036,
FT                   10927105..10927197,10928320..10928416,10929816..10929964,
FT                   10930654..10930803,10933969..10934040,10935711..10935863,
FT                   10936271..10936433,10940029..10940217,10946099..10946289,
FT                   10946955..10947044,10949045..10949261,10953328..10953452,
FT                   10955215..10955393,10955560..10955604,10956556..10956656,
FT                   10957530..10957776,10959001..10959134,10960608..10960748,
FT                   10963343..10963450,10969627..10969688,10971263..10971349,
FT                   10975013..10975244,10996354..10996415))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19747"
FT                   /product="mCG19747"
FT                   /note="gene_id=mCG19747.2 transcript_id=mCT21806.2
FT                   protein_id=mCP7263.1"
FT                   /protein_id="EDL07132.1"
FT                   /translation="MMRNKDKSQEEDSSLHSNASSRSASEEVSGSDSGSQSESEQGSEP
FT                   GSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYP
FT                   DVYGVRRSNRSRQEPSRFNVKEEASSGSESGSPKRRGQRQLKKQEKWKQDPSEDEQEQG
FT                   TSAESEAEQKKGKARRPVPRRTVPKPQVKKQPKIQRGKRKKQESSDDDDDDDEAPKRQT
FT                   RRRAAKNVSYKEDDDFETDSDDLIEMTGEGGDEQQDNSETIEKVLDSRLGKKGADLNPF
FT                   AATGASTTVYAVEANGDPSDDFDTEREEGEVQYLIKWKGWSYIHSTWESEDSLQQQKVK
FT                   GLKKLENFKKKEDEVKQWLGKVSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKST
FT                   LGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKKFQNCIDSFHSRNNSK
FT                   TIPTRECKALKQRPRFVALKKQPAYLGGESLELRDYQLEGLNWLAHSWCKSNSVILADE
FT                   MGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLM
FT                   SRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSL
FT                   LYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHGKGRENGYQ
FT                   SLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRG
FT                   STSGFLNIVMELKKCCNHCYLIKAPEDSERESGQEVLQSLIRSSGKLILLDKLLTRLRE
FT                   RGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFL
FT                   LSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEE
FT                   EIIERAKKKMVLDHLVIQRMDTTGRTVLENNSGRSNSNPFNKEELTAILKFGAEDLFKE
FT                   IEGEESEPQEMDIDEILRLAETRENEVSTSATDELLSQFKVANFATMEDEEELEERPHK
FT                   DWDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSA
FT                   SESETDDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARD
FT                   AELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKESTSEGKGPGKRRGPTIKISGVQVN
FT                   VKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHG
FT                   YGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRVDYLLKLLRKGLEKKGTVASGEE
FT                   AKLKKRKPRVKKENKAPRLKDEHGLEPASPRHSDNPSEEGEVKDDGLEKSPTKKKQKKK
FT                   ENKENKEKPVSSRKDREGDKERKKSKDKKEKVKGGDGKSSSKSKRSQGPVHITAGSEPV
FT                   PIGEDEDDDLDQETFSICKERMRPVKKALKQLDKPDKGLSVQEQLEHTRNCLLKIGDRI
FT                   AECLKAYSDQEHIKLWRRNLWIFVSKFTEFDARKLHKLYKMAHKKRSQEEEEQKKKDDS
FT                   LGGKKPFRPEASGSSRDSLISQSHTSHNLHPQKPHLPASHGPQMHGHPRDNYSHPNKRH
FT                   FSNADRGDWQRERKFNYGGGNSAPWGGDRHHQYEQHWYKDHHYGDRRHMDAHRSGSYRP
FT                   NNMSRKRPYEQYNSDRDHRGHRDYYD"
FT   gap             10939112..10939724
FT                   /estimated_length=613
FT   gap             10962566..10962685
FT                   /estimated_length=120
FT   gap             10979139..10979158
FT                   /estimated_length=20
FT   gene            10979383..10983512
FT                   /locus_tag="mCG_147201"
FT                   /note="gene_id=mCG147201.0"
FT   mRNA            join(10979383..10980717,10983450..10983512)
FT                   /locus_tag="mCG_147201"
FT                   /product="mCG147201"
FT                   /note="gene_id=mCG147201.0 transcript_id=mCT187464.0
FT                   created on 13-JAN-2004"
FT   CDS             10979879..10980037
FT                   /codon_start=1
FT                   /locus_tag="mCG_147201"
FT                   /product="mCG147201"
FT                   /note="gene_id=mCG147201.0 transcript_id=mCT187464.0
FT                   protein_id=mCP109608.0"
FT                   /protein_id="EDL07133.1"
FT                   /translation="MYTFYWTQKKKKVCQKRKREKKREKTALLRFLGNEAVFLKLDFKN
FT                   NRVTSIS"
FT   gap             10987569..10987588
FT                   /estimated_length=20
FT   gene            complement(10999492..>11013825)
FT                   /locus_tag="mCG_113526"
FT                   /note="gene_id=mCG113526.1"
FT   mRNA            complement(join(10999492..10999964,11005179..11005234,
FT                   11010831..11010909,11011432..11011497,11013616..>11013825))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT114610"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT114610.1
FT                   created on 18-OCT-2002"
FT   mRNA            complement(join(10999619..10999964,11005179..11005234,
FT                   11010831..11010909,11013616..>11013724))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174578"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174578.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(10999813..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_b"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174578.0
FT                   protein_id=mCP97500.0 isoform=CRA_b"
FT                   /protein_id="EDL07128.1"
FT                   /translation="KACTIDIEAFTPRLKSLKWTLPLRNQDGSPLWGIEENGLMQECCN
FT                   IIQPTQDSFNVDSMK"
FT   mRNA            complement(join(<10999825..10999964,11005179..11005234,
FT                   11009075..11009165,11010831..11010909,11011432..>11011500))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174581"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174581.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(<10999825..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_d"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174581.0
FT                   protein_id=mCP97497.0 isoform=CRA_d"
FT                   /protein_id="EDL07131.1"
FT                   /translation="KACTIDIEAFTPRLKSLKWTLPLRNQDGSPLWGIEENGLMQECCN
FT                   IIQPTQDSFNVD"
FT   mRNA            complement(join(<10999846..10999964,11005179..11005234,
FT                   11010831..11010909,11011432..11011497,11013352..>11013383))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174580"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174580.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(<10999846..10999964,11005179..>11005209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_c"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174580.0
FT                   protein_id=mCP97499.0 isoform=CRA_c"
FT                   /protein_id="EDL07130.1"
FT                   /translation="KACTIDIEAFTPRLKSLKWTLPLRNQDGSPLWGIEENGLMQECCN
FT                   IIQPT"
FT   mRNA            complement(join(10999888..10999964,11005179..11005234,
FT                   11011432..11011497,11013616..>11013825))
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, transcript variant mCT174579"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174579.0
FT                   created on 18-OCT-2002"
FT   CDS             complement(join(11011475..11011497,11013616..>11013823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_a"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT114610.1
FT                   protein_id=mCP88714.1 isoform=CRA_a"
FT                   /protein_id="EDL07127.1"
FT                   /translation="AARDVGARGRSARGGRAHDARGSAAAAAVLVSRAAGRRLRAAGGR
FT                   LRRATRPGHARKSEPMAAGAALRPGNLEDDN"
FT   CDS             complement(join(11011475..11011497,11013616..>11013823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113526"
FT                   /product="mCG113526, isoform CRA_a"
FT                   /note="gene_id=mCG113526.1 transcript_id=mCT174579.0
FT                   protein_id=mCP97498.0 isoform=CRA_a"
FT                   /protein_id="EDL07129.1"
FT                   /translation="AARDVGARGRSARGGRAHDARGSAAAAAVLVSRAAGRRLRAAGGR
FT                   LRRATRPGHARKSEPMAAGAALRPGNLEDDN"
FT   gap             11013935..11013983
FT                   /estimated_length=49
FT   gap             11018358..11018499
FT                   /estimated_length=142
FT   gap             11032311..11032330
FT                   /estimated_length=20
FT   gap             11042934..11043467
FT                   /estimated_length=534
FT   gap             11044958..11045273
FT                   /estimated_length=316
FT   gap             11046878..11047368
FT                   /estimated_length=491
FT   gap             11048675..11049544
FT                   /estimated_length=870
FT   gap             11057111..11057267
FT                   /estimated_length=157
FT   gap             11059893..11060334
FT                   /estimated_length=442
FT   gap             11078547..11078566
FT                   /estimated_length=20
FT   gap             11089554..11089573
FT                   /estimated_length=20
FT   gap             11101423..11101741
FT                   /estimated_length=319
FT   gap             11128365..11132010
FT                   /estimated_length=3646
FT   gap             11133654..11133673
FT                   /estimated_length=20
FT   gene            complement(11138865..>11140312)
FT                   /locus_tag="mCG_61177"
FT                   /note="gene_id=mCG61177.1"
FT   mRNA            complement(11138865..>11140312)
FT                   /locus_tag="mCG_61177"
FT                   /product="mCG61177"
FT                   /note="gene_id=mCG61177.1 transcript_id=mCT61360.1 created
FT                   on 13-NOV-2002"
FT   CDS             complement(11139263..11140312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61177"
FT                   /product="mCG61177"
FT                   /note="gene_id=mCG61177.1 transcript_id=mCT61360.1
FT                   protein_id=mCP29917.0"
FT                   /protein_id="EDL07126.1"
FT                   /translation="MGSSKRQRSGNTLVSVVVKQERLSPEPSAPAASLPTAKPNASRSP
FT                   DKKKRKSSGRRSKSPPTKRSRSPHYSTVKVKQEREDHPLRGREDPQPREPSEQEHRRAR
FT                   NSDEQAPHRGHSHQRRSSDERPVSGQGRDRDSQNLKAQEEERDFHNARRQEHRQQNGSA
FT                   GSGEVQEEVIPHPAGNRSKEVPVKEKPCFELSGALLEDTNTFRGVVIKYNEPPEARIPK
FT                   KRWRLYPFKNDELLPVLYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVLQYRLVESTR
FT                   ADGTVGRSVKPFIIDLCSANGTFLNNKRIEPQRYYELKESDVLKFGFSSRDYVLLHESS
FT                   DTSELEEGR"
FT   gap             11164525..11164929
FT                   /estimated_length=405
FT   gap             11170403..11170733
FT                   /estimated_length=331
FT   gap             11176720..11176816
FT                   /estimated_length=97
FT   gene            11194092..11231122
FT                   /locus_tag="mCG_18431"
FT                   /note="gene_id=mCG18431.2"
FT   mRNA            join(11194092..11194802,11220702..11220833,
FT                   11229099..11231122)
FT                   /locus_tag="mCG_18431"
FT                   /product="mCG18431"
FT                   /note="gene_id=mCG18431.2 transcript_id=mCT11506.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(11194477..11194802,11220702..11220833,
FT                   11229099..11229102)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18431"
FT                   /product="mCG18431"
FT                   /note="gene_id=mCG18431.2 transcript_id=mCT11506.2
FT                   protein_id=mCP7248.2"
FT                   /protein_id="EDL07125.1"
FT                   /translation="MSALPPPPPPPLLLLLLALLAAPAALARRAESASASQPEAEHQPP
FT                   PGPGNATQLGSGMAGGGSSNSSVDAVVTRISSLLRDLPTLKATVIVACAFSALLIACLL
FT                   LRVFRLGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR"
FT   gap             11197802..11197821
FT                   /estimated_length=20
FT   gap             11199907..11199926
FT                   /estimated_length=20
FT   gap             11213407..11213426
FT                   /estimated_length=20
FT   gap             11215617..11215636
FT                   /estimated_length=20
FT   gene            complement(11238266..>11270634)
FT                   /locus_tag="mCG_141101"
FT                   /note="gene_id=mCG141101.0"
FT   mRNA            complement(join(11238266..11238319,11264569..11264672,
FT                   11265713..11265776,11267080..11267184,11270139..11270370,
FT                   11270546..>11270634))
FT                   /locus_tag="mCG_141101"
FT                   /product="mCG141101"
FT                   /note="gene_id=mCG141101.0 transcript_id=mCT173108.0
FT                   created on 10-SEP-2002"
FT   gap             11252578..11252597
FT                   /estimated_length=20
FT   CDS             complement(join(11270181..11270370,11270546..>11270631))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141101"
FT                   /product="mCG141101"
FT                   /note="gene_id=mCG141101.0 transcript_id=mCT173108.0
FT                   protein_id=mCP96027.0"
FT                   /protein_id="EDL07124.1"
FT                   /translation="GEVTEGRDRQLFTWPPGPAKKKGSKNRKRKKLAMLGSKELGENKT
FT                   GWEETSVAKCLFHYAYADGILDARVCGTVFVQATVSQEARFASRLN"
FT   gap             11274874..11274893
FT                   /estimated_length=20
FT   gap             11306729..11306748
FT                   /estimated_length=20
FT   gap             11324457..11324487
FT                   /estimated_length=31
FT   gap             11336928..11336978
FT                   /estimated_length=51
FT   gap             11346432..11346485
FT                   /estimated_length=54
FT   gap             11382996..11383057
FT                   /estimated_length=62
FT   gap             11385439..11385458
FT                   /estimated_length=20
FT   gap             11390607..11390626
FT                   /estimated_length=20
FT   gene            complement(11393629..11468372)
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /note="gene_id=mCG113522.0"
FT   mRNA            complement(join(11393629..11397972,11415213..11415506,
FT                   11421259..11421516,11426443..11426571,11431138..11431200,
FT                   11468108..11468372))
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 2"
FT                   /note="gene_id=mCG113522.0 transcript_id=mCT114606.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(11397687..11397972,11415213..11415506,
FT                   11421259..11421516,11426443..11426571,11431138..11431200,
FT                   11468108..11468205))
FT                   /codon_start=1
FT                   /gene="St8sia2"
FT                   /locus_tag="mCG_113522"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 2"
FT                   /note="gene_id=mCG113522.0 transcript_id=mCT114606.0
FT                   protein_id=mCP88967.1"
FT                   /db_xref="GOA:O35696"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:106020"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35696"
FT                   /protein_id="EDL07123.1"
FT                   /translation="MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAV
FT                   NSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFL
FT                   DAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNS
FT                   GVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATW
FT                   REKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRG
FT                   YWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYT
FT                   SQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT"
FT   gap             11431029..11431048
FT                   /estimated_length=20
FT   gap             11465111..11465389
FT                   /estimated_length=279
FT   gap             11468395..11468431
FT                   /estimated_length=37
FT   gap             11470257..11470719
FT                   /estimated_length=463
FT   gap             11503914..11503933
FT                   /estimated_length=20
FT   gap             11520561..11521173
FT                   /estimated_length=613
FT   gap             11537593..11539911
FT                   /estimated_length=2319
FT   gap             11541058..11541933
FT                   /estimated_length=876
FT   gap             11543551..11543859
FT                   /estimated_length=309
FT   gap             11588266..11588697
FT                   /estimated_length=432
FT   gap             11590486..11590661
FT                   /estimated_length=176
FT   gap             11601480..11601730
FT                   /estimated_length=251
FT   gap             11646846..11648047
FT                   /estimated_length=1202
FT   gap             11666557..11667237
FT                   /estimated_length=681
FT   gap             11677083..11677102
FT                   /estimated_length=20
FT   gap             11682052..11682491
FT                   /estimated_length=440
FT   gap             11683747..11685770
FT                   /estimated_length=2024
FT   gap             11687202..11690063
FT                   /estimated_length=2862
FT   gap             11703261..11703596
FT                   /estimated_length=336
FT   gene            complement(11730433..12009567)
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /note="gene_id=mCG141102.1"
FT   mRNA            complement(join(11730433..11730519,11739249..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..>11775482))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT185130"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185130.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(11730437..11730519,11739249..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..>11775482))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_b"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185130.0
FT                   protein_id=mCP106389.0 isoform=CRA_b"
FT                   /protein_id="EDL07120.1"
FT                   /translation="AIRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVRYGNNSARGSA
FT                   LDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPPENASVV
FT                   PGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLR
FT                   LLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILY
FT                   TTTWQCLRKNYKRYIKNHEGGLSTSTEYQDIETEKTCPESQSPSEDSFVRS"
FT   mRNA            complement(join(11736289..11737972,11739062..11739491,
FT                   11752053..11752117,11757973..11758148,11773341..11773479,
FT                   11775367..11775565,11782745..11782909,11801267..11801530,
FT                   11813744..11813842,11959609..11960074,12009434..12009567))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT173109"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT173109.1
FT                   created on 04-JUN-2003"
FT   gap             11738375..11738394
FT                   /estimated_length=20
FT   CDS             complement(join(11739112..11739491,11752053..11752117,
FT                   11757973..11758148,11773341..11773479,11775367..11775565,
FT                   11782745..11782909,11801267..11801530,11813744..11813842,
FT                   11959609..11960074,12009434..12009466))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_a"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT173109.1
FT                   protein_id=mCP96028.0 isoform=CRA_a"
FT                   /protein_id="EDL07119.1"
FT                   /translation="MLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL
FT                   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCATN
FT                   GSSSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSS
FT                   LYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLC
FT                   GALLFFSSLLMFGFPQSLPPHSDPGMESEQAMLPEREYERPKPSNGVLRHPLEPDSSAS
FT                   CFQQLRVIPKVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ
FT                   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPV
FT                   AGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLT
FT                   GCACLTTVPPENASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVS
FT                   PELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYL
FT                   YVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNLGRDPVP
FT                   AHQTHRTKFIYNLEDHEWCENMESVL"
FT   mRNA            complement(join(11750574..11752117,11757973..11758148,
FT                   11773341..11773479,11775367..11775565,11782745..11782909,
FT                   11801267..11801530,11813744..11813842,11959609..11960074,
FT                   12009434..12009567))
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, transcript variant mCT185131"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185131.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(11751997..11752117,11757973..11758148,
FT                   11773341..11773479,11775367..11775565,11782745..11782909,
FT                   11801267..11801530,11813744..11813842,11959609..11960074,
FT                   12009434..12009466))
FT                   /codon_start=1
FT                   /gene="Slco3a1"
FT                   /locus_tag="mCG_141102"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 3a1, isoform CRA_c"
FT                   /note="gene_id=mCG141102.1 transcript_id=mCT185131.0
FT                   protein_id=mCP106388.0 isoform=CRA_c"
FT                   /protein_id="EDL07121.1"
FT                   /translation="MLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALIL
FT                   FVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCATN
FT                   GSSSDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSS
FT                   LYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLC
FT                   GALLFFSSLLMFGFPQSLPPHSDPGMESEQAMLPEREYERPKPSNGVLRHPLEPDSSAS
FT                   CFQQLRVIPKVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQ
FT                   LLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPV
FT                   AGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLT
FT                   GCACLTTVPPENASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVS
FT                   PELKSYALGVLFLLLRLLGTYCLFSPSIMSWMCITR"
FT   gap             11798776..11798879
FT                   /estimated_length=104
FT   gap             11812322..11812379
FT                   /estimated_length=58
FT   gap             11829076..11829100
FT                   /estimated_length=25
FT   gene            11846607..11865936
FT                   /locus_tag="mCG_63340"
FT                   /note="gene_id=mCG63340.2"
FT   mRNA            join(11846607..11846655,11850980..11851208,
FT                   11853717..11853807,11865115..11865936)
FT                   /locus_tag="mCG_63340"
FT                   /product="mCG63340"
FT                   /note="gene_id=mCG63340.2 transcript_id=mCT63523.2 created
FT                   on 10-DEC-2002"
FT   CDS             join(11851137..11851208,11853717..11853807,
FT                   11865115..11865140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63340"
FT                   /product="mCG63340"
FT                   /note="gene_id=mCG63340.2 transcript_id=mCT63523.2
FT                   protein_id=mCP29884.2"
FT                   /protein_id="EDL07122.1"
FT                   /translation="MPLRHRAAHGYHHCGELDRTPACQPLMDRWSVYDPMEVLSLCLQS
FT                   VGHGFATETVGLLRMGG"
FT   gap             11857994..11858205
FT                   /estimated_length=212
FT   gap             11862178..11862413
FT                   /estimated_length=236
FT   gap             11885783..11885898
FT                   /estimated_length=116
FT   gap             11894547..11894566
FT                   /estimated_length=20
FT   gap             11901085..11901104
FT                   /estimated_length=20
FT   gap             11918276..11918600
FT                   /estimated_length=325
FT   gap             11930665..11930684
FT                   /estimated_length=20
FT   gap             11932518..11932558
FT                   /estimated_length=41
FT   gap             11935915..11935934
FT                   /estimated_length=20
FT   gap             11964030..11964049
FT                   /estimated_length=20
FT   gap             11978956..11978975
FT                   /estimated_length=20
FT   gap             12004969..12004988
FT                   /estimated_length=20
FT   gap             12006520..12006618
FT                   /estimated_length=99
FT   gap             12009568..12009782
FT                   /estimated_length=215
FT   gene            <12013908..12014859
FT                   /locus_tag="mCG_1028382"
FT                   /note="gene_id=mCG1028382.0"
FT   mRNA            join(<12013908..12014277,12014650..12014859)
FT                   /locus_tag="mCG_1028382"
FT                   /product="mCG1028382"
FT                   /note="gene_id=mCG1028382.0 transcript_id=mCT146086.0
FT                   created on 12-NOV-2002"
FT   CDS             <12014064..12014222
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028382"
FT                   /product="mCG1028382"
FT                   /note="gene_id=mCG1028382.0 transcript_id=mCT146086.0
FT                   protein_id=mCP88804.0"
FT                   /protein_id="EDL07118.1"
FT                   /translation="LENTVCAELKFVSIPYSLSFPHTSLPDNICLTHPLLTTHYILRFI
FT                   FKLSLLI"
FT   gap             12026630..12026649
FT                   /estimated_length=20
FT   gap             12040778..12040805
FT                   /estimated_length=28
FT   gap             12043595..12044114
FT                   /estimated_length=520
FT   gap             12052460..12054300
FT                   /estimated_length=1841
FT   gap             12063026..12063140
FT                   /estimated_length=115
FT   gap             12064333..12064352
FT                   /estimated_length=20
FT   gap             12076579..12076796
FT                   /estimated_length=218
FT   gap             12079132..12079201
FT                   /estimated_length=70
FT   gap             12134933..12134952
FT                   /estimated_length=20
FT   gap             12136069..12136088
FT                   /estimated_length=20
FT   gap             12186982..12188898
FT                   /estimated_length=1917
FT   gap             12190045..12190854
FT                   /estimated_length=810
FT   gene            12196870..12197999
FT                   /pseudo
FT                   /locus_tag="mCG_1028192"
FT                   /note="gene_id=mCG1028192.0"
FT   mRNA            join(12196870..12197375,12197842..12197999)
FT                   /pseudo
FT                   /locus_tag="mCG_1028192"
FT                   /note="gene_id=mCG1028192.0 transcript_id=mCT145896.0
FT                   created on 12-NOV-2002"
FT   gap             12197453..12197620
FT                   /estimated_length=168
FT   gap             12198179..12199862
FT                   /estimated_length=1684
FT   gap             12202796..12202815
FT                   /estimated_length=20
FT   gap             12208530..12209384
FT                   /estimated_length=855
FT   gap             12211837..12212326
FT                   /estimated_length=490
FT   gap             12214313..12214332
FT                   /estimated_length=20
FT   gap             12215420..12215439
FT                   /estimated_length=20
FT   gap             12264726..12264745
FT                   /estimated_length=20
FT   gap             12271687..12271706
FT                   /estimated_length=20
FT   gap             12273666..12273685
FT                   /estimated_length=20
FT   gap             12278926..12278994
FT                   /estimated_length=69
FT   gene            complement(12289492..>12320013)
FT                   /locus_tag="mCG_64353"
FT                   /note="gene_id=mCG64353.2"
FT   mRNA            complement(join(12289492..12290722,12318654..12318748,
FT                   12319749..>12320013))
FT                   /locus_tag="mCG_64353"
FT                   /product="mCG64353"
FT                   /note="gene_id=mCG64353.2 transcript_id=mCT64536.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(12290575..12290722,12318654..12318748,
FT                   12319749..>12319817))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64353"
FT                   /product="mCG64353"
FT                   /note="gene_id=mCG64353.2 transcript_id=mCT64536.2
FT                   protein_id=mCP29919.2"
FT                   /protein_id="EDL07117.1"
FT                   /translation="DRGHCTASHPHLTPCRCYLSPLQRHRSGVGRRNGMRPRDLIHSPH
FT                   LKPPVHITSRLSASGKEGLCLCKSSLWSLFQCPACMEGESNQCTTAEVMTPCMALSLY"
FT   gene            12352447..12353252
FT                   /pseudo
FT                   /locus_tag="mCG_1028248"
FT                   /note="gene_id=mCG1028248.0"
FT   mRNA            12352447..12353252
FT                   /pseudo
FT                   /locus_tag="mCG_1028248"
FT                   /note="gene_id=mCG1028248.0 transcript_id=mCT145952.1
FT                   created on 26-NOV-2002"
FT   gap             12360393..12363506
FT                   /estimated_length=3114
FT   gap             12364861..12364880
FT                   /estimated_length=20
FT   gap             12365957..12371259
FT                   /estimated_length=5303
FT   gap             12383913..12383932
FT                   /estimated_length=20
FT   gap             12397340..12397359
FT                   /estimated_length=20
FT   gap             12428378..12429531
FT                   /estimated_length=1154
FT   gap             12436090..12437656
FT                   /estimated_length=1567
FT   gap             12464037..12464056
FT                   /estimated_length=20
FT   gap             12475116..12476243
FT                   /estimated_length=1128
FT   gap             12478948..12478967
FT                   /estimated_length=20
FT   gap             12500602..12501543
FT                   /estimated_length=942
FT   gene            12502281..12546103
FT                   /locus_tag="mCG_15697"
FT                   /note="gene_id=mCG15697.1"
FT   mRNA            join(12502281..12502325,12508219..12508508,
FT                   12520957..12521192,12525127..12525408,12526111..12526211,
FT                   12527726..12527832,12533271..12533359,12545750..12546103)
FT                   /locus_tag="mCG_15697"
FT                   /product="mCG15697"
FT                   /note="gene_id=mCG15697.1 transcript_id=mCT18579.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(12508336..12508508,12520957..12521044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15697"
FT                   /product="mCG15697"
FT                   /note="gene_id=mCG15697.1 transcript_id=mCT18579.1
FT                   protein_id=mCP7262.2"
FT                   /protein_id="EDL07116.1"
FT                   /translation="MLARMWRKRKTPPLLVGLQAFTTTLEISLVVPQKIGHSTTGGSHN
FT                   TSPGHISRRCPNRSLEQKLLKSRRRKSFFRVIPGSHGVVTR"
FT   gap             12542753..12542925
FT                   /estimated_length=173
FT   gap             12553349..12553368
FT                   /estimated_length=20
FT   gap             12556103..12556122
FT                   /estimated_length=20
FT   gap             12557167..12557186
FT                   /estimated_length=20
FT   gap             12574851..12575042
FT                   /estimated_length=192
FT   gap             12579662..12579730
FT                   /estimated_length=69
FT   gene            complement(12587092..12774354)
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /note="gene_id=mCG15698.2"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672779,12774245..12774354))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT176113"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176113.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672779,12685664..12685878))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT18580"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT18580.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(12587092..12589974,12592121..12592280,
FT                   12596142..12596311,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12633530..12633617))
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, transcript
FT                   variant mCT176114"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176114.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(12589791..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672397))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_a"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176113.0
FT                   protein_id=mCP99036.0 isoform=CRA_a"
FT                   /protein_id="EDL07113.1"
FT                   /translation="MDDYRYRDNYEGYAPSDGYYRSNEQNQEEDAQSDVTEGHDEEDEI
FT                   YEGEYQGIPHPDDVKSKQTKMAPSRADGLGGQADLMAERMEDEEELAHQYETIIDECGH
FT                   GRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAF
FT                   ILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAY
FT                   FSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVI
FT                   VCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHI
FT                   KTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAVVWFT
FT                   MALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDK
FT                   FIKMYFKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINS
FT                   TFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLIS
FT                   AVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCK
FT                   FGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM"
FT   CDS             complement(join(12589791..12589974,12592121..12592280,
FT                   12596142..12596342,12597700..12597833,12608682..12608846,
FT                   12612462..12612550,12613365..12613475,12619966..12620055,
FT                   12621284..12621417,12628947..12629098,12629609..12629789,
FT                   12671947..12672397))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_a"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT18580.2
FT                   protein_id=mCP7279.2 isoform=CRA_a"
FT                   /protein_id="EDL07115.1"
FT                   /translation="MDDYRYRDNYEGYAPSDGYYRSNEQNQEEDAQSDVTEGHDEEDEI
FT                   YEGEYQGIPHPDDVKSKQTKMAPSRADGLGGQADLMAERMEDEEELAHQYETIIDECGH
FT                   GRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAF
FT                   ILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAY
FT                   FSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVI
FT                   VCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHI
FT                   KTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAVVWFT
FT                   MALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDK
FT                   FIKMYFKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINS
FT                   TFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLIS
FT                   AVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCK
FT                   FGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM"
FT   gap             12594776..12594863
FT                   /estimated_length=88
FT   CDS             complement(join(12596238..12596311,12597700..12597833,
FT                   12608682..12608846,12612462..12612550,12613365..12613475,
FT                   12619966..12620055,12621284..12621417,12628947..12629098,
FT                   12629609..12629769))
FT                   /codon_start=1
FT                   /gene="Sv2b"
FT                   /locus_tag="mCG_15698"
FT                   /product="synaptic vesicle glycoprotein 2 b, isoform CRA_b"
FT                   /note="gene_id=mCG15698.2 transcript_id=mCT176114.0
FT                   protein_id=mCP99035.0 isoform=CRA_b"
FT                   /protein_id="EDL07114.1"
FT                   /translation="MMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFL
FT                   FCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHY
FT                   GWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQV
FT                   HDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNAL
FT                   YCVMGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGA
FT                   TINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIEST
FT                   TFYNTGLSIPPFWSRRRAATWTLKRTMIF"
FT   gap             12607245..12607264
FT                   /estimated_length=20
FT   gap             12616501..12617353
FT                   /estimated_length=853
FT   gap             12654347..12654480
FT                   /estimated_length=134
FT   gap             12726057..12726137
FT                   /estimated_length=81
FT   gap             12737207..12738770
FT                   /estimated_length=1564
FT   gene            <12774639..12795966
FT                   /locus_tag="mCG_1028376"
FT                   /note="gene_id=mCG1028376.1"
FT   mRNA            join(<12774639..12774956,12778114..12778225,
FT                   12795580..12795966)
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, transcript variant mCT146080"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT146080.1
FT                   created on 18-OCT-2002"
FT   CDS             join(12774639..12774956,12778114..12778206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, isoform CRA_a"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT146080.1
FT                   protein_id=mCP88769.1 isoform=CRA_a"
FT                   /protein_id="EDL07111.1"
FT                   /translation="MWKAAINVSSPSWETIYRANSSCAFTPSPGEGHVQRSAQPGAAAS
FT                   APFSVRCFPTLLPFEAFPNNRTQRSQHGSQHARPGSPAPPRESPSPTWVENPQRAGQQP
FT                   NTALAKPHRRQLYQDPFSKILLAYAIVSAFGG"
FT   mRNA            join(<12774735..12774956,12778114..12778225,
FT                   12784283..12784561)
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, transcript variant mCT174577"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT174577.0
FT                   created on 18-OCT-2002"
FT   CDS             join(<12774735..12774956,12778114..12778206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028376"
FT                   /product="mCG1028376, isoform CRA_b"
FT                   /note="gene_id=mCG1028376.1 transcript_id=mCT174577.0
FT                   protein_id=mCP97496.0 isoform=CRA_b"
FT                   /protein_id="EDL07112.1"
FT                   /translation="HVQRSAQPGAAASAPFSVRCFPTLLPFEAFPNNRTQRSQHGSQHA
FT                   RPGSPAPPRESPSPTWVENPQRAGQQPNTALAKPHRRQLYQDPFSKILLAYAIVSAFGG
FT                   "
FT   gap             12788189..12788420
FT                   /estimated_length=232
FT   gap             12789725..12790217
FT                   /estimated_length=493
FT   gap             12799637..12799656
FT                   /estimated_length=20
FT   gap             12805047..12805735
FT                   /estimated_length=689
FT   gap             12806847..12807078
FT                   /estimated_length=232
FT   gap             12822315..12822334
FT                   /estimated_length=20
FT   gap             12823743..12823762
FT                   /estimated_length=20
FT   gap             12827893..12828068
FT                   /estimated_length=176
FT   gap             12839567..12839586
FT                   /estimated_length=20
FT   gap             12844840..12844859
FT                   /estimated_length=20
FT   gap             12852941..12853038
FT                   /estimated_length=98
FT   gap             12856746..12856880
FT                   /estimated_length=135
FT   gap             12859441..12859542
FT                   /estimated_length=102
FT   gap             12863331..12864109
FT                   /estimated_length=779
FT   gap             12865934..12866377
FT                   /estimated_length=444
FT   gap             12868238..12868257
FT                   /estimated_length=20
FT   gap             12884485..12884582
FT                   /estimated_length=98
FT   gap             12893293..12893312
FT                   /estimated_length=20
FT   gap             12903794..12903813
FT                   /estimated_length=20
FT   gap             12905306..12905781
FT                   /estimated_length=476
FT   gap             12911078..12911097
FT                   /estimated_length=20
FT   gene            12921531..13213509
FT                   /locus_tag="mCG_15699"
FT                   /note="gene_id=mCG15699.2"
FT   mRNA            join(12921531..12921635,13000946..13000989,
FT                   13030611..13030758,13040221..13040517,13046876..13047059,
FT                   13063518..13063710,13069216..13072279,13075649..13075776,
FT                   13121709..13121784,13124809..13124945,13136087..13136460,
FT                   13138801..13138854,13142375..13142440,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163460..13163580,13176788..13176855,13179142..13179208,
FT                   13182800..13182935,13184315..13184427,13184983..13185135,
FT                   13185985..13186235,13187811..13187936,13188049..13188166,
FT                   13189378..13189626,13194639..13194670,13195167..13195348,
FT                   13195489..13195571,13198247..13198441,13201528..13201689,
FT                   13202358..13202428,13202857..13202901,13205654..13205704,
FT                   13206472..13206921,13208074..13208404,13209468..13209552,
FT                   13209742..13213509)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT18581"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT18581.2 created
FT                   on 22-OCT-2002"
FT   mRNA            join(12921753..12921982,13000946..13000989,
FT                   13030611..13030758,13040221..13041095)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175210"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175210.0 created
FT                   on 22-OCT-2002"
FT   gap             12954355..12954544
FT                   /estimated_length=190
FT   gap             12985104..12985123
FT                   /estimated_length=20
FT   gap             12999360..12999561
FT                   /estimated_length=202
FT   CDS             join(13000957..13000989,13030611..13030758,
FT                   13040221..13040517,13046876..13047059,13063518..13063710,
FT                   13069216..13072279,13075649..13075776,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13138801..13138854,
FT                   13142375..13142440,13144098..13144290,13146194..13146302,
FT                   13154606..13154648,13156286..13156418,13163460..13163580,
FT                   13176788..13176855,13179142..13179208,13182800..13182935,
FT                   13184315..13184427,13184983..13185135,13185985..13186235,
FT                   13187811..13187936,13188049..13188166,13189378..13189626,
FT                   13194639..13194670,13195167..13195348,13195489..13195571,
FT                   13198247..13198441,13201528..13201689,13202358..13202428,
FT                   13202857..13202901,13205654..13205704,13206472..13206921,
FT                   13208074..13208404,13209468..13209517)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_d"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT18581.2
FT                   protein_id=mCP7304.2 isoform=CRA_d"
FT                   /protein_id="EDL07110.1"
FT                   /translation="MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCT
FT                   STRKVSSDTLETIAPGHDCCETVKVLLCASREGLPVFVVAEEDFHFVQDEAYDAAQFLA
FT                   TSAGNQQALNFTRFLDRSGPPSRDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHDGGP
FT                   RETLMHFAVRLGLLRLTWFLLQKPGGRGALSIHNKEGATPVSLALERGYHELHQLLTEE
FT                   NAGEPDSWSSLSYEIPYGDCSVRHHRELDIYTLTSESESHREPHGDSCTGHISKLMNIQ
FT                   QQLMKTNLKQMDNLMPLMVTAQDSSCVPSVPETDGLFLPCVPEPSDHQHPPFEETKSTL
FT                   CCQRSPGRMAESSCDLSSMVEEENVICSHKKNKDVGRKGEEAEPASAMDSGSASHQDSC
FT                   LQSVPDCGVKGREGLPSCGNRNEVTGTNYSGVATCQQPLSSRSSVLQDAMVTEPDACQH
FT                   SSGRELPDSSSTDVGAPEKAGELEHSLLTPDATTQNNKPQVGEGTKERLENSDSSTTET
FT                   TAVQVLSEPMEKADITNHVFATSAVGVNTPAEASPALSSEEIPTEKPGMETQERGCEGG
FT                   TTSDQSSPVLPAAAIENKVLGGQEPDTSIAGFCKTASPLDLTMPGPSSDGMPEQNSESH
FT                   ARPAQSLSSQALLCSTAEAGTPSAEATHQPSTVTSSGRLEECGSGKASLPESTMVQPST
FT                   QELCTTLCPEDPQADTVTSDTVKNTQKSVGVCHLCVSDAKNQGNGLKQDTPLTNVLEDV
FT                   PRLPSVVSQTEKELAPDQVSPPGSSFSLASSPESESVTKDDALSLVPSQKEKGTATPQL
FT                   HRTTACRDGPDGRDLSDTDKVGDGATDPPPSSAVELRTSMGNTSPVGIGGEQEGSSPTA
FT                   TLEVLSDSLLHNVDKAALVSDFTLPEEGVSVVGPESSTALGQDGKDRAMSCSSVKEDVH
FT                   SSEMSREDQRTPPSGQEIPGLCEKPMSALCAEEKAQQHTPSACLKTETKDIKEVAPQVS
FT                   LLTEGGAAKSLVPPRTSLSADSKQKASSTEQSGSSLLPSGLPGASEALHCNQPSALDVV
FT                   VENTQFQGETNACEVSRSAMEDVTVADASPATAEPRRKDASHCIKDIPVSELLSQEKQM
FT                   TPSLPEAFLDKGVTDLQEVITPEIEPLDCKRETLEGTDLNCATSNSKETPIEKPMQPLA
FT                   RDLPTETGLSVINNNVPQADMKQVAQASVPAEESNATTVSTQAADVSTRADSIEETATR
FT                   IVEAVIRQVRASNALMAKVETQNPSLSSPETKQLENAYTESACAFLPGETPQIEKTHED
FT                   TTGQCGAETEEPEKIILPEPAPEMPDTRTGDEVDLLSRISAASEEEAVGNGAATPKMKQ
FT                   GPGTQAINRESWCAIEPCPEAASLLASKQSSECRSFIDVGLGTECASKEGMLQRVSGSE
FT                   SDLFHSPSDEMDSIIFSKPEEEQLLCDTTGSSSSTDDTASLDRHSSHGSDVSLPQTSKL
FT                   NRSRNHQSANGFFSPGVEAPESRESESEPAGSGEMEEEEMDSITEVPANCSFLRSSMRS
FT                   LSPFRRHSWGPGKNAASDAEMNQRSSMRALGHVVRRPPIHRRSMSWCPSGVQYSAALNA
FT                   DFNIRSFSLEGLTGGGVGNKPSSSLEMSSANSSELRNPFGGEEQRNSLMSLSEEHLEPD
FT                   QRQHHRMFDQQTCYRSKQQGFNYCTSAISSPLTKSISLMTISHPGLDSSRPFHSTSANL
FT                   TESITEENCNFLPPSPSKKNFEEKSGTKVSRTFSYIRNKMSSSKKSKKEKDKKTLNGHT
FT                   FSPIPIVGPISCSQCMKPFTNKDAYTCAGCGAFVHKGCRENLASCAKVKMKQPKGSLQA
FT                   HDTSSLPTVIMRNKSSQPKERPRSAVLLADEATAAPMFTNRRSQQSVSLSKSVSIQNIT
FT                   GVGNDENMSNTWKFLSHSTDSLNKICKVNESTESLTDEGVGTDMNEGQLMGDFESDSKQ
FT                   LEAESWSRTVDSKFLKQQKKDVVKRQEVIYELMQTELHHIRTLKIMSDVYSRGMMTDLL
FT                   FEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVSQFSGE
FT                   SAERLKKTYGKFCGQHNQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRLGIPECILLVT
FT                   QRITKYPVLFQRILQCTKDNEVEQEDLTQSLSLVKDVIGAVDSKVASYEKKVRLGEIYT
FT                   KTDSKSIMRMKSGQMFAKEDLRRKKLVRDGSVFLKSTTGRLKEKDQKYVFASLDHKSTV
FT                   ISLKKLIVREVAHEEKGLFLISMGVKDPEMVEVHASSREERNSWIQIIQDTINSLNRDE
FT                   DEGIPSENEEEKKLLDTKARELKEQLQQKDQQILLLLEEKEMIFRDMTECSTPLPEDCS
FT                   PTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQSLVSGSLGGTLGQSISSPVEQEVMA
FT                   APISLPRRAETFGGFDCHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNGNLVFMLK
FT                   RNSEQVVQSIVHLHELLSMLQGVVLQQDSYIEDQKLVLTEKVLTRSASRPSSLIEQEKQ
FT                   RSLEKQRQDLANLQKQQAQHLEEKRRREREWEAREQELRDREAKLAEREETVRRRQQDL
FT                   ERDREELQQKKGTYQCDLERLRAAQKQLEREQEQLRRDTERLSQRQMDQNLCQVSNKHG
FT                   RLMRIPSFLPNSDEFSSPSAPSVTKSGSLDSELSVSPKRNSISRTQKDKGPFHILGSAS
FT                   QTKVPEGQSQAPSSTSTSTRLFGLSKPKEKKEKKKKSKGSRTQPGDGPASEVPAEGEEI
FT                   FC"
FT   CDS             join(13000957..13000989,13030611..13030758,
FT                   13040221..13040726)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_c"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175210.0
FT                   protein_id=mCP98128.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D9W9"
FT                   /db_xref="InterPro:IPR028852"
FT                   /db_xref="MGI:MGI:2676556"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9W9"
FT                   /protein_id="EDL07109.1"
FT                   /translation="MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCT
FT                   STRKVSSDTLETIAPGHDCCETVKVLLCASREGLPVFVVAEEDFHFVQDEAYDAAQFLA
FT                   TSAGNQQALNFTRFLDRSGPPSRDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHGEKP
FT                   QTYKLPWNTSAFPFKQPLWFKPPRWLSKLEFLRSIFFFQVHSLSRLAHLCASGLTAQAR
FT                   RVVDGS"
FT   gap             13007642..13007661
FT                   /estimated_length=20
FT   gap             13091833..13092264
FT                   /estimated_length=432
FT   gap             13092934..13093103
FT                   /estimated_length=170
FT   mRNA            join(<13101617..13101763,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163406..>13163459)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175209"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175209.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(<13101617..13101763,13121709..13121784,
FT                   13124809..13124945,13136087..13136460,13144098..13144290,
FT                   13146194..13146302,13154606..13154648,13156286..13156418,
FT                   13163406..>13163459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_b"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175209.0
FT                   protein_id=mCP98127.0 isoform=CRA_b"
FT                   /protein_id="EDL07108.1"
FT                   /translation="HWSLDSADIRLHFVSSFLHLYKMYERHKRRYSLCDISKVDRTVDV
FT                   VLLKINRESWCAIEPCPEAASLLASKQSSECRSFIDVGLGTECASKEGMLQRVSGSESD
FT                   LFHSPSDEMDSIIFSKPEEEQLLCDTTGSSSSTDDTASLDRHSSHGSDVSLPQTSKLNR
FT                   SRNHQSANGFFSPGVEAPESRESESEPAGSGEMEEEEMDSITEVPANCSFLRSSMRSLS
FT                   PFRRHSWGPGKNAASDAEMNQRSFSLEGLTGGGVGNKPSSSLEMSSANSSELRNPFGGE
FT                   EQRNSLMSLSEEHLEPDQRQHHRMFDQQTCYRSKQQGFNYCTSAISSPLTKSISLMTIS
FT                   HPGLDSSRPFHSTSANLTESITEENCNFLPPSPSKKNFEEKSGTKVSRTFSYIRNKMSS
FT                   SKKSKEKEKEKDKIKEKEKDSKE"
FT   gap             13117378..13117459
FT                   /estimated_length=82
FT   gap             13130133..13130152
FT                   /estimated_length=20
FT   gap             13132170..13132189
FT                   /estimated_length=20
FT   gap             13156577..13156726
FT                   /estimated_length=150
FT   mRNA            join(<13161040..13161193,13163406..13163580,
FT                   13176788..13177066)
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, transcript variant mCT175208"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175208.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(<13161089..13161193,13163406..13163580,
FT                   13176788..13176864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15699"
FT                   /product="mCG15699, isoform CRA_a"
FT                   /note="gene_id=mCG15699.2 transcript_id=mCT175208.0
FT                   protein_id=mCP98129.0 isoform=CRA_a"
FT                   /protein_id="EDL07107.1"
FT                   /translation="EDISWHGGQIMSVKWGRLPEVPLITVRFTGLKHGQEKEKEKDKIK
FT                   EKEKDSKEKEKDKKTLNGHTFSPIPIVGPISCSQCMKPFTNKDAYTCAGCGAFVHKGCR
FT                   ENLASCAKVKMKVR"
FT   gap             13172538..13172557
FT                   /estimated_length=20
FT   gap             13192875..13193368
FT                   /estimated_length=494
FT   gap             13225223..13225383
FT                   /estimated_length=161
FT   gene            <13225422..13235733
FT                   /locus_tag="mCG_1028373"
FT                   /note="gene_id=mCG1028373.0"
FT   mRNA            join(<13225422..13225523,13235330..13235733)
FT                   /locus_tag="mCG_1028373"
FT                   /product="mCG1028373"
FT                   /note="gene_id=mCG1028373.0 transcript_id=mCT176109.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<13225440..13225523,13235330..13235620)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028373"
FT                   /product="mCG1028373"
FT                   /note="gene_id=mCG1028373.0 transcript_id=mCT176109.0
FT                   protein_id=mCP99031.0"
FT                   /protein_id="EDL07105.1"
FT                   /translation="SQHSGGRGRRISEFEASLVYKVSSRTTRGYTEKPCLEKPKKKKET
FT                   GKSAVGHLWIVGMVEEPGESGGLYWGHSRLLRVLSSCPNLYHCMVIEELGSSPRHMVKF
FT                   PRFFLHSSGNFHKSQKCSRV"
FT   gene            complement(<13227955..>13232803)
FT                   /locus_tag="mCG_1028374"
FT                   /note="gene_id=mCG1028374.0"
FT   mRNA            complement(join(<13227955..13228144,13232579..>13232803))
FT                   /locus_tag="mCG_1028374"
FT                   /product="mCG1028374"
FT                   /note="gene_id=mCG1028374.0 transcript_id=mCT146078.0
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(<13227955..13228144,13232579..>13232764))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028374"
FT                   /product="mCG1028374"
FT                   /note="gene_id=mCG1028374.0 transcript_id=mCT146078.0
FT                   protein_id=mCP89054.0"
FT                   /protein_id="EDL07106.1"
FT                   /translation="PKNSGKSPSAKEMGAAVLNLWVATVGIAVQSRDRTAAVACQLDDV
FT                   SKGWVHHDMGTVWKNLAARGQEIHQDICLDLMGNAVALWVCLFKPKCDDLLPVSGNPGV
FT                   DLARVYHPEQYVNKACFILVS"
FT   gap             13238986..13239732
FT                   /estimated_length=747
FT   gap             13241191..13241210
FT                   /estimated_length=20
FT   gap             13242493..13242515
FT                   /estimated_length=23
FT   gap             13246036..13246138
FT                   /estimated_length=103
FT   gap             13261040..13261169
FT                   /estimated_length=130
FT   gap             13262475..13262732
FT                   /estimated_length=258
FT   gap             13266064..13266083
FT                   /estimated_length=20
FT   gap             13268857..13268876
FT                   /estimated_length=20
FT   gap             13270328..13273490
FT                   /estimated_length=3163
FT   gap             13274471..13275206
FT                   /estimated_length=736
FT   gap             13277096..13277224
FT                   /estimated_length=129
FT   gap             13277948..13277967
FT                   /estimated_length=20
FT   gene            13306152..13335132
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /note="gene_id=mCG53536.2"
FT   mRNA            join(13306152..13306244,13326081..13328189)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT53719"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT53719.1 created
FT                   on 12-NOV-2002"
FT   mRNA            join(<13306157..13306233,13333700..13334528)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT176119"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176119.0 created
FT                   on 12-NOV-2002"
FT   CDS             join(<13306180..13306233,13333700..13333987)
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176119.0
FT                   protein_id=mCP99041.0 isoform=CRA_a"
FT                   /protein_id="EDL07102.1"
FT                   /translation="AGRGRRQRRGLQSLWGRTTAWFLLPGPEADSSSPGRQQLKLSLTL
FT                   GREMKFSSVTCALVSKAGSGSCGEKRPEARAGTSNQRHLCRALRLIVTQAWQWLPGKSR
FT                   GPLAQQHSL"
FT   gap             13324108..13324156
FT                   /estimated_length=49
FT   CDS             13326092..13327861
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT53719.1
FT                   protein_id=mCP29847.2 isoform=CRA_c"
FT                   /protein_id="EDL07104.1"
FT                   /translation="MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMF
FT                   TDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDF
FT                   AYSSRIVINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLSPSNCLGMMVLSDAHQCRR
FT                   LYEFSCRMSLVHFETVRQSEDFNSLSRDTLLDLISRDELETEDERVVFEAILQWVKHDL
FT                   EQRKAHLPLLLRNVRLALLPSDCLKNAVSGEALLMADECTKLILDEAFRCKTKILLNDG
FT                   VVTSPFARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGC
FT                   KVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSL
FT                   AGIFPASPSVSLKQVEKYDPGDNKWTMVAPMRDGVSNAAVVSAKLKLFVFGGTSIHRDM
FT                   VSKVQCFDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEYTAASAYRFDCETNQ
FT                   WTRIGDMTAKRMSCHAVASGNKLYVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLI
FT                   PTAFVSTWKHLPA"
FT   mRNA            join(<13327807..13327885,13333700..13335132)
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), transcript variant
FT                   mCT176120"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176120.0 created
FT                   on 12-NOV-2002"
FT   gap             13329066..13329131
FT                   /estimated_length=66
FT   CDS             <13334196..13334831
FT                   /codon_start=1
FT                   /gene="Klhl25"
FT                   /locus_tag="mCG_53536"
FT                   /product="kelch-like 25 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG53536.2 transcript_id=mCT176120.0
FT                   protein_id=mCP99042.0 isoform=CRA_b"
FT                   /protein_id="EDL07103.1"
FT                   /translation="LPLLRGDFWEASMDIGQMPVTSQTLLRVPQQDSRSPSAGRGLMLA
FT                   LLRGTEEQHDIPASSTGPLFWTPTCLSLVSCLLHKRAVMSRMAEGLPRSLQFAQRLYCC
FT                   HCGSRTKAPIMPAILLGTSWQPESCLIFFLELRKKDPKKLPKCVSQGFLPSVSPALGFR
FT                   RHFLLMPVWIPGSSLVCLVLLVSGTGWGVFHRWWLPITASGRSIQSGF"
FT   gap             13338866..13338927
FT                   /estimated_length=62
FT   gap             13405498..13405517
FT                   /estimated_length=20
FT   gap             13410848..13410867
FT                   /estimated_length=20
FT   gap             13423710..13423729
FT                   /estimated_length=20
FT   gap             13425382..13425401
FT                   /estimated_length=20
FT   gap             13427966..13427985
FT                   /estimated_length=20
FT   gap             13429151..13429170
FT                   /estimated_length=20
FT   gap             13430187..13430206
FT                   /estimated_length=20
FT   gap             13431293..13431312
FT                   /estimated_length=20
FT   gap             13432850..13432869
FT                   /estimated_length=20
FT   gap             13434242..13434261
FT                   /estimated_length=20
FT   gap             13441390..13447665
FT                   /estimated_length=6276
FT   gap             13457157..13457241
FT                   /estimated_length=85
FT   gap             13468632..13469188
FT                   /estimated_length=557
FT   gap             13469974..13471413
FT                   /estimated_length=1440
FT   gap             13485623..13485642
FT                   /estimated_length=20
FT   gap             13486943..13486962
FT                   /estimated_length=20
FT   gap             13491450..13491709
FT                   /estimated_length=260
FT   gap             13495319..13495338
FT                   /estimated_length=20
FT   gap             13498575..13498594
FT                   /estimated_length=20
FT   gap             13521899..13528342
FT                   /estimated_length=6444
FT   gap             13529447..13530151
FT                   /estimated_length=705
FT   gap             13531164..13531183
FT                   /estimated_length=20
FT   gap             13532892..13537096
FT                   /estimated_length=4205
FT   gap             13538414..13538489
FT                   /estimated_length=76
FT   gap             13548668..13548768
FT                   /estimated_length=101
FT   gap             13567667..13570564
FT                   /estimated_length=2898
FT   gap             13572493..13572512
FT                   /estimated_length=20
FT   gap             13595424..13595443
FT                   /estimated_length=20
FT   gap             13597368..13597563
FT                   /estimated_length=196
FT   gap             13605929..13606190
FT                   /estimated_length=262
FT   gap             13610108..13610127
FT                   /estimated_length=20
FT   gap             13631445..13631464
FT                   /estimated_length=20
FT   gap             13653845..13653864
FT                   /estimated_length=20
FT   gap             13655671..13655690
FT                   /estimated_length=20
FT   gap             13694077..13696101
FT                   /estimated_length=2025
FT   gap             13697229..13701402
FT                   /estimated_length=4174
FT   gap             13719102..13719121
FT                   /estimated_length=20
FT   gap             13729089..13730623
FT                   /estimated_length=1535
FT   gap             13745262..13745281
FT                   /estimated_length=20
FT   gap             13759126..13759145
FT                   /estimated_length=20
FT   gene            <13837663..>13931263
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /note="gene_id=mCG55764.2"
FT   mRNA            join(<13837663..13837765,13838254..13838380,
FT                   13838702..13838739,13839052..13839201,13862125..13862333,
FT                   13866498..13866663,13867619..13867683,13873411..13873527,
FT                   13874546..13875126,13876581..13876664,13876890..13876976,
FT                   13879380..13879528,13880565..13880652,13888082..13888226,
FT                   13901291..13901444,13918268..13918427,13918571..13918689,
FT                   13931154..>13931263)
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /product="hypothetical protein D430020F16"
FT                   /note="gene_id=mCG55764.2 transcript_id=mCT55947.2 created
FT                   on 12-NOV-2002"
FT   CDS             join(13837663..13837765,13838254..13838380,
FT                   13838702..13838739,13839052..13839201,13862125..13862333,
FT                   13866498..13866663,13867619..13867683,13873411..13873527,
FT                   13874546..13875126,13876581..13876664,13876890..13876976,
FT                   13879380..13879528,13880565..13880652,13888082..13888226,
FT                   13901291..13901444,13918268..13918427,13918571..13918689,
FT                   13931154..13931263)
FT                   /codon_start=1
FT                   /gene="D430020F16"
FT                   /locus_tag="mCG_55764"
FT                   /product="hypothetical protein D430020F16"
FT                   /note="gene_id=mCG55764.2 transcript_id=mCT55947.2
FT                   protein_id=mCP29832.2"
FT                   /protein_id="EDL07101.1"
FT                   /translation="MVQQGTDPTGPPGKSVEMALMQPNKPIIDTPQCARVSGSGSWHKT
FT                   AVFPMHSQALPPNRPSESPRFQVQIEKLYTGWAAAEVLAALLKSRVSEAEQSGECLPPK
FT                   RNTLSRESCQSRNSTLRHQALTYISSEHKEGDFWWESNCRRAVNRGYVNSLLRLHQDWH
FT                   SRDVTNTYVTIRHGLLLCLRHIVALRSGREAFLAAQGMETLFSIAQTCLENKNMELVIS
FT                   AVIQILRQCYPASRLPLVTASSAYTFPAPGSTSSELPLNLTEEDFDDDGDEEMDKDSDV
FT                   EVVKEDDDLETDLSKLSSKPGLDLPEEELAQYDAMCPELSCSFEELEPKCGDDLNNKDT
FT                   LHANHHHIPSVASLRQHCFNREHSSWRQEREDTVHSSILHMVKTGKSGVPSSSKQRSAT
FT                   NVNQSLQQNGLEINSSGHDTSDIQAPLEQAAWDMEAISCPRITASFPNSTKPEESIGAA
FT                   EKLLHTHAKHIPFHDPHLYIANAMRTRSAVGFKTMAFPDLWGHCPPPAAQPMLDRKLGV
FT                   QRIKILEDIRRLLHPSDVINKVVFSLDEPRPLQGSISNCLRFHSKFESGNLRKAIQVRE
FT                   FEYDLLVNADVNSSQHQQWFYFKVSGMRAAVPYHFNIINCEKPNSQFNYGMQLTLYSVK
FT                   EALLGRPAWIRTGSDICYYKNHYRQNAATMDGALGKRYYTLTFAVTFPHNEDACYLAYH
FT                   YPYTYSTLMTHLEILERSIDHREIYFRHDVLCQTLGGNPCPLVTITAFPESNSTEHLEQ
FT                   FLLACDMLDADFDLCSSLPSLLYGGVLGVCVGDGERLAEDRQGKCFFHPTAMVERAHST
FT                   GLLLLQILLDFAVMSAAALSSVVPSKKSSLMVEKVAGFLWLIEHPGGSCGFDIPEFYRA
FT                   RATSTCSDALPV"
FT   gap             13850538..13851059
FT                   /estimated_length=522
FT   gap             13868790..13869749
FT                   /estimated_length=960
FT   gap             13870911..13870930
FT                   /estimated_length=20
FT   gap             13892941..13894396
FT                   /estimated_length=1456
FT   gap             13895096..13896303
FT                   /estimated_length=1208
FT   gap             13912485..13912504
FT                   /estimated_length=20
FT   gap             13921363..13927807
FT                   /estimated_length=6445
FT   gap             13935564..13935583
FT                   /estimated_length=20
FT   gap             13942204..13942223
FT                   /estimated_length=20
FT   gap             13943396..13943415
FT                   /estimated_length=20
FT   gap             13945068..13945637
FT                   /estimated_length=570
FT   gap             13957470..13957489
FT                   /estimated_length=20
FT   gap             14002305..14002324
FT                   /estimated_length=20
FT   gap             14021604..14022157
FT                   /estimated_length=554
FT   gap             14033275..14036978
FT                   /estimated_length=3704
FT   gap             14038451..14038616
FT                   /estimated_length=166
FT   gap             14053639..14053658
FT                   /estimated_length=20
FT   gap             14072343..14072506
FT                   /estimated_length=164
FT   gap             14078996..14079015
FT                   /estimated_length=20
FT   gap             14101396..14101491
FT                   /estimated_length=96
FT   gap             14140708..14143045
FT                   /estimated_length=2338
FT   gap             14151546..14151565
FT                   /estimated_length=20
FT   gap             14162326..14162509
FT                   /estimated_length=184
FT   gap             14171684..14174090
FT                   /estimated_length=2407
FT   gap             14206357..14206376
FT                   /estimated_length=20
FT   gap             14222386..14222405
FT                   /estimated_length=20
FT   gap             14223693..14223712
FT                   /estimated_length=20
FT   gap             14226234..14226253
FT                   /estimated_length=20
FT   gap             14249347..14249366
FT                   /estimated_length=20
FT   gap             14295772..14295791
FT                   /estimated_length=20
FT   gap             14312351..14313257
FT                   /estimated_length=907
FT   gap             14366724..14366749
FT                   /estimated_length=26
FT   gap             14394017..14394810
FT                   /estimated_length=794
FT   gap             14396875..14396894
FT                   /estimated_length=20
FT   gap             14406552..14406571
FT                   /estimated_length=20
FT   gap             14411968..14412483
FT                   /estimated_length=516
FT   gap             14416500..14416519
FT                   /estimated_length=20
FT   gap             14418087..14418106
FT                   /estimated_length=20
FT   gap             14449790..14449809
FT                   /estimated_length=20
FT   gap             14470123..14470179
FT                   /estimated_length=57
FT   gap             14498220..14498292
FT                   /estimated_length=73
FT   gap             14507157..14507405
FT                   /estimated_length=249
FT   gap             14531263..14531282
FT                   /estimated_length=20
FT   gap             14532707..14532726
FT                   /estimated_length=20
FT   gap             14558487..14558848
FT                   /estimated_length=362
FT   gap             14569348..14569367
FT                   /estimated_length=20
FT   gap             14571850..14571961
FT                   /estimated_length=112
FT   gap             14589491..14589510
FT                   /estimated_length=20
FT   gap             14591147..14591166
FT                   /estimated_length=20
FT   gap             14592433..14592452
FT                   /estimated_length=20
FT   gap             14598373..14598483
FT                   /estimated_length=111
FT   gap             14674350..14674512
FT                   /estimated_length=163
FT   gap             14730004..14730023
FT                   /estimated_length=20
FT   gap             14732074..14732259
FT                   /estimated_length=186
FT   gap             14763958..14763977
FT                   /estimated_length=20
FT   gap             14790122..14790207
FT                   /estimated_length=86
FT   gap             14792943..14793382
FT                   /estimated_length=440
FT   gap             14818679..14818698
FT                   /estimated_length=20
FT   gap             14834127..14834146
FT                   /estimated_length=20
FT   gap             14860629..14860648
FT                   /estimated_length=20
FT   gap             14861729..14861922
FT                   /estimated_length=194
FT   gap             14910267..14913003
FT                   /estimated_length=2737
FT   gap             14916786..14916888
FT                   /estimated_length=103
FT   gap             14919986..14920568
FT                   /estimated_length=583
FT   gap             14925284..14925392
FT                   /estimated_length=109
FT   gap             14958629..14959360
FT                   /estimated_length=732
FT   gap             14960438..14961955
FT                   /estimated_length=1518
FT   gap             14994697..14994777
FT                   /estimated_length=81
FT   gap             14994991..14995010
FT                   /estimated_length=20
FT   gap             14997790..14997834
FT                   /estimated_length=45
FT   gap             15000675..15000919
FT                   /estimated_length=245
FT   gap             15026168..15026430
FT                   /estimated_length=263
FT   gap             15086666..15086685
FT                   /estimated_length=20
FT   gap             15107281..15117381
FT                   /estimated_length=10101
FT   gap             15130739..15130855
FT                   /estimated_length=117
FT   gap             15193249..15193268
FT                   /estimated_length=20
FT   gap             15223162..15223587
FT                   /estimated_length=426
FT   gap             15229526..15229545
FT                   /estimated_length=20
FT   gap             15260121..15260285
FT                   /estimated_length=165
FT   gap             15262743..15262762
FT                   /estimated_length=20
FT   gap             15272608..15272659
FT                   /estimated_length=52
FT   gap             15327484..15327503
FT                   /estimated_length=20
FT   gap             15329288..15329307
FT                   /estimated_length=20
FT   gap             15338733..15338752
FT                   /estimated_length=20
FT   gap             15364254..15364273
FT                   /estimated_length=20
FT   gap             15368322..15368958
FT                   /estimated_length=637
FT   gap             15370999..15371018
FT                   /estimated_length=20
FT   gap             15372533..15376563
FT                   /estimated_length=4031
FT   gap             15377662..15377681
FT                   /estimated_length=20
FT   gap             15386914..15387113
FT                   /estimated_length=200
FT   gap             15389059..15389550
FT                   /estimated_length=492
FT   gap             15393909..15393928
FT                   /estimated_length=20
FT   gap             15405890..15405916
FT                   /estimated_length=27
FT   gap             15408667..15408686
FT                   /estimated_length=20
FT   gap             15435742..15435850
FT                   /estimated_length=109
FT   gap             15439409..15439428
FT                   /estimated_length=20
FT   gap             15451821..15452200
FT                   /estimated_length=380
FT   gap             15453613..15453632
FT                   /estimated_length=20
FT   gap             15510552..15510571
FT                   /estimated_length=20
FT   gap             15530190..15530450
FT                   /estimated_length=261
FT   gap             15579625..15579737
FT                   /estimated_length=113
FT   gap             15591388..15613685
FT                   /estimated_length=22298
FT   gap             15625636..15626367
FT                   /estimated_length=732
FT   gap             15639123..15639142
FT                   /estimated_length=20
FT   gap             15656412..15656431
FT                   /estimated_length=20
FT   gap             15670544..15670681
FT                   /estimated_length=138
FT   gene            <15674405..15675764
FT                   /locus_tag="mCG_1028362"
FT                   /note="gene_id=mCG1028362.0"
FT   mRNA            join(<15674405..15674678,15674939..15675764)
FT                   /locus_tag="mCG_1028362"
FT                   /product="mCG1028362"
FT                   /note="gene_id=mCG1028362.0 transcript_id=mCT146066.0
FT                   created on 17-OCT-2002"
FT   CDS             join(<15674638..15674678,15674939..15675203)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028362"
FT                   /product="mCG1028362"
FT                   /note="gene_id=mCG1028362.0 transcript_id=mCT146066.0
FT                   protein_id=mCP88777.0"
FT                   /protein_id="EDL07100.1"
FT                   /translation="PCRWGSDGLFTKTGTCCHFSSVRFTDLYRRKMGHHRMNKCPYPAY
FT                   HCLPVIFSMKSQLLKGHGHKMSALPISFYFFSPTLCILSFTFFDLTGLSKPLDLFI"
FT   gene            complement(15722621..15999044)
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /note="gene_id=mCG9459.2"
FT   mRNA            complement(join(15722621..15722742,15724287..15724421,
FT                   15776072..15776260,15872304..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15999044))
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   transcript variant mCT173136"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT173136.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(15722624..15722742,15724287..15724421,
FT                   15776072..15776260,15872304..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15998786))
FT                   /codon_start=1
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT173136.0
FT                   protein_id=mCP96055.0 isoform=CRA_a"
FT                   /protein_id="EDL07098.1"
FT                   /translation="MGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTI
FT                   KNSGLRNIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIR
FT                   WMQLWQEQGEARLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAV
FT                   ITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAE
FT                   NVVGMSNASVALTVYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESK
FT                   IIHMDYYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTD
FT                   FFDFESDASPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGM
FT                   KGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNC
FT                   HKPDTWVFSNIDNHGILNLKDNRDHLVPSTHYIYEEPEVQSGDVSYPRSHGFREIMLNP
FT                   ISLSGHSKPLNHGIYVEDVNVYFSKGRHGF"
FT   gap             15745446..15745520
FT                   /estimated_length=75
FT   gap             15780082..15780101
FT                   /estimated_length=20
FT   gap             15806532..15808144
FT                   /estimated_length=1613
FT   gap             15812695..15813275
FT                   /estimated_length=581
FT   gap             15841243..15844284
FT                   /estimated_length=3042
FT   gap             15860262..15860342
FT                   /estimated_length=81
FT   gap             15865742..15865987
FT                   /estimated_length=246
FT   mRNA            complement(join(15871042..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15999044))
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   transcript variant mCT9047"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT9047.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(15872191..15872406,15873308..15873372,
FT                   15874740..15874763,15881690..15881986,15882454..15882595,
FT                   15882995..15883137,15884194..15884351,15899291..15899359,
FT                   15937807..15937878,15938497..15938571,15998734..15998786))
FT                   /codon_start=1
FT                   /gene="Ntrk3"
FT                   /locus_tag="mCG_9459"
FT                   /product="neurotrophic tyrosine kinase, receptor, type 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9459.2 transcript_id=mCT9047.2
FT                   protein_id=mCP7365.2 isoform=CRA_b"
FT                   /protein_id="EDL07099.1"
FT                   /translation="MGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTI
FT                   KNSGLRNIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIR
FT                   WMQLWQEQGEARLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAV
FT                   ITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAE
FT                   NVVGMSNASVALTVYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESK
FT                   IIHMDYYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTD
FT                   FFDFESDASPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGM
FT                   KGKVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW"
FT   gap             15900842..15904093
FT                   /estimated_length=3252
FT   gap             15950857..15950893
FT                   /estimated_length=37
FT   gap             15973919..15973938
FT                   /estimated_length=20
FT   gap             15975233..15975317
FT                   /estimated_length=85
FT   gap             15999045..15999702
FT                   /estimated_length=658
FT   gene            15999995..16000675
FT                   /locus_tag="mCG_147200"
FT                   /note="gene_id=mCG147200.0"
FT   mRNA            15999995..16000675
FT                   /locus_tag="mCG_147200"
FT                   /product="mCG147200"
FT                   /note="gene_id=mCG147200.0 transcript_id=mCT187463.0
FT                   created on 13-JAN-2004"
FT   CDS             16000374..16000556
FT                   /codon_start=1
FT                   /locus_tag="mCG_147200"
FT                   /product="mCG147200"
FT                   /note="gene_id=mCG147200.0 transcript_id=mCT187463.0
FT                   protein_id=mCP109607.0"
FT                   /protein_id="EDL07097.1"
FT                   /translation="MRRAFFGKHHASTVGGQLLGLSPRVRRAGSLVRGWADCSLRMIWG
FT                   AQNLLFPSPTNTPSW"
FT   gene            complement(16002220..16158774)
FT                   /locus_tag="mCG_57387"
FT                   /note="gene_id=mCG57387.2"
FT   mRNA            complement(join(16002220..16003913,16006586..16006655,
FT                   16015564..16015751,16078804..16078904,16081799..16081853,
FT                   16104539..16104731,16130259..16130361,16131740..16131797,
FT                   16133017..16133324,16134899..16135079,16138833..16138973))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT57570"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT57570.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(16003905..16003913,16006586..16006655,
FT                   16015564..16015730))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_b"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT57570.2
FT                   protein_id=mCP29881.2 isoform=CRA_b"
FT                   /protein_id="EDL07095.1"
FT                   /translation="MCWKQTPSRTGRFTISSLEKPLKKPSPSPWRKQDLEWSDSIHVGM
FT                   STEQTPCGRRRRKRSDACYEWRCFLDFPCLRNHEGS"
FT   mRNA            complement(join(16008534..16008996,16015564..16015751,
FT                   16078804..16078904,16079033..16079150,16081799..16081853,
FT                   16104539..16104731,16152469..16152693,16158684..16158774))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT176108"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT176108.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(16008930..16008996,16015564..16015730))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_c"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT176108.1
FT                   protein_id=mCP99030.1 isoform=CRA_c"
FT                   /protein_id="EDL07096.1"
FT                   /translation="MCWKQTPSRTGRFTISSLEKPLKKPSPSPWRKQDLEWSDSIHVGM
FT                   STEQTPCGRRRKAPTNTPRGVLSRRLQIQASR"
FT   gap             16018551..16018570
FT                   /estimated_length=20
FT   gap             16033067..16033086
FT                   /estimated_length=20
FT   gap             16035783..16036391
FT                   /estimated_length=609
FT   gap             16045600..16045619
FT                   /estimated_length=20
FT   gap             16056422..16056441
FT                   /estimated_length=20
FT   gap             16080202..16080221
FT                   /estimated_length=20
FT   gap             16084184..16084225
FT                   /estimated_length=42
FT   gap             16085005..16085100
FT                   /estimated_length=96
FT   gap             16103964..16103983
FT                   /estimated_length=20
FT   gap             16108762..16108785
FT                   /estimated_length=24
FT   gap             16135942..16136032
FT                   /estimated_length=91
FT   mRNA            complement(join(16147460..16148258,16152469..16152693,
FT                   16158684..16158766))
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, transcript variant mCT146064"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT146064.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(16147548..16147715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57387"
FT                   /product="mCG57387, isoform CRA_a"
FT                   /note="gene_id=mCG57387.2 transcript_id=mCT146064.1
FT                   protein_id=mCP88762.1 isoform=CRA_a"
FT                   /protein_id="EDL07094.1"
FT                   /translation="MVQWLRALTALPEVPSSIPSSHMVAYDHQQWGLMLSSGVFDESNG
FT                   ELKKRVQNVK"
FT   gap             16168476..16168699
FT                   /estimated_length=224
FT   gap             16176633..16176652
FT                   /estimated_length=20
FT   gene            complement(16196125..16203829)
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /note="gene_id=mCG6297.1"
FT   mRNA            complement(join(16196125..16196507,16201219..16201392,
FT                   16202181..16202367,16203588..16203829))
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /product="mitochondrial ribosomal protein L46"
FT                   /note="gene_id=mCG6297.1 transcript_id=mCT5363.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16196239..16196507,16201219..16201392,
FT                   16202181..16202367,16203588..16203809))
FT                   /codon_start=1
FT                   /gene="Mrpl46"
FT                   /locus_tag="mCG_6297"
FT                   /product="mitochondrial ribosomal protein L46"
FT                   /note="gene_id=mCG6297.1 transcript_id=mCT5363.1
FT                   protein_id=mCP7351.1"
FT                   /protein_id="EDL07093.1"
FT                   /translation="MAAPVGRTLLGLARGWRQLDRFWAGSSRGLSLEAASSSSRSPWRL
FT                   SGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKADLY
FT                   DEEQEQGITLAQDLEDMWEQAFLQFRPGARETEADKKNDRTSLHRKLDRNLVLLVREKL
FT                   GDQDVWMLPQVEWQPGETLRGTAERILATLSENNMEAKFLGNAPCGHYKFKFPKAIQTE
FT                   SDLGVKVFFFKALLLTGDFVQAGKKSRHVWASKEELGDYLQPKYLAQVRRFLLDSDGLS
FT                   CL"
FT   gene            16204072..16213768
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /note="gene_id=mCG6300.1"
FT   mRNA            join(16204072..16204204,16204354..16204461,
FT                   16211418..16211547,16212655..16212720,16213421..16213768)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT5366"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT5366.1 created on
FT                   10-SEP-2002"
FT   mRNA            join(16204120..16204204,16204354..16204461,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213767)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT173127"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173127.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(16204137..16204204,16204354..16204467,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213766)
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, transcript
FT                   variant mCT173126"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173126.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(16204140..16204204,16204354..16204461,
FT                   16209456..16209554,16211418..16211547,16212655..16212720,
FT                   16213421..16213528)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173127.0
FT                   protein_id=mCP96045.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U8Y1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="MGI:MGI:1915244"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8Y1"
FT                   /protein_id="EDL07091.1"
FT                   /translation="MQVLRNSGSWLLRSWAGHGMTRFVGIAPAKNIHTGAPRLEDSAAR
FT                   QNTEREAAPSRFSLYPPVPGQESSLQWAGMKFEDVPIAHIKATYNNTQIQVVSATNASL
FT                   ARASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHIRVVVKGMGPGRWSAIKGLT
FT                   MGGLEVISITDNTPVPHNGCRPRKARRL"
FT   CDS             join(16204140..16204204,16204354..16204461,
FT                   16211418..16211547,16212655..16212720,16213421..16213528)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT5366.1
FT                   protein_id=mCP7335.2 isoform=CRA_c"
FT                   /protein_id="EDL07092.1"
FT                   /translation="MQVLRNSGSWLLRSWAGHGMTRFVGIAPAKNIHTGAPRLEDSAAR
FT                   QNTEREAAPSRFSTQIQVVSATNASLARASCGTEGFRNAKKGTGIAAQTAGIAAAAKAT
FT                   GKGVTHIRVVVKGMGPGRWSAIKGLTMGGLEVISITDNTPVPHNGCRPRKARRL"
FT   CDS             join(16204140..16204204,16204354..16204465)
FT                   /codon_start=1
FT                   /gene="Mrps11"
FT                   /locus_tag="mCG_6300"
FT                   /product="mitochondrial ribosomal protein S11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6300.1 transcript_id=mCT173126.0
FT                   protein_id=mCP96046.0 isoform=CRA_a"
FT                   /protein_id="EDL07090.1"
FT                   /translation="MQVLRNSGSWLLRSWAGHGMTRFVGIAPAKNIHTGAPRLEDSAAR
FT                   QNTEREAAPSRFR"
FT   gap             16229853..16229998
FT                   /estimated_length=146
FT   gene            16238999..16241379
FT                   /locus_tag="mCG_147204"
FT                   /note="gene_id=mCG147204.0"
FT   mRNA            join(16238999..16239986,16240822..16241379)
FT                   /locus_tag="mCG_147204"
FT                   /product="mCG147204"
FT                   /note="gene_id=mCG147204.0 transcript_id=mCT187467.0
FT                   created on 13-JAN-2004"
FT   CDS             16239795..16239950
FT                   /codon_start=1
FT                   /locus_tag="mCG_147204"
FT                   /product="mCG147204"
FT                   /note="gene_id=mCG147204.0 transcript_id=mCT187467.0
FT                   protein_id=mCP109611.0"
FT                   /protein_id="EDL07089.1"
FT                   /translation="MYHLTLYDFLVCFAIQIFSFVGIQFHRIFLPLKNDKRHLGLSRLV
FT                   CSPGSL"
FT   gap             16243949..16246923
FT                   /estimated_length=2975
FT   gene            complement(<16247035..16260197)
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /note="gene_id=mCG6308.1"
FT   mRNA            complement(join(<16247035..16247232,16252959..16253146,
FT                   16256126..16257218,16260065..16260197))
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /product="de-etiolated homolog 1 (Arabidopsis)"
FT                   /note="gene_id=mCG6308.1 transcript_id=mCT5355.1 created on
FT                   16-OCT-2002"
FT   CDS             complement(join(<16247035..16247232,16252959..16253146,
FT                   16256126..16257208))
FT                   /codon_start=1
FT                   /gene="Det1"
FT                   /locus_tag="mCG_6308"
FT                   /product="de-etiolated homolog 1 (Arabidopsis)"
FT                   /note="gene_id=mCG6308.1 transcript_id=mCT5355.1
FT                   protein_id=mCP7364.2"
FT                   /protein_id="EDL07088.1"
FT                   /translation="MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQN
FT                   VFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEI
FT                   LSNGNDQRSVSIRGRLFERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLP
FT                   DEPHPPFYEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGL
FT                   YLYKNILAILSVQQQTIHVFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQT
FT                   GMANPFRDPFINSLKHRLLVYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDEN
FT                   HLFIKYTSEDVVTLRVTDPSQASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRN
FT                   ATLHSEVQFPCSASSNNFARQIQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGS
FT                   PYLDLSLFSYDDKWVVSHGATQDLWEITRSGT"
FT   gap             16269149..16269168
FT                   /estimated_length=20
FT   gene            16285593..16286195
FT                   /pseudo
FT                   /locus_tag="mCG_54597"
FT                   /note="gene_id=mCG54597.2"
FT   mRNA            16285593..16286195
FT                   /pseudo
FT                   /locus_tag="mCG_54597"
FT                   /note="gene_id=mCG54597.2 transcript_id=mCT54780.2 created
FT                   on 11-NOV-2002"
FT   gap             16287842..16287863
FT                   /estimated_length=22
FT   gap             16295206..16295394
FT                   /estimated_length=189
FT   gap             16302278..16302303
FT                   /estimated_length=26
FT   gap             16304712..16304731
FT                   /estimated_length=20
FT   gene            16308876..16318439
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /note="gene_id=mCG6304.3"
FT   mRNA            join(16308876..16308948,16312288..16312888,
FT                   16315901..16316101,16317202..16317634)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT5356"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT5356.1 created on
FT                   10-SEP-2002"
FT   mRNA            join(<16308879..16308948,16312402..16312888,
FT                   16315901..16316101,16317202..16318439)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT189928"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT189928.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<16308915..16308948,16315901..16316101,
FT                   16317202..16318181)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT173131"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173131.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(<16308916..16308948,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173131.0
FT                   protein_id=mCP96050.0 isoform=CRA_a"
FT                   /protein_id="EDL07084.1"
FT                   /translation="VKPGKARPGFQILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDT
FT                   TYVPNLLSQPSSLIRTRVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMELYQLVEVQW
FT                   EQQVASSAQAPAEDRGPDSSTDVEQYMDDQYWPEDLTQSTGAETNGGPDRQEGEEGQGA
FT                   RSAPP"
FT   CDS             join(<16308920..16308948,16312402..16312888,
FT                   16315901..16316101,16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT189928.0
FT                   protein_id=mCP110929.0 isoform=CRA_c"
FT                   /protein_id="EDL07086.1"
FT                   /translation="NLGKRGRVFSLNTKDVVRRRHKRRSRQHQRFMARKALLQEQELLS
FT                   TAPGPGLCLLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRPGPIKCVA
FT                   IDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHKA
FT                   IPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQPSSLIRT
FT                   RVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQAPAEDRG
FT                   PDSSTDVEQYMDDQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP"
FT   mRNA            join(16308987..16309135,16312288..16312888,
FT                   16315901..16316101,16317202..16318432)
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   transcript variant mCT173132"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173132.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(16312352..16312888,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT173132.0
FT                   protein_id=mCP96051.0 isoform=CRA_b"
FT                   /protein_id="EDL07085.1"
FT                   /translation="MVAGEVPESTQCPSLTSLNTKDVVRRRHKRRSRQHQRFMARKALL
FT                   QEQELLSTAPGPGLCLLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRP
FT                   GPIKCVAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGIT
FT                   RQHMHKAIPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQ
FT                   PSSLIRTRVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQ
FT                   APAEDRGPDSSTDVEQYMDDQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP"
FT   CDS             join(16312352..16312888,16315901..16316101,
FT                   16317202..16317474)
FT                   /codon_start=1
FT                   /gene="Isg20l1"
FT                   /locus_tag="mCG_6304"
FT                   /product="interferon stimulated exonuclease gene 20-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6304.3 transcript_id=mCT5356.1
FT                   protein_id=mCP7313.1 isoform=CRA_b"
FT                   /protein_id="EDL07087.1"
FT                   /translation="MVAGEVPESTQCPSLTSLNTKDVVRRRHKRRSRQHQRFMARKALL
FT                   QEQELLSTAPGPGLCLLPSPSQMPAVTEASDSRRQRPKARSGSNGLCSKKSVPREAPRP
FT                   GPIKCVAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGIT
FT                   RQHMHKAIPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVPNLLSQ
FT                   PSSLIRTRVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMELYQLVEVQWEQQVASSAQ
FT                   APAEDRGPDSSTDVEQYMDDQYWPEDLTQSTGAETNGGPDRQEGEEGQGARSAPP"
FT   gene            16323515..16330419
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /note="gene_id=mCG6303.2"
FT   mRNA            join(16323515..16323551,16324379..16324631,
FT                   16326600..16326800,16329779..16330374)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT173129"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173129.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(16323875..16324099,16324379..16324631,
FT                   16326600..16326800,16330113..16330407)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT173130"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173130.0 created
FT                   on 16-DEC-2002"
FT   mRNA            join(16324290..16324631,16326600..16326800,
FT                   16330113..16330419)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT5369"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT5369.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(16324386..16324631,16326600..16326800,
FT                   16329868..16330254)
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, transcript variant
FT                   mCT177652"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT177652.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16329779..16330252)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_a"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173129.0
FT                   protein_id=mCP96049.0 isoform=CRA_a"
FT                   /protein_id="EDL07080.1"
FT                   /translation="MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRP
FT                   EGEITDYRTQVSGVTPQHMVRATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSK
FT                   YTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKRLLHKNIQVLPGSLLGVGGCILPGTDIL
FT                   HLLLYVGMVRIADLRLLTPFLPPSCLACPLLPESLASARSHAVISALSSSSHLLTPLPN
FT                   PSQGPQGHVDRLSGQLQDWGGSPLAPALPVSAEQLAGPLLCGRCQGHNGALQNLSATQS
FT                   PARAALPWDVRLNFILIQG"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16330113..16330229)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_b"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT173130.0
FT                   protein_id=mCP96048.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FK39"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="MGI:MGI:1928895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK39"
FT                   /protein_id="EDL07081.1"
FT                   /translation="MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRP
FT                   EGEITDYRTQVSGVTPQHMVRATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSK
FT                   YTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKRLLHKNIQNNWRGHCSVEDARATMELYK
FT                   ISQRLRAQRGLPCPGTSD"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16330113..16330229)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_b"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT5369.2
FT                   protein_id=mCP7284.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FK39"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="MGI:MGI:1928895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK39"
FT                   /protein_id="EDL07083.1"
FT                   /translation="MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRP
FT                   EGEITDYRTQVSGVTPQHMVRATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSK
FT                   YTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKRLLHKNIQNNWRGHCSVEDARATMELYK
FT                   ISQRLRAQRGLPCPGTSD"
FT   CDS             join(16324404..16324631,16326600..16326800,
FT                   16329868..16329876)
FT                   /codon_start=1
FT                   /gene="Isg20"
FT                   /locus_tag="mCG_6303"
FT                   /product="interferon-stimulated protein, isoform CRA_c"
FT                   /note="gene_id=mCG6303.2 transcript_id=mCT177652.0
FT                   protein_id=mCP100574.0 isoform=CRA_c"
FT                   /protein_id="EDL07082.1"
FT                   /translation="MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRP
FT                   EGEITDYRTQVSGVTPQHMVRATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSK
FT                   YTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKRLLHKNIQDC"
FT   gap             16331450..16331591
FT                   /estimated_length=142
FT   gap             16358246..16358265
FT                   /estimated_length=20
FT   gap             16368063..16383895
FT                   /estimated_length=15833
FT   gap             16385105..16385124
FT                   /estimated_length=20
FT   gap             16389488..16389507
FT                   /estimated_length=20
FT   gap             16394460..16394479
FT                   /estimated_length=20
FT   gap             16400032..16400216
FT                   /estimated_length=185
FT   gap             16406602..16406621
FT                   /estimated_length=20
FT   gap             16408723..16408802
FT                   /estimated_length=80
FT   gap             16413724..16413743
FT                   /estimated_length=20
FT   gap             16417517..16417576
FT                   /estimated_length=60
FT   gap             16422092..16422111
FT                   /estimated_length=20
FT   gap             16423536..16423555
FT                   /estimated_length=20
FT   gap             16445013..16445076
FT                   /estimated_length=64
FT   gap             16454908..16454927
FT                   /estimated_length=20
FT   gap             16460339..16460358
FT                   /estimated_length=20
FT   gene            16460362..16522345
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /note="gene_id=mCG141103.0"
FT   mRNA            join(16460362..16460487,16489427..16489503,
FT                   16491720..16492103,16493515..16493689,16495431..16495558,
FT                   16496854..16497147,16498192..16498596,16499569..16499743,
FT                   16499935..16500062,16501240..16501533,16503925..16504140,
FT                   16505010..16508492,16518554..16518712,16519225..16519307,
FT                   16519945..16520089,16520903..16521085,16521448..16522345)
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /product="aggrecan 1"
FT                   /note="gene_id=mCG141103.0 transcript_id=mCT173113.0
FT                   created on 10-SEP-2002"
FT   gap             16475027..16475377
FT                   /estimated_length=351
FT   gap             16484664..16486320
FT                   /estimated_length=1657
FT   CDS             join(16489434..16489503,16491720..16492103,
FT                   16493515..16493689,16495431..16495558,16496854..16497147,
FT                   16498192..16498596,16499569..16499743,16499935..16500062,
FT                   16501240..16501533,16503925..16504140,16505010..16508492,
FT                   16518554..16518712,16519225..16519307,16519945..16520089,
FT                   16520903..16521085,16521448..16521524)
FT                   /codon_start=1
FT                   /gene="Agc1"
FT                   /locus_tag="mCG_141103"
FT                   /product="aggrecan 1"
FT                   /note="gene_id=mCG141103.0 transcript_id=mCT173113.0
FT                   protein_id=mCP96032.0"
FT                   /protein_id="EDL07079.1"
FT                   /translation="MTTLLLVFVTLRVIAAVISEEVPDHDNSLSVSIPQPSPLKVLLGS
FT                   SLTIPCYFIDPMHPVTTAPSTAPLTPRIKWSRVSKEKEVVLLVATEGQVRVNSIYQDKV
FT                   SLPNYPAIPSDATLEIQNLRSNDSGIYRCEVMHGIEDSEATLEVIVKGIVFHYRAISTR
FT                   YTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYG
FT                   DKDEFPGVRTYGIRDTNETYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLA
FT                   TTGQLYLAWQGGMDMCSAGWLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDP
FT                   SSRYDAICYTGEDFVDIPENFFGVGGEDDITIQTVTWPDLELPLPRNVTEGEALGSVIL
FT                   TAKPIFDLSPTISEPGEALTLAPEVGSTAFPEAEERTGEATRPWGFPAEVTRGPDSATA
FT                   FASEDLVVRVTISPGAAEVPGQPRLPGGVVFHYRPGSTRYSLTFEEAQQACMHTGAVIA
FT                   SPEQLQAAYEAGYEQCDAGWLQDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSSETY
FT                   DVYCYVDKLEGEVFFATRLEQFTFQEARAFCAAQNATLASTGQLYAAWSQGLDKCYAGW
FT                   LADGTLRYPIITPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFRGVSVAPSPGE
FT                   EEGSTPTSPSDIEDWIVTQVGPGVDAVPLEPKTTEVPYFTTEPRKQTEWEPAYTPVGTS
FT                   PQPGIPPTWLPTLPAAEEHTESPSASEEPSASAVPSTSEEPYTSSFAVPSMTELPGSGE
FT                   ASGAPDLSGDFTGSGDASGRLDSSGQPSGGIESGLPSGDLDSSGLSPTVSSGLPVESGS
FT                   ASGDGEVPWSHTPTVGRLPSGGESPEGSASASGTGDLSGLPSGGEITETSTSGAEETSG
FT                   LPSGGDGLETSTSGVDDVSGIPTGREGLETSASGVEDLSGLPSGEEGSETSTSGIEDIS
FT                   VLPTGGESLETSASGVGDLSGLPSGGESLETSASGAEDVTQLPTERGGLETSASGVEDI
FT                   TVLPTGRESLETSASGVEDVSGLPSGREGLETSASGIEDISVFPTEAEGLDTSASGGYV
FT                   SGIPSGGDGTETSASGVEDVSGLPSGGEGLETSASGVEDLGPSTRDSLETSASGVDVTG
FT                   FPSGRGDPETSVSGVGDDFSGLPSGKEGLETSASGAEDLSGLPSGKEDLVGSASGALDF
FT                   GKLPPGTLGSGQTPEVNGFPSGFSGEYSGADIGSGPSSGLPDFSGLPSGFPTVSLVDST
FT                   LVEVITATTSSELEGRGTIGISGSGEVSGLPLGELDSSADISGLPSGTELSGQASGSPD
FT                   SSGETSGFFDVSGQPFGSSGVSEETSGIPEISGQPSGTPDTTATSGVTELNELSSGQPD
FT                   VSGDGSGILFGSGQSSGITSVSGETSGISDLSGQPSGFPVFSGTATRTPDLASGTISGS
FT                   GESSGITFVDTSFVEVTPTTFREEEGLGSVELSGFPSGETELSGTSGTVDVSEQSSGAI
FT                   DSSGLTSPTPEFSGLPSGVAEVSGEFSGVETGSSLPSGAFDGSGLVSGFPTVSLVDRTL
FT                   VESITQAPTAQEAGEGPSGILEFSGAHSGTPDISGELSGSLDLSTLQSGQMETSTETPS
FT                   SPYFSGDFSSTTDVSGESIAATTGSGESSGLPEVTLNTSELVEGVTEPTVSQELGHGPS
FT                   MTYTPRLFEASGDASASGDLGGAVTNFPGSGIEASVPEASSDLSAYPEAGVGVSAAPEA
FT                   SSKLSEFPDLHGITSAFHETDLEMTTPSTEVNSNPWTFQEGTREGSAAPEVSGESSTTS
FT                   DIDTGTSGVPSATPMASGDRTEISGEWSDHTSEVNVAISSTITESEWAQPTRYPTETLQ
FT                   EIESPNPSYSGEETQTAETTMSLTDAPTLSSSEGSGETESTVADQEQCEEGWTKFQGHC
FT                   YRHFHDRETWVDAERRCREQQSHLSSIVTPEEQEFVNKNAQDYQWIGLNDRTIEGDFRW
FT                   SDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCKKGTVACGD
FT                   PPVVEHARTLGQKKDRYEISSLVRYQCTEGFVQRHVPTIRCQPSGHWEEPRITCTDPNT
FT                   YKHRLQKRSMRPTRRSRPSMAH"
FT   gap             16509422..16509441
FT                   /estimated_length=20
FT   gene            complement(16524276..16537949)
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /note="gene_id=mCG6307.1"
FT   mRNA            complement(join(16524276..16524741,16525097..16525399,
FT                   16528907..16529275,16530630..16530811,16537836..16537949))
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /product="hyaluronan and proteoglycan link protein 3"
FT                   /note="gene_id=mCG6307.1 transcript_id=mCT5359.1 created on
FT                   17-OCT-2002"
FT   CDS             complement(join(16524458..16524741,16525097..16525399,
FT                   16528907..16529275,16530630..16530753))
FT                   /codon_start=1
FT                   /gene="Hapln3"
FT                   /locus_tag="mCG_6307"
FT                   /product="hyaluronan and proteoglycan link protein 3"
FT                   /note="gene_id=mCG6307.1 transcript_id=mCT5359.1
FT                   protein_id=mCP7363.2"
FT                   /db_xref="GOA:Q80WM5"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR003596"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:1914916"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80WM5"
FT                   /protein_id="EDL07078.1"
FT                   /translation="MSLLFLVLLSPFPCVLGLPFYNGFYYSNDLSGRTLGNGYGEGLFN
FT                   GVKLVVETTEESLFSHQGASVTLPCHYHYEPALASPRHVRVKWWKLSENGAPEQDVLVV
FT                   IGQRHRSFGDYQGRVQLRQDKQQEVSLELRDLRLEDSGRYRCEVIDGLEDESGLVELEL
FT                   RGVVFPYQSREGRYQLNFHEAQQACQEQGAMVATFEQLFRAWEEGLDWCNAGWLQDASV
FT                   QYPIVLPRQPCGGLGLAPGVRSYGQRHHRLHRYDVFCFAAALKGRVYYLENPKKLTLLE
FT                   AREACQEDGAQISTVGQLFAAWKFRGLDRCDAGWLADGSARYPIVHPRLNCGPPEPGVR
FT                   TFGFPDPHTRYGVYCYVQH"
FT   gene            complement(16540665..16555890)
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /note="gene_id=mCG6301.2"
FT   mRNA            complement(join(16540665..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16550128..16550238,16552100..16552231,
FT                   16552475..16552597,16555754..16555872))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT5360"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT5360.0 created on
FT                   16-DEC-2002"
FT   mRNA            complement(join(16540665..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16552100..16552231,16552475..16552597,
FT                   16555754..16555863))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT173128"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT173128.0 created
FT                   on 16-DEC-2002"
FT   mRNA            complement(join(16541042..16541442,16541548..16541697,
FT                   16543514..16543580,16552511..16552597,16555754..16555890))
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, transcript
FT                   variant mCT177651"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT177651.0 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(16541305..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16552100..16552231,16552475..16552597,
FT                   16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT173128.0
FT                   protein_id=mCP96047.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TDU5"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR027060"
FT                   /db_xref="MGI:MGI:102768"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDU5"
FT                   /protein_id="EDL07075.1"
FT                   /translation="MQVSRVLAALCGMLLCASGLFAASGDFCDSSLCLNGGTCLTGQDN
FT                   DIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSG
FT                   IHCETGCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNY
FT                   DSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKE
FT                   FLGNLDNNSLKVNMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNT
FT                   IPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQV
FT                   TGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEK
FT                   PFMARYVRVLPVSWHNRITLRLELLGC"
FT   CDS             complement(join(16541305..16541442,16541548..16541697,
FT                   16543514..16543698,16548495..16548639,16549252..16549404,
FT                   16549719..16549900,16550128..16550238,16552100..16552231,
FT                   16552475..16552597,16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT5360.0
FT                   protein_id=mCP7369.1 isoform=CRA_c"
FT                   /protein_id="EDL07077.1"
FT                   /translation="MQVSRVLAALCGMLLCASGLFAASGDFCDSSLCLNGGTCLTGQDN
FT                   DIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSG
FT                   IHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQ
FT                   ISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQ
FT                   GASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQ
FT                   YIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGW
FT                   YPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKV
FT                   AHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRL
FT                   ELLGC"
FT   CDS             complement(join(16541670..16541697,16543514..16543580,
FT                   16552511..16552597,16555754..16555826))
FT                   /codon_start=1
FT                   /gene="Mfge8"
FT                   /locus_tag="mCG_6301"
FT                   /product="milk fat globule-EGF factor 8 protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6301.2 transcript_id=mCT177651.0
FT                   protein_id=mCP100573.0 isoform=CRA_b"
FT                   /protein_id="EDL07076.1"
FT                   /translation="MQVSRVLAALCGMLLCASGLFAASGDFCDSSLCLNGGTCLTGQDN
FT                   DIYCLCPEGWIIRARSMPGRLRATVPRNGCRLTWALRGK"
FT   gap             16568786..16568805
FT                   /estimated_length=20
FT   gap             16569844..16569863
FT                   /estimated_length=20
FT   gap             16574174..16574193
FT                   /estimated_length=20
FT   gap             16597889..16598788
FT                   /estimated_length=900
FT   gap             16608500..16609971
FT                   /estimated_length=1472
FT   gap             16610751..16611000
FT                   /estimated_length=250
FT   gap             16614602..16618862
FT                   /estimated_length=4261
FT   gap             16621151..16621442
FT                   /estimated_length=292
FT   gap             16622786..16622805
FT                   /estimated_length=20
FT   gap             16648449..16648587
FT                   /estimated_length=139
FT   gap             16655297..16655484
FT                   /estimated_length=188
FT   gap             16674380..16674741
FT                   /estimated_length=362
FT   gene            16681281..16765066
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /note="gene_id=mCG6299.1"
FT   mRNA            join(16681281..16681344,16704873..16704972,
FT                   16706350..16706552,16733692..16733867,16735657..16735824,
FT                   16752924..16753107,16755415..16755507,16758654..16758764,
FT                   16760475..16760544,16762731..16762815,16764625..16765066)
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /product="abhydrolase domain containing 2"
FT                   /note="gene_id=mCG6299.1 transcript_id=mCT5365.1 created on
FT                   11-NOV-2002"
FT   gap             16691594..16692208
FT                   /estimated_length=615
FT   gap             16702745..16702764
FT                   /estimated_length=20
FT   gap             16706295..16706314
FT                   /estimated_length=20
FT   CDS             join(16706362..16706552,16733692..16733867,
FT                   16735657..16735824,16752924..16753107,16755415..16755507,
FT                   16758654..16758764,16760475..16760544,16762731..16762815,
FT                   16764625..16764821)
FT                   /codon_start=1
FT                   /gene="Abhd2"
FT                   /locus_tag="mCG_6299"
FT                   /product="abhydrolase domain containing 2"
FT                   /note="gene_id=mCG6299.1 transcript_id=mCT5365.1
FT                   protein_id=mCP7352.1"
FT                   /protein_id="EDL07074.1"
FT                   /translation="MPMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYF
FT                   QDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSD
FT                   GATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLG
FT                   ALPNIELTSPRMFTYGCTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQAN
FT                   QEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKK
FT                   PQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVN
FT                   AADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEY
FT                   ANAICQWERNKSQCSDTEQMEAELE"
FT   gap             16725978..16725997
FT                   /estimated_length=20
FT   gene            complement(16779534..16791723)
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /note="gene_id=mCG6305.2"
FT   mRNA            complement(join(16779534..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788637,16789334..16789454,
FT                   16791364..16791723))
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, transcript
FT                   variant mCT173133"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT173133.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(16779534..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788719,16789334..16789460))
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, transcript
FT                   variant mCT5357"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT5357.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16780223..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788620))
FT                   /codon_start=1
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT173133.0
FT                   protein_id=mCP96052.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Y3"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="MGI:MGI:97930"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y3"
FT                   /protein_id="EDL07072.1"
FT                   /translation="MSDGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTL
FT                   QKAKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARK
FT                   FDVGRAYELLKGYVNFRLQYPELFDSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNI
FT                   ENWHCEEVTFDEILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKK
FT                   MVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEID
FT                   ENILPADFGGTLPKYDGKVVAEQLFGPRAEVENTAL"
FT   CDS             complement(join(16780223..16780381,16780560..16780670,
FT                   16781890..16782048,16784634..16784812,16786308..16786512,
FT                   16788287..16788415,16788609..16788620))
FT                   /codon_start=1
FT                   /gene="Rlbp1"
FT                   /locus_tag="mCG_6305"
FT                   /product="retinaldehyde binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG6305.2 transcript_id=mCT5357.1
FT                   protein_id=mCP7329.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Y3"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="MGI:MGI:97930"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y3"
FT                   /protein_id="EDL07073.1"
FT                   /translation="MSDGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTL
FT                   QKAKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARK
FT                   FDVGRAYELLKGYVNFRLQYPELFDSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNI
FT                   ENWHCEEVTFDEILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKK
FT                   MVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEID
FT                   ENILPADFGGTLPKYDGKVVAEQLFGPRAEVENTAL"
FT   gap             16784262..16784445
FT                   /estimated_length=184
FT   gap             16795041..16795320
FT                   /estimated_length=280
FT   gene            <16798039..16860182
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /note="gene_id=mCG141643.0"
FT   mRNA            join(<16798039..16798100,16801601..16801703,
FT                   16804844..16804916,16807531..16807661,16807975..16808131,
FT                   16808217..16808274,16810758..16810799,16811782..16811905,
FT                   16812939..16813024,16814755..16814881,16817113..16817205,
FT                   16818564..16818700,16834124..16834251,16834812..16834882,
FT                   16836025..16836139,16837045..16837167,16840348..16840416,
FT                   16842032..16842133,16843101..16843277,16843351..16843472,
FT                   16844054..16844218,16845115..16845294,16848154..16848320,
FT                   16849539..16849615,16850552..16850668,16853657..16853708,
FT                   16853864..16853991,16854074..16854142,16854317..16854425,
FT                   16854591..16854778,16855453..16855506,16855586..16855645,
FT                   16858166..16858228,16858736..16859096,16859556..16860182)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT176110"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176110.1
FT                   created on 04-JUN-2003"
FT   mRNA            join(<16804835..16804916,16807531..16807661,
FT                   16807975..16808131,16808217..16808274,16810758..16810799,
FT                   16811782..16811905,16812939..16813024,16814755..16814881,
FT                   16817113..16817205,16818564..16818700,16830182..16830269,
FT                   16834124..16834251,16834812..16834882,16836025..16836139,
FT                   16837045..16837167,16840348..16840416,16842032..16842133,
FT                   16843101..16843277,16843351..16843472,16844054..16844218,
FT                   16845115..16845611)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT185132"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT185132.0
FT                   created on 04-JUN-2003"
FT   gap             16810396..16810600
FT                   /estimated_length=205
FT   gap             16815031..16815050
FT                   /estimated_length=20
FT   CDS             join(<16818572..16818700,16830182..16830269,
FT                   16834124..16834251,16834812..16834882,16836025..16836139,
FT                   16837045..16837167,16840348..16840416,16842032..16842133,
FT                   16843101..16843277,16843351..16843472,16844054..16844218,
FT                   16845115..16845298)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_c"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT185132.0
FT                   protein_id=mCP106390.0 isoform=CRA_c"
FT                   /protein_id="EDL07071.1"
FT                   /translation="SFKDFRCKKLQGSSAPPRLQVSSDSRPPENLCFNHDLRSGEEQIH
FT                   EMIRQEILEQVLNRVVTRTSSPINHFLDLFSDIIMYAPLILQNCSKVTETFDYLTFLPL
FT                   QTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKVLGS
FT                   LPSSQCTQSIGVTQVRVDVHSRYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYD
FT                   VLRRNSQLASSIMQTLFSQLKQFYEPEPDLLPPLKLGACVLTQGSQIFLQEPLDHLLSC
FT                   IQHCLAWYKSRVVPLQQGDEGEEEEEELYSELDDMLESITVRMIKSELEDFELDKSADF
FT                   SQNTNVGIKNNICACLIMGVCEVLMEYNFSISNFSKSKFEEILSLFTCYKKFSDILSEK
FT                   AGKGKAKMTSKVSDSLLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHYAVNVAL
FT                   QKIQQLIRTGHVSGPDGQNPDKIFQNLCDITR"
FT   CDS             join(<16818694..16818700,16834124..16834251,
FT                   16834812..16834882,16836025..16836139,16837045..16837167,
FT                   16840348..16840416,16842032..16842133,16843101..16843277,
FT                   16843351..16843472,16844054..16844218,16845115..16845294,
FT                   16848154..16848320,16849539..16849615,16850552..16850668,
FT                   16853657..16853708,16853864..16853991,16854074..16854142,
FT                   16854317..16854425,16854591..16854778,16855453..16855506,
FT                   16855586..16855645,16858166..16858228,16858736..16858909)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_a"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176110.1
FT                   protein_id=mCP99033.1 isoform=CRA_a"
FT                   /protein_id="EDL07069.1"
FT                   /translation="GTDLFSDIIMYAPLILQNCSKVTETFDYLTFLPLQTVQGLLKAVQ
FT                   PLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKVLGSLPSSQCTQSIG
FT                   VTQVRVDVHSRYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYDVLRRNSQLASS
FT                   IMQTLFSQLKQFYEPEPDLLPPLKLGACVLTQGSQIFLQEPLDHLLSCIQHCLAWYKSR
FT                   VVPLQQGDEGEEEEEELYSELDDMLESITVRMIKSELEDFELDKSADFSQNTNVGIKNN
FT                   ICACLIMGVCEVLMEYNFSISNFSKSKFEEILSLFTCYKKFSDILSEKAGKGKAKMTSK
FT                   VSDSLLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHYAVNVALQKIQQLIRTGH
FT                   VSGPDGQNPDKIFQNLCDITRVLLWRYTSIPTSVEESGKKEKGKSISLLCLEGLQKTFS
FT                   VVLQFYQPKVQQFLQALDVMGTEEEEAGVTVTQRASFQIRQFQRSLLNLLSSEEDDFNS
FT                   KEALLLIAVLSTLSRLLEPTSPQFVQMLSWTSKICKEYSQEDASFCKSLMNLFFSLHVL
FT                   YKSPVTLLRDLSQDIHGQLGDIDQDVEIEKTDHFAVVNLRTAAPTVCLLVLSQAEKVLE
FT                   EVDWLIAKIKGSANQETLSDKVTPEDASSQAVPPTLLIEKAIVMQLGTLVTFFHELVQT
FT                   ALPSGSCVDTLLKGLSKIYSTLTAFVKYYLQVCQSSRGIPNTVEKLVKLSGSHLTPVCY
FT                   SFISYVQNKSSDAPKCSEKEKAAVSTTMAKVLRETKPIPNLVFAIEQYEKFLIQLSKKS
FT                   KVKMFFISTLIYCWKESSKLCGRQHS"
FT   gap             16820499..16820518
FT                   /estimated_length=20
FT   gap             16824198..16824217
FT                   /estimated_length=20
FT   gap             16827654..16828074
FT                   /estimated_length=421
FT   mRNA            join(<16855596..16855645,16858166..16858228,
FT                   16858736..16858831,16858989..16859096,16859556..16859732)
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, transcript variant
FT                   mCT176111"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176111.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<16855598..16855645,16858166..16858228,
FT                   16858736..16858831,16858989..16859096,16859556..16859627)
FT                   /codon_start=1
FT                   /gene="BC025462"
FT                   /locus_tag="mCG_141643"
FT                   /product="cDNA sequence BC025462, isoform CRA_b"
FT                   /note="gene_id=mCG141643.0 transcript_id=mCT176111.0
FT                   protein_id=mCP99032.0 isoform=CRA_b"
FT                   /protein_id="EDL07070.1"
FT                   /translation="GSHLTPVCYSFISYVQNKSSDAPKCSEKEKAAVSTTMAKVLRETK
FT                   PIPNLVFAIEQYEKFLIQLSKKSKVNLMQHMKLSTSRDFKIKGSVLDMVLREDEEDENE
FT                   EGTASAHTQQDREPAKKRRKKCLS"
FT   gene            complement(16859297..>16876108)
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /note="gene_id=mCG6296.2"
FT   mRNA            complement(join(16859297..16859450,16860401..16860558))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173125"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173125.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(16859298..16859953,16860401..16860561,
FT                   16861458..16861666,16861776..16861944,16862023..16862145,
FT                   16863621..16863867,16863955..16864090,16864510..16864627,
FT                   16864727..16864780,16865351..16865511,16865957..16866064,
FT                   16866351..16866428,16866624..16866744,16868090..16868326,
FT                   16869090..16869216,16869353..16869501,16869605..16869787,
FT                   16869974..16870053,16870179..16870325,16870432..16870596,
FT                   16871614..16871809,16874518..16875285,16875984..>16876108))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT5362"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT5362.1 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(16859422..16859450,16860401..16860557))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_a"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173125.0
FT                   protein_id=mCP96044.0 isoform=CRA_a"
FT                   /protein_id="EDL07065.1"
FT                   /translation="MFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGME
FT                   RRYGIPQGCDLELRPE"
FT   CDS             complement(join(16859877..16859953,16860401..16860561,
FT                   16861458..16861666,16861776..16861944,16862023..16862145,
FT                   16863621..16863867,16863955..16864090,16864510..16864627,
FT                   16864727..16864780,16865351..16865511,16865957..16866064,
FT                   16866351..16866428,16866624..16866744,16868090..16868326,
FT                   16869090..16869216,16869353..16869501,16869605..16869787,
FT                   16869974..16870053,16870179..16870325,16870432..16870596,
FT                   16871614..16871809,16874518..>16875191))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_b"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT5362.1
FT                   protein_id=mCP7291.1 isoform=CRA_b"
FT                   /protein_id="EDL07066.1"
FT                   /translation="KQSSWSPKPGAPTHSGGLPAPTMSRLLWKKVAGAKVASGPVPATA
FT                   RWVSSSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQIFGCGGEMPDEAA
FT                   VQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLL
FT                   EAQLPPEPKSWAWAEGWTRYGPEGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISP
FT                   SAWYSWCSRRLVEERYSWTSQLSPADLIPLGGSTSASSSTKQDGQEQLVVGHNVSFDRA
FT                   HIREQYLIQDSRMRFLDTMSMHMAISGLSSFQRSLWMGAKQGKHKTQQSTKRGQKSPRK
FT                   ANGPAISSWDWMDISSANNLADVHNLYVGGPPLEKEPRELFVKGSMRDIRENFQDLMQY
FT                   CARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLTEAQNTYEE
FT                   LQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKPASASKLP
FT                   IEGAGPFGDPMDQEDPGPPSEEEELQRSVTAHNRLQQLRSTTDLLPKRPQHLPGHPGWY
FT                   RKLCPRLDDPAWAPGPSLLSLQMRVTPKLMALTWDGFPLHYSDSHGWGYLVPGRRDNLT
FT                   EPPVSPTVESAAVTCPYRAIESLYRKHCLEQGKQQLEPQEVDLAEEFLLTDSSAMWQTV
FT                   EELGCLDVEAEAKMENSGLSQPLVLPAACAPKSSQPTYHHGNGPYNDVNIPGCWFFKLP
FT                   HKDGNNYNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQM
FT                   VVWLPRSALPRVVTRHPSFDEEGHYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVG
FT                   SELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTD
FT                   LHSKTAATVGISREHAKIFNYGRIYGAGQSFAERLLMQFNHRLTRQEAAEKAQQMYAVT
FT                   KGLRRYRLSADGEWLVKQLNLPVDRTEDGWVSLQDLRMIRREASRKSRWKKWEVASERA
FT                   WTGGTESEMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFITSRVNWVVQSSAVD
FT                   YLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAY
FT                   KLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIE
FT                   LTKGSLEKRSQPGP"
FT   mRNA            complement(join(<16861511..16861666,16861776..16862145,
FT                   16863621..>16863687))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173124"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173124.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(<16861511..16861666,16861776..>16862018))
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_d"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173124.0
FT                   protein_id=mCP96042.0 isoform=CRA_d"
FT                   /protein_id="EDL07068.1"
FT                   /translation="EPCVVKMRGLVGSQRADQGGLCSPRSRWKKWEVASERAWTGGTES
FT                   EMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFITSRVNWVVQSSAVDYLHLMLV
FT                   AMKWLFEEFAIDGRFCISIHDEVRYLVRE"
FT   mRNA            complement(join(<16874809..16875285,16875817..>16875984))
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, transcript
FT                   variant mCT173123"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173123.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(<16874809..>16875207)
FT                   /codon_start=1
FT                   /gene="Polg"
FT                   /locus_tag="mCG_6296"
FT                   /product="polymerase (DNA directed), gamma, isoform CRA_c"
FT                   /note="gene_id=mCG6296.2 transcript_id=mCT173123.0
FT                   protein_id=mCP96043.0 isoform=CRA_c"
FT                   /protein_id="EDL07067.1"
FT                   /translation="VFRPLKAVKLEPKARCPDSQRGAPCTNHEPPALEEGGWRQGRLRA
FT                   STSNRALGLQLRPRPRPQRRAAAVANALLREWAAAAQPSAHPDVVERPARADLRVRRGN
FT                   ARRGRGAAQRRAPAEARALGAAGHALARR"
FT   gap             16878179..16878198
FT                   /estimated_length=20
FT   gap             16894652..16894692
FT                   /estimated_length=41
FT   gene            <16911438..16945731
FT                   /locus_tag="mCG_144576"
FT                   /note="gene_id=mCG144576.0"
FT   mRNA            join(<16911438..16911572,16935218..16935277,
FT                   16942514..16945731)
FT                   /locus_tag="mCG_144576"
FT                   /product="mCG144576"
FT                   /note="gene_id=mCG144576.0 transcript_id=mCT184000.0
FT                   created on 05-JUN-2003"
FT   gap             16937129..16937203
FT                   /estimated_length=75
FT   gap             16940619..16940781
FT                   /estimated_length=163
FT   CDS             <16942872..16943381
FT                   /codon_start=1
FT                   /locus_tag="mCG_144576"
FT                   /product="mCG144576"
FT                   /note="gene_id=mCG144576.0 transcript_id=mCT184000.0
FT                   protein_id=mCP106146.0"
FT                   /protein_id="EDL07064.1"
FT                   /translation="RLHHQHFHPQRTRQHTGKLPKEGTPASQELTTFLPSYPPLGAPLP
FT                   PSSCSQQAGPGTRSHAAVLLPGELGGRSELCREKARPVRVSEMNHRHPCAAGLHVSQGS
FT                   CSVPENGEAQRGSRAHSLFISRGFLTVLPLPGMGSPLPLSLPPMIHSWVPVVRTAHPLL
FT                   HSPPKP"
FT   gap             16952050..16952069
FT                   /estimated_length=20
FT   gap             16963900..16964142
FT                   /estimated_length=243
FT   gap             16974351..16976277
FT                   /estimated_length=1927
FT   gap             16978164..16978183
FT                   /estimated_length=20
FT   gap             16987797..16987816
FT                   /estimated_length=20
FT   gap             16989603..16989639
FT                   /estimated_length=37
FT   gene            complement(16997747..17003720)
FT                   /locus_tag="mCG_147198"
FT                   /note="gene_id=mCG147198.0"
FT   mRNA            complement(join(16997747..16998148,17003482..17003720))
FT                   /locus_tag="mCG_147198"
FT                   /product="mCG147198"
FT                   /note="gene_id=mCG147198.0 transcript_id=mCT187461.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16997837..16998043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147198"
FT                   /product="mCG147198"
FT                   /note="gene_id=mCG147198.0 transcript_id=mCT187461.0
FT                   protein_id=mCP109605.0"
FT                   /protein_id="EDL07063.1"
FT                   /translation="MTNVNSADGHHTEAALLIVHSIRITRGDGSAVKKAYRFFRGWEFS
FT                   SQNHVRQLTAAHSSSYIASNTLL"
FT   gene            complement(17004469..>17029149)
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /note="gene_id=mCG6306.1"
FT   mRNA            complement(join(17004469..17004904,17005886..17006092,
FT                   17009909..17009982,17010338..17010462,17010725..17010861,
FT                   17011048..17011185,17011863..17012029,17012956..17013103,
FT                   17015200..17015350,17019005..17019191,17028841..>17029149))
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   transcript variant mCT5358"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT5358.1 created on
FT                   10-SEP-2002"
FT   mRNA            complement(join(17004472..17004720,17009951..17009982,
FT                   17010338..>17010377))
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   transcript variant mCT173134"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT173134.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(17004488..>17004664)
FT                   /codon_start=1
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT173134.0
FT                   protein_id=mCP96053.0 isoform=CRA_a"
FT                   /protein_id="EDL07061.1"
FT                   /translation="HEEKLRPGVGKGVWNGRASLPPPHPGYPFLDSSSLRLLPNNVFPM
FT                   FQGTQDHSILCSK"
FT   CDS             complement(join(17005910..17006092,17009909..17009982,
FT                   17010338..17010462,17010725..17010861,17011048..17011185,
FT                   17011863..17012029,17012956..17013103,17015200..17015350,
FT                   17019005..17019191,17028841..>17029147))
FT                   /codon_start=1
FT                   /gene="Rhcg"
FT                   /locus_tag="mCG_6306"
FT                   /product="Rhesus blood group-associated C glycoprotein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6306.1 transcript_id=mCT5358.1
FT                   protein_id=mCP7272.0 isoform=CRA_b"
FT                   /protein_id="EDL07062.1"
FT                   /translation="ARGRHHGQLFRVRPAQCPGPLSVSLVSEPSVQSKRPAVRSMAWNT
FT                   NLRGRLPITCLILQVTMVVLFGVFVRYDIQADAHWWLEKKRKNISSDVENEFYYRYPSF
FT                   QDVHAMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHYFEEGHIVLSV
FT                   ENIIQADFCVASSCVAFGAVLGKVSPMQLLIMTFFQVTLFTVNEFILLNLIEAKDAGGS
FT                   MTIHTFGAYFGLTVTWILYRKNLDQSKQRQSSVYHSDLFAMIGTLFLWIYWPSFNSASS
FT                   FHGDAQHRAALNTYLSLAASVLTTVTVSSIVHKKGKLDMVHIQNATLAGGVGVGTAAEM
FT                   MLTPYGALIVGFFCGIFSTLGFAYLTPFLESRLRIQDTCGIHNLHGIPGIIGGIVGAVT
FT                   AAYSSPDVYGEPGIVHSFGFGSYKMDWNKRMQGRSQIFGLLLSLAMALVGGIIVGFILK
FT                   LPFWGQAADENCFEDSIYWEVHEEVNTVYIPEDLAHKHSTSLVPAMPLVLPTTSASIVP
FT                   PVPPTPPVSLATSAPSAALVH"
FT   gap             17007987..17008354
FT                   /estimated_length=368
FT   gap             17013340..17013359
FT                   /estimated_length=20
FT   gap             17014408..17014513
FT                   /estimated_length=106
FT   gap             17024560..17024579
FT                   /estimated_length=20
FT   gap             17051803..17052289
FT                   /estimated_length=487
FT   gap             17053163..17053657
FT                   /estimated_length=495
FT   gap             17057685..17060292
FT                   /estimated_length=2608
FT   gap             17061373..17063681
FT                   /estimated_length=2309
FT   gap             17066964..17066983
FT                   /estimated_length=20
FT   gap             17069847..17069866
FT                   /estimated_length=20
FT   gap             17071380..17074057
FT                   /estimated_length=2678
FT   gene            <17074659..17081937
FT                   /locus_tag="mCG_124632"
FT                   /note="gene_id=mCG124632.0"
FT   mRNA            join(<17074659..17074821,17076222..17076351,
FT                   17081489..17081625,17081727..17081937)
FT                   /locus_tag="mCG_124632"
FT                   /product="mCG124632"
FT                   /note="gene_id=mCG124632.0 transcript_id=mCT125880.0
FT                   created on 11-NOV-2002"
FT   CDS             join(17074659..17074821,17076222..17076351,
FT                   17081489..17081625,17081727..17081749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124632"
FT                   /product="mCG124632"
FT                   /note="gene_id=mCG124632.0 transcript_id=mCT125880.0
FT                   protein_id=mCP88938.0"
FT                   /protein_id="EDL07060.1"
FT                   /translation="MILTVFRAKEAEFQSHFLQTAATEGSQDTASLFSDVVDSVLNQSH
FT                   NLFEDPASSAPCVPEWVQQELSHTSSWSPALVEKWFPFSNASGATSDLMESFWLLHAAS
FT                   PDNDESSKTESELTRCLSELYQRSHEESTVVNQERSRKKRFLCAEP"
FT   gap             17075393..17075750
FT                   /estimated_length=358
FT   gap             17076993..17077012
FT                   /estimated_length=20
FT   gap             17078085..17078104
FT                   /estimated_length=20
FT   gap             17081985..17082154
FT                   /estimated_length=170
FT   gene            17083634..17103459
FT                   /locus_tag="mCG_141644"
FT                   /note="gene_id=mCG141644.0"
FT   mRNA            join(17083634..17083757,17085369..17085520,
FT                   17087260..17087360,17088173..17088266,17088353..17088432,
FT                   17088612..17088839,17089319..17089415,17090566..17090623,
FT                   17092139..17092300,17094592..17094682,17096274..17096332,
FT                   17097238..17097369,17098168..17098325,17100005..17102130,
FT                   17102243..17102368,17102962..17103459)
FT                   /locus_tag="mCG_141644"
FT                   /product="mCG141644"
FT                   /note="gene_id=mCG141644.0 transcript_id=mCT176112.0
FT                   created on 11-NOV-2002"
FT   gap             17083873..17083892
FT                   /estimated_length=20
FT   CDS             join(17085467..17085520,17087260..17087360,
FT                   17088173..17088266,17088353..17088432,17088612..17088839,
FT                   17089319..17089415,17090566..17090623,17092139..17092300,
FT                   17094592..17094682,17096274..17096332,17097238..17097369,
FT                   17098168..17098325,17100005..17100634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141644"
FT                   /product="mCG141644"
FT                   /note="gene_id=mCG141644.0 transcript_id=mCT176112.0
FT                   protein_id=mCP99034.0"
FT                   /protein_id="EDL07059.1"
FT                   /translation="MVSTIKMFLKSKDIKELEVACLSHVNSNLLKTSKTLRQNLAGKMD
FT                   TEDKVGECQLQVFLRLEMCEQCPSVLDRPDEVERIVEEVTDLLRLVCLTKDSAYLSEFL
FT                   EEILRLYIGSIPGTIGQLYHSLGLKIPQKLAGVLPTGFFSDDSMSQESMSPPPSSSTHR
FT                   SVSAITESEQLEELRTRSAKKRRKNALIRHKSIAEISQTLRQIEVPKVSKRATRNENSH
FT                   SASIQLPVPRKDTIQEVTKVRRNLFNQEMLSPSKRGLKKGLPRSHSVSALECLHHKQDK
FT                   FKKTKSSTFQGYCKLLTKSVAETPVHKQISRRLLHRQIKGRSSDPGPDIHVVEESPEKE
FT                   DEMTLRRSPRIKQLSFSRTNSGSFYSVSQPKSRSVQRIHSSQQESEQRENFPVQSIQSP
FT                   KTLLFGALSEIPSSSKKGSAQIKRSLRSMLDSEISTSYETPKKSNQKSPSFSKTTPRRF
FT                   PRTAQTLLYTPERLQNSPTEMTSAEGTISEATIKTPSSHGYNSPFASKVTSQKTVSPAK
FT                   EETSPPLTKLPSTPRESDVQPPQCSSDCTWPHSVNSSPEGPYYPASPPPMAGQARSQCL
FT                   TPIRYSFRTPPRTALAGTSKQQEHQELPLPRASQTQEPPQGLEKKALKIPKKPAHTSTS
FT                   PLSPEEHFTSGM"
FT   gene            complement(17104019..>17120467)
FT                   /locus_tag="mCG_19450"
FT                   /note="gene_id=mCG19450.1"
FT   mRNA            complement(join(17104019..17105223,17105458..17105604,
FT                   17105695..17105893,17106491..17106697,17107258..17107473,
FT                   17108413..17108589,17108760..17108885,17109086..17109283,
FT                   17110934..17111136,17113046..17113233,17114011..17114108,
FT                   17114732..17114950,17115476..17115592,17116628..17116874,
FT                   17117013..17117191,17117270..17117406,17117723..17117923,
FT                   17120140..>17120467))
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, transcript variant mCT20073"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT20073.2 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(17104856..17105223,17105458..17105604,
FT                   17105695..17105893,17106491..17106697,17107258..17107473,
FT                   17108413..17108589,17108760..17108885,17109086..17109283,
FT                   17110934..17111136,17113046..17113233,17114011..17114108,
FT                   17114732..17114950,17115476..17115592,17116628..17116874,
FT                   17117013..17117191,17117270..17117406,17117723..17117923,
FT                   17120140..17120467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, isoform CRA_b"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT20073.2
FT                   protein_id=mCP7219.2 isoform=CRA_b"
FT                   /protein_id="EDL07057.1"
FT                   /translation="MGLEAQRLPGAEEAPVRVALRVRPLLPKELLHGHQSCLRVEPERG
FT                   RITLGRDRHFGFHVVLGEDTGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTM
FT                   GEASVASLHEDEQGIIPRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTAS
FT                   RDIQLREDDRGNVVLCGVKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFT
FT                   HFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIPYRDSKIT
FT                   RILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPEAERVPE
FT                   EQAAGARGPPRHRSETRIIHRGRRGDEGTQQLLTLQSQVARLEEENRDFLAALEDAMEQ
FT                   YKLQSDRLREQQEEMVELRLRLELAQPGWGAPGLLQGLPPGSFVPRPHTAPLGGAHTHM
FT                   LGMMPSTCLPGEEVSSEQLEGEDVVEEVEERTVCRTGHTSGSEDALRAFSSRGADPDNL
FT                   HVVAVGSGKVPVQTRQAPAAMASEWRLAQAQQKIRELAINIRMKEELIGELVRTGKAAQ
FT                   ALNRQHSQRIRELEQEAERVRAELCEGQRQLRELEGREPQDASERSRLQEFRKRVAAAQ
FT                   SQVQVLKEKKQATERLVSLSAQSETRLQELERNVQLMRRQQGQLQRRLREETEQKRRLE
FT                   TEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGSNGSVVSLEQQQKIEEQK
FT                   KWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKTGLESKRLRSSQALNEDI
FT                   VRVSSRLEHLEKELSEKSGQLRQGSAQNQQQIRGEIDTLRQEKDSLLKQRLEIDSKLRQ
FT                   GSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQCEMNLMAKLS
FT                   YLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEVALERQRLE
FT                   MDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIHALEKELGRHMWINQEL
FT                   KQKLSAGSTAGQSRGCERRSLCLENRQCLGNEDGLHPAAPEPLWQSSLLEGVSRVWDES
FT                   RDLVHAPLPLTWKRSSLCSEQGSSEESRVRETTEPPVGRVLPMGEVGLSWNFGPLPKPR
FT                   WEPRRTSPGMIDVRKNPL"
FT   mRNA            complement(join(<17105832..17105893,17106491..17106697,
FT                   17107258..17107441,17110996..17111136,17113046..17113195,
FT                   17113299..>17113353))
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, transcript variant mCT175837"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT175837.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(<17105832..17105893,17106491..17106697,
FT                   17107258..17107441,17110996..>17111045))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19450"
FT                   /product="mCG19450, isoform CRA_a"
FT                   /note="gene_id=mCG19450.1 transcript_id=mCT175837.0
FT                   protein_id=mCP98759.0 isoform=CRA_a"
FT                   /protein_id="EDL07056.1"
FT                   /translation="RAEAASRAGGQGAPRCHRLEHLEKELSEKSGQLRQGSAQNQQQIR
FT                   GEIDTLRQEKDSLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAI
FT                   TCRQRVLRASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFS
FT                   ELEM"
FT   gene            17116679..17118667
FT                   /locus_tag="mCG_147196"
FT                   /note="gene_id=mCG147196.0"
FT   mRNA            17116679..17118667
FT                   /locus_tag="mCG_147196"
FT                   /product="mCG147196"
FT                   /note="gene_id=mCG147196.0 transcript_id=mCT187459.0
FT                   created on 13-JAN-2004"
FT   CDS             17117040..17117426
FT                   /codon_start=1
FT                   /locus_tag="mCG_147196"
FT                   /product="mCG147196"
FT                   /note="gene_id=mCG147196.0 transcript_id=mCT187459.0
FT                   protein_id=mCP109604.0"
FT                   /db_xref="GOA:Q9D5P0"
FT                   /db_xref="MGI:MGI:3696417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5P0"
FT                   /protein_id="EDL07058.1"
FT                   /translation="MWLPRRWGSPRALMTFPSASRVLLIWMLSLSRSPVLPVFRTLSEP
FT                   ARSTKWNLETSRWPAAGRGKRLGVRPRCSRVTVKTVCERLERRLKCVAPVWRAALPISR
FT                   RLSTSSRPSTSTSFTPQSTVETTL"
FT   gap             17120921..17120940
FT                   /estimated_length=20
FT   gap             17124567..17124586
FT                   /estimated_length=20
FT   gap             17127304..17127794
FT                   /estimated_length=491
FT   gene            complement(17128086..17139806)
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /note="gene_id=mCG19463.2"
FT   mRNA            complement(join(17128086..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..17139067,
FT                   17139654..17139806))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT20084"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT20084.2 created
FT                   on 11-NOV-2002"
FT   mRNA            complement(join(17128086..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..>17139083))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT189931"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT189931.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(17128309..17128680,17129529..17129601,
FT                   17130264..>17130301))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175844"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175844.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17128342..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..>17139083))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_e"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT189931.0
FT                   protein_id=mCP110920.0 isoform=CRA_e"
FT                   /protein_id="EDL07054.1"
FT                   /translation="GFCFAAWRVRMSMNKGPTLLDGDLPEQENVLQRVLQLPVVSGTCE
FT                   CFQKTYNSTKEAHPLVASVCNAYEKGVQGASNLAAWSMEPVVRRLSTQFTAANELACRG
FT                   LDHLEEKIPALQYPPEKIASELKGTISTRLRSARNSISVPIASTSDKVLGATLAGCELA
FT                   LGMAKETAEYAANTRVGRLASGGADLALGSIEKVVEFLLPPDKESAPSSGRQRTQKAPK
FT                   AKPSLVRRVSTLANTLSRHTMQTTAWALKQGHSLAMWIPGVAPLSSLAQWGASAAMQVV
FT                   SRRQSEVRVPWLHNLAASQDESHDDQTDTEGEETDDEEEEEESEAEENVLREVTALPNP
FT                   RGLLGGVVHTVQNTLRNTISAVTWAPAAVLGTVGRILHLTPAQAVSSTKGRAMSLSDAL
FT                   KGVTDNVVDTVVHYVPLPRLSLMEPESEFRDIDNPSAEAERKGSGARPASPESTPRPGQ
FT                   PRGSLRSVRGLSAPSCPGLDDKTEASARPGFLAMPREKPARRVSDSFFRPSVMEPILGR
FT                   AQYSQLRKKS"
FT   CDS             complement(join(17128342..17128680,17129529..17129774,
FT                   17130172..17130372,17132556..17132728,17133316..17133577,
FT                   17134882..17134964,17136763..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_f"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT20084.2
FT                   protein_id=mCP7265.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q8CGN5"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:1890505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGN5"
FT                   /protein_id="EDL07055.1"
FT                   /translation="MSMNKGPTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYNSTK
FT                   EAHPLVASVCNAYEKGVQGASNLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPA
FT                   LQYPPEKIASELKGTISTRLRSARNSISVPIASTSDKVLGATLAGCELALGMAKETAEY
FT                   AANTRVGRLASGGADLALGSIEKVVEFLLPPDKESAPSSGRQRTQKAPKAKPSLVRRVS
FT                   TLANTLSRHTMQTTAWALKQGHSLAMWIPGVAPLSSLAQWGASAAMQVVSRRQSEVRVP
FT                   WLHNLAASQDESHDDQTDTEGEETDDEEEEEESEAEENVLREVTALPNPRGLLGGVVHT
FT                   VQNTLRNTISAVTWAPAAVLGTVGRILHLTPAQAVSSTKGRAMSLSDALKGVTDNVVDT
FT                   VVHYVPLPRLSLMEPESEFRDIDNPSAEAERKGSGARPASPESTPRPGQPRGSLRSVRG
FT                   LSAPSCPGLDDKTEASARPGFLAMPREKPARRVSDSFFRPSVMEPILGRAQYSQLRKKS
FT                   "
FT   CDS             complement(join(17128342..17128680,17129529..17129601,
FT                   17130264..>17130265))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_c"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175844.0
FT                   protein_id=mCP98766.0 isoform=CRA_c"
FT                   /protein_id="EDL07052.1"
FT                   /translation="EAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDIDNPS
FT                   AEAERKGSGARPASPESTPRPGQPRGSLRSVRGLSAPSCPGLDDKTEASARPGFLAMPR
FT                   EKPARRVSDSFFRPSVMEPILGRAQYSQLRKKS"
FT   mRNA            complement(join(17129302..17129774,17130172..17130189,
FT                   17136839..17136967,17139009..17139067,17139654..17139805))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175842"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175842.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17129478..17129774,17130172..17130189,
FT                   17136839..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_a"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175842.0
FT                   protein_id=mCP98765.0 isoform=CRA_a"
FT                   /protein_id="EDL07050.1"
FT                   /translation="MSMNKGPTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYNSTK
FT                   EAHPLVASVCNAYENVLREVTALPNPRGLLGGVVHTVQNTLRNTISAVTWAPAAVLGTV
FT                   GRILHLTPAQAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPVSPAPGPPSDSQGRFD"
FT   mRNA            complement(join(17132412..17132728,17133316..17133577,
FT                   17134882..>17134971))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175845"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175845.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17132517..17132728,17133316..17133577,
FT                   17134882..>17134971))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_d"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175845.0
FT                   protein_id=mCP98764.0 isoform=CRA_d"
FT                   /protein_id="EDL07053.1"
FT                   /translation="LSVTAANELACRGLDHLEEKIPALQYPPEKIASELKGTISTRLRS
FT                   ARNSISVPIASTSDKVLGATLAGCELALGMAKETAEYAANTRVGRLASGGADLALGSIE
FT                   KVVEFLLPPDKESAPSSGRQRTQKAPKAKPSLVRRVSTLANTLSRHTMQTTAWALKQGH
FT                   SLAMWIPGVAPLVSVCSEFPLALL"
FT   mRNA            complement(join(17136392..17136967,17139009..17139067,
FT                   17139654..17139805))
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, transcript variant mCT175843"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175843.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17136749..17136967,17139009..17139053))
FT                   /codon_start=1
FT                   /gene="Plin"
FT                   /locus_tag="mCG_19463"
FT                   /product="perilipin, isoform CRA_b"
FT                   /note="gene_id=mCG19463.2 transcript_id=mCT175843.0
FT                   protein_id=mCP98767.0 isoform=CRA_b"
FT                   /protein_id="EDL07051.1"
FT                   /translation="MSMNKGPTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYNSTK
FT                   EAHPLVASVCNAYEKGVQGASNLAAWSMEPVVRRLSTQCESS"
FT   gap             17140198..17140690
FT                   /estimated_length=493
FT   gene            complement(17144028..>17149790)
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /note="gene_id=mCG19440.0"
FT   mRNA            complement(join(17144028..17144674,17146929..17147044,
FT                   17149675..>17149790))
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, transcript
FT                   variant mCT19835"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT19835.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(17144028..17144674,17149675..17149772))
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, transcript
FT                   variant mCT173115"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT173115.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(17144106..17144674,17146929..17147044,
FT                   17149675..>17149790))
FT                   /codon_start=1
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, isoform CRA_b"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT19835.0
FT                   protein_id=mCP7235.0 isoform=CRA_b"
FT                   /protein_id="EDL07049.1"
FT                   /translation="GDVPGDPRGSGRNAWLWVGAMDAFIRVANQSQGRDRLFRATQHAC
FT                   MLLRYLLESKADKEAVVLKLKRLETSVSTGRKWFRLGNVFHAIQATEQSIQAADLAPRL
FT                   CLTLANLNRVVYYICDTVLWAKSVGLTSGVNREKWQRWAARHYYYFLLLSLVRDLYEIL
FT                   LQMGQVARDRAKREKSSRDPPKYSVANEETEWLQSFLLLLFQSLKRHPPLLLDTVKNFC
FT                   DILIPLNQLGIYKSNLGVVGLGGLISSLAGLLTVVYPQLKLKAR"
FT   CDS             complement(join(17144632..17144674,17149675..17149730))
FT                   /codon_start=1
FT                   /gene="Pex11a"
FT                   /locus_tag="mCG_19440"
FT                   /product="peroxisomal biogenesis factor 11a, isoform CRA_a"
FT                   /note="gene_id=mCG19440.0 transcript_id=mCT173115.0
FT                   protein_id=mCP96034.0 isoform=CRA_a"
FT                   /protein_id="EDL07048.1"
FT                   /translation="MDAFIRVANQSQGRDRLFRVQTGQRVPCHPGN"
FT   gap             17166001..17166260
FT                   /estimated_length=260
FT   gap             17167085..17167104
FT                   /estimated_length=20
FT   gap             17170157..17170731
FT                   /estimated_length=575
FT   gap             17186881..17187126
FT                   /estimated_length=246
FT   gene            complement(17196875..17197537)
FT                   /locus_tag="mCG_141320"
FT                   /note="gene_id=mCG141320.0"
FT   mRNA            complement(17196875..17197537)
FT                   /locus_tag="mCG_141320"
FT                   /product="mCG141320"
FT                   /note="gene_id=mCG141320.0 transcript_id=mCT174600.0
FT                   created on 17-OCT-2002"
FT   CDS             complement(17197023..17197349)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141320"
FT                   /product="mCG141320"
FT                   /note="gene_id=mCG141320.0 transcript_id=mCT174600.0
FT                   protein_id=mCP97519.0"
FT                   /protein_id="EDL07047.1"
FT                   /translation="MQVSKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKK
FT                   LVKAIKKKFACNGTIIEHPEYGEVIQLQGDQRKNICQLLIETGLAKDDQPKAHGFKCLW
FT                   LSEA"
FT   gene            complement(17198996..17200522)
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /note="gene_id=mCG19467.1"
FT   mRNA            complement(join(17198996..17199345,17199619..17200522))
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /product="mesoderm posterior 1"
FT                   /note="gene_id=mCG19467.1 transcript_id=mCT20089.2 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(17199277..17199345,17199619..17200281))
FT                   /codon_start=1
FT                   /gene="Mesp1"
FT                   /locus_tag="mCG_19467"
FT                   /product="mesoderm posterior 1"
FT                   /note="gene_id=mCG19467.1 transcript_id=mCT20089.2
FT                   protein_id=mCP7308.1"
FT                   /protein_id="EDL07046.1"
FT                   /translation="MAQPLCEPRSESWILSPAGRQPPMPSDGNSVCSPAWSSDPWDGAQ
FT                   ASSPAPPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRTLARALHELRRFLP
FT                   PSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQRHAVSPRGCPLCPDSDLAQ
FT                   SQSLGPRLSPAVCSGVSWGSPPAYPRPRVAAESWDPSFLYAETASQERQEMEPSPSSPL
FT                   FSSDMLALLETWTPPQEWPPA"
FT   gene            17217553..17220184
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /note="gene_id=mCG19460.1"
FT   mRNA            join(17217553..17218518,17219288..17220184)
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /product="mesoderm posterior 2"
FT                   /note="gene_id=mCG19460.1 transcript_id=mCT20081.1 created
FT                   on 11-NOV-2002"
FT   CDS             join(17217688..17218518,17219288..17219569)
FT                   /codon_start=1
FT                   /gene="Mesp2"
FT                   /locus_tag="mCG_19460"
FT                   /product="mesoderm posterior 2"
FT                   /note="gene_id=mCG19460.1 transcript_id=mCT20081.1
FT                   protein_id=mCP7231.1"
FT                   /db_xref="GOA:A6H5V4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:1096325"
FT                   /db_xref="UniProtKB/TrEMBL:A6H5V4"
FT                   /protein_id="EDL07045.1"
FT                   /translation="MAQSPPPQSLQGLDHWVFSQGWGWAQQSDSTSPASSSDSSGSCPC
FT                   YATRRPSQPAGPARSTRTTQATAPRRTRPAPAGGQRQSASEREKLRMRTLARALQELRR
FT                   FLPPSVAPAGQSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRRRSADAAFSHRCPQC
FT                   PDGGSPSQAQMLGPSLGSAMSSGVSWGCPPACPGPLISPENLGNRISNVDPWVTPPYCP
FT                   QIQSPLHQSLERAADSSPWAPPQACPGMQMSPEPRNKTGHWTQSTEPAELTKVYQSLSV
FT                   SPEPCLSLGSPLLLPRPSCQRLQPQPQPQPQWGCWGHDAEVLSTSEDQGSSPALQLPVA
FT                   SPTPSSGLQLSGCPELWQEDLEGPPLNIFY"
FT   gap             17228462..17228564
FT                   /estimated_length=103
FT   gene            complement(17228651..17250509)
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /note="gene_id=mCG19457.1"
FT   mRNA            complement(join(17228651..17229223,17232150..17232231,
FT                   17232553..17232693,17233439..17233606,17233718..17233828,
FT                   17234419..17234510,17241813..17241960,17243356..17243411,
FT                   17243513..17243646,17244195..17244268,17244457..17244632,
FT                   17246468..17246533,17246639..17246704,17246873..17247016,
FT                   17247114..17247227,17247388..17247542,17247627..17247753,
FT                   17249098..17249234,17249311..17249453,17249863..17250509))
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /product="alanyl (membrane) aminopeptidase"
FT                   /note="gene_id=mCG19457.1 transcript_id=mCT20079.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(17229071..17229223,17232150..17232231,
FT                   17232553..17232693,17233439..17233606,17233718..17233828,
FT                   17234419..17234510,17241813..17241960,17243356..17243411,
FT                   17243513..17243646,17244195..17244268,17244457..17244632,
FT                   17246468..17246533,17246639..17246704,17246873..17247016,
FT                   17247114..17247227,17247388..17247542,17247627..17247753,
FT                   17249098..17249234,17249311..17249453,17249863..17250476))
FT                   /codon_start=1
FT                   /gene="Anpep"
FT                   /locus_tag="mCG_19457"
FT                   /product="alanyl (membrane) aminopeptidase"
FT                   /note="gene_id=mCG19457.1 transcript_id=mCT20079.1
FT                   protein_id=mCP7344.1"
FT                   /protein_id="EDL07044.1"
FT                   /translation="MAKGFYISKTLGILGILLGVAAVCTIIALSVVYAQEKNRNAENSA
FT                   TAPTLPGSTSATTATTTPAVDESKPWNQYRLPKTLIPDSYRVILRPYLTPNNQGLYIFQ
FT                   GNSTVRFTCNQTTDVIIIHSKKLNYTLKGNHRVVLRTLDGTPAPNIDKTELVERTEYLV
FT                   VHLQGSLVEGRQYEMDSQFQGELADDLAGFYRSEYMEGDVKKVVATTQMQAADARKSFP
FT                   CFDEPAMKAMFNITLIYPNNLIALSNMLPKESKPYPEDPSCTMTEFHSTPKMSTYLLAY
FT                   IVSEFKNISSVSANGVQIGIWARPSAIDEGQGDYALNVTGPILNFFAQHYNTSYPLPKS
FT                   DQIALPDFNAGAMENWGLVTYRESSLVFDSQSSSISNKERVVTVIAHELAHQWFGNLVT
FT                   VAWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSSPA
FT                   DEIKTPDQIMELFDSITYSKGASVIRMLSSFLTEDLFKKGLSSYLHTYQYSNTVYLDLW
FT                   EHLQKAVNQQTAVQPPATVRTIMDRWILQMGFPVITVNTNTGEISQKHFLLDSKSNVTR
FT                   PSEFNYIWIAPIPFLKSGQEDHYWLDVEKNQSAKFQTSSNEWILLNINVTGYYLVNYDE
FT                   NNWKKLQNQLQTDLSVIPVINRAQIIHDSFNLASAKMIPITLALDNTLFLVKEAEYMPW
FT                   QAALSSLNYFTLMFDRSEVYGPMKRYLKKQVTPLFFYFQNRTNNWVNRPPTLMEQYNEI
FT                   NAISTACSSGLKECRDLVVELYSQWMKNPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAW
FT                   EQFRNATLVNEADKLRSALACSKDVWILNRYLSYTLNPDYIRKQDTTSTIISIASNVAG
FT                   HPLVWDFVRSNWKKLFENYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKADNSATGFG
FT                   TGTRALEQALEKTRANIDWVKENKDAVFKWFTENSS"
FT   gap             17235810..17237803
FT                   /estimated_length=1994
FT   gap             17254034..17254053
FT                   /estimated_length=20
FT   gap             17255926..17257131
FT                   /estimated_length=1206
FT   gap             17258350..17258369
FT                   /estimated_length=20
FT   gap             17274327..17274383
FT                   /estimated_length=57
FT   gap             17276903..17276961
FT                   /estimated_length=59
FT   gene            complement(17286171..17327030)
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /note="gene_id=mCG19454.2"
FT   mRNA            complement(join(17286171..17287021,17288875..17288982,
FT                   17316269..17316340,17321581..17321692,17322450..17322541,
FT                   17326943..17327029))
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, transcript variant mCT20077"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT20077.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(17286893..17287021,17288875..17288982,
FT                   17316269..17316340,17321581..17321692,17322450..17322541,
FT                   17326943..17327011))
FT                   /codon_start=1
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT20077.1
FT                   protein_id=mCP7324.1 isoform=CRA_b"
FT                   /protein_id="EDL07043.1"
FT                   /translation="MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDN
FT                   ICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENV
FT                   CELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVS
FT                   AVKNINLPEIPRNINIGDLNIKVPNLSQFV"
FT   mRNA            complement(join(17288920..17288982,17316269..17316340,
FT                   17321581..17321692,17322450..17322541,17323665..17323756,
FT                   17326943..17327030))
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, transcript variant mCT173116"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT173116.0 created
FT                   on 10-SEP-2002"
FT   gap             17304037..17304112
FT                   /estimated_length=76
FT   CDS             complement(join(17323697..17323756,17326943..17327011))
FT                   /codon_start=1
FT                   /gene="Ap3s2"
FT                   /locus_tag="mCG_19454"
FT                   /product="adaptor-related protein complex 3, sigma 2
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG19454.2 transcript_id=mCT173116.0
FT                   protein_id=mCP96035.0 isoform=CRA_a"
FT                   /protein_id="EDL07042.1"
FT                   /translation="MIQAILVFNNHGKPRLVRFYQRFVLTPYPWLNWNLLCRPGWH"
FT   gene            17327187..17328955
FT                   /locus_tag="mCG_147210"
FT                   /note="gene_id=mCG147210.0"
FT   mRNA            join(17327187..17327373,17327483..17328955)
FT                   /locus_tag="mCG_147210"
FT                   /product="mCG147210"
FT                   /note="gene_id=mCG147210.0 transcript_id=mCT187473.0
FT                   created on 13-JAN-2004"
FT   CDS             17327805..17328062
FT                   /codon_start=1
FT                   /locus_tag="mCG_147210"
FT                   /product="mCG147210"
FT                   /note="gene_id=mCG147210.0 transcript_id=mCT187473.0
FT                   protein_id=mCP109617.0"
FT                   /protein_id="EDL07041.1"
FT                   /translation="MSKTILKQSSKKEPALPTNQTKQDNLKYVLKLHLYGFFWRGPTRL
FT                   QRCMCGNQRTIWGVSSLLLCKRSNVSHQTWQCLYLTSLKS"
FT   gene            complement(17332253..17341748)
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /note="gene_id=mCG141104.0"
FT   mRNA            complement(join(17332253..17333284,17334060..17334223,
FT                   17334606..17334812,17336007..17336139,17338229..17338304,
FT                   17341579..17341748))
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /product="RIKEN cDNA 2610034B18"
FT                   /note="gene_id=mCG141104.0 transcript_id=mCT173117.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(17333276..17333284,17334060..17334223,
FT                   17334606..17334812,17336007..17336139,17338229..17338304,
FT                   17341579..17341670))
FT                   /codon_start=1
FT                   /gene="2610034B18Rik"
FT                   /locus_tag="mCG_141104"
FT                   /product="RIKEN cDNA 2610034B18"
FT                   /note="gene_id=mCG141104.0 transcript_id=mCT173117.0
FT                   protein_id=mCP96036.0"
FT                   /protein_id="EDL07040.1"
FT                   /translation="MSRIYQDSALRNKAVQSARLPGTWDPATHQGGNGILLEGELVDVS
FT                   RHSILDAHGRKERYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEA
FT                   KGDTDRLTLEALKSLVNKPQLLELTESLTPDQAVAFWMPESEMEVMELELGTGVRLKTR
FT                   GDGPFIDSLAKLELGTVTKCNFAGDGKTGASWTDNIMAQKSSERNTAEIREQGDGAEDE
FT                   EWDD"
FT   gap             17343560..17343579
FT                   /estimated_length=20
FT   gap             17352534..17352701
FT                   /estimated_length=168
FT   gap             17358965..17359016
FT                   /estimated_length=52
FT   gap             17373582..17373601
FT                   /estimated_length=20
FT   gap             17378989..17379193
FT                   /estimated_length=205
FT   gap             17381793..17381812
FT                   /estimated_length=20
FT   gap             17383084..17383103
FT                   /estimated_length=20
FT   gap             17388225..17388279
FT                   /estimated_length=55
FT   gap             17397531..17398252
FT                   /estimated_length=722
FT   gap             17402277..17402505
FT                   /estimated_length=229
FT   gap             17407092..17407144
FT                   /estimated_length=53
FT   gap             17410440..17410531
FT                   /estimated_length=92
FT   gap             17414727..17414983
FT                   /estimated_length=257
FT   gap             17415864..17415984
FT                   /estimated_length=121
FT   gap             17417415..17417947
FT                   /estimated_length=533
FT   gap             17424629..17424648
FT                   /estimated_length=20
FT   gap             17431710..17432673
FT                   /estimated_length=964
FT   gap             17439554..17439612
FT                   /estimated_length=59
FT   gap             17446229..17446265
FT                   /estimated_length=37
FT   gap             17459507..17459612
FT                   /estimated_length=106
FT   gene            complement(17468468..>17481218)
FT                   /locus_tag="mCG_1028355"
FT                   /note="gene_id=mCG1028355.1"
FT   mRNA            complement(join(17468468..17468657,17475494..17475661,
FT                   17481044..>17481218))
FT                   /locus_tag="mCG_1028355"
FT                   /product="mCG1028355"
FT                   /note="gene_id=mCG1028355.1 transcript_id=mCT146059.1
FT                   created on 11-NOV-2002"
FT   gene            17469599..17470936
FT                   /locus_tag="mCG_1028354"
FT                   /note="gene_id=mCG1028354.1"
FT   mRNA            join(17469599..17470094,17470272..17470936)
FT                   /locus_tag="mCG_1028354"
FT                   /product="mCG1028354"
FT                   /note="gene_id=mCG1028354.1 transcript_id=mCT146058.1
FT                   created on 11-NOV-2002"
FT   CDS             17469705..17469857
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028354"
FT                   /product="mCG1028354"
FT                   /note="gene_id=mCG1028354.1 transcript_id=mCT146058.1
FT                   protein_id=mCP88742.1"
FT                   /protein_id="EDL07039.1"
FT                   /translation="MLCLCSPSLLPFTLGTPHLPGDLSLFSGSFFSSLFFYSVPHFFSS
FT                   APFFF"
FT   gap             17471250..17471341
FT                   /estimated_length=92
FT   gap             17474505..17474691
FT                   /estimated_length=187
FT   CDS             complement(join(17475540..17475661,17481044..>17481122))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028355"
FT                   /product="mCG1028355"
FT                   /note="gene_id=mCG1028355.1 transcript_id=mCT146059.1
FT                   protein_id=mCP88745.1"
FT                   /protein_id="EDL07038.1"
FT                   /translation="RNTPGDSPGSKTSPLASSCCSHSRPKASQPVEKPHVWTRRLSEGE
FT                   GWGPVIRTSALRADGSPGTRC"
FT   gene            17486824..17496945
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /note="gene_id=mCG19453.2"
FT   mRNA            join(17486824..17488490,17491948..17492139,
FT                   17492431..17492605,17496341..17496945)
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, transcript variant
FT                   mCT20076"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT20076.2 created
FT                   on 11-NOV-2002"
FT   CDS             join(17487027..17488490,17491948..17492139,
FT                   17492431..17492605,17496341..17496510)
FT                   /codon_start=1
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, isoform CRA_b"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT20076.2
FT                   protein_id=mCP7226.2 isoform=CRA_b"
FT                   /protein_id="EDL07037.1"
FT                   /translation="MEGFMDSGTQTDAVVVLSLAQAAVLGLVSENELFGATISAEAFYP
FT                   DLGPELTGTAMGEPGPPGPDIYQLACNGRALEEPPEEEVLEVEAAFEKHTRRKTRPPVR
FT                   LVPKVKFEKAEEEEEQEVYEVSVPGDDKDPGPAEAPAEVASSGCEALVQSSAVKMIDLS
FT                   AFSRKPRTLRHLPRTPRPELDMAPFDPPFPDPARDGFPEPSMALPGPETLPTECSFEPP
FT                   HLAPLSNPEPPNMTSTTELVKPEQGFVWQESSEFEADTAGSTVERHKKAQLDRLDINVQ
FT                   IDDSYLVEAGDRQKRWQCRMCEKSYTSKYNLVTHILGHNGIKPHSCPHCSKLFKQPSHL
FT                   QTHLLTHQGTRPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGRGFAYPSELKAH
FT                   EVKHESGRCHVCVECGLDFSTLTQLKRHLASHQGPTLYQCLECDKSFHYRSQLQNHMLK
FT                   HQNVRPFVCTECGMEFSQIHHLKQHSLTHKGVKEFKCEVCGREFTLQANMKRHMLIHTS
FT                   VRPYQCHICFKTFVQKQTLKTHMIVHSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKP
FT                   FKCPYCSSKFNLKGNLSRHMKVKHGVMDISLDSQDPMMELAGPDPSELDNHQEMEDFEE
FT                   NAYTYSSVDSSAEASTLTEQAMKEMAYYNVL"
FT   mRNA            join(<17487027..17488490,17491948..17492139,
FT                   17492431..17492847)
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, transcript variant
FT                   mCT175838"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT175838.0 created
FT                   on 11-NOV-2002"
FT   CDS             join(17487027..17488490,17491948..17492139,
FT                   17492431..17492772)
FT                   /codon_start=1
FT                   /gene="Zfp710"
FT                   /locus_tag="mCG_19453"
FT                   /product="zinc finger protein 710, isoform CRA_a"
FT                   /note="gene_id=mCG19453.2 transcript_id=mCT175838.0
FT                   protein_id=mCP98760.0 isoform=CRA_a"
FT                   /protein_id="EDL07036.1"
FT                   /translation="MEGFMDSGTQTDAVVVLSLAQAAVLGLVSENELFGATISAEAFYP
FT                   DLGPELTGTAMGEPGPPGPDIYQLACNGRALEEPPEEEVLEVEAAFEKHTRRKTRPPVR
FT                   LVPKVKFEKAEEEEEQEVYEVSVPGDDKDPGPAEAPAEVASSGCEALVQSSAVKMIDLS
FT                   AFSRKPRTLRHLPRTPRPELDMAPFDPPFPDPARDGFPEPSMALPGPETLPTECSFEPP
FT                   HLAPLSNPEPPNMTSTTELVKPEQGFVWQESSEFEADTAGSTVERHKKAQLDRLDINVQ
FT                   IDDSYLVEAGDRQKRWQCRMCEKSYTSKYNLVTHILGHNGIKPHSCPHCSKLFKQPSHL
FT                   QTHLLTHQGTRPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGRGFAYPSELKAH
FT                   EVKHESGRCHVCVECGLDFSTLTQLKRHLASHQGPTLYQCLECDKSFHYRSQLQNHMLK
FT                   HQNVRPFVCTECGMEFSQIHHLKQHSLTHKGVKEFKCEVCGREFTLQANMKRHMLIHTS
FT                   VRPYQCHICFKTFVQKQTLKTHMIVHSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKP
FT                   FKCPYCSSKFNLKGNLSRHMKVKHGVMDISLDSQGGWAVRSGQSRIDSSMAHSGVSSPI
FT                   RGVGGLAKAETSMRWAQVWREGEPGEPLWQ"
FT   gene            complement(17500853..17521345)
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /note="gene_id=mCG19451.2"
FT   mRNA            complement(join(17500853..17501210,17501630..17501722,
FT                   17501808..17501905,17502032..17502144,17503813..17503964,
FT                   17504145..17504281,17504774..17504917,17505001..17505161,
FT                   17506746..17506911,17509124..17509215,17521185..17521334))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT20074"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT20074.0 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(17501066..17501175,17506865..17506911,
FT                   17509124..17509215,17521185..17521327))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172343"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172343.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(17501123..17501210,17501630..17501722,
FT                   17501808..17501905,17502032..17502144,17503813..17503964,
FT                   17504145..17504281,17504774..17504917,17505001..17505161,
FT                   17506746..17506911,17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_d"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT20074.0
FT                   protein_id=mCP7300.1 isoform=CRA_d"
FT                   /protein_id="EDL07035.1"
FT                   /translation="MAGYLRAVSSLCRASGSARTWAPAALTVPSWPEQPRRHYAEKRIK
FT                   VEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALAT
FT                   QKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPG
FT                   WTKPITIGRHAHGDQYKATDFVVDRAGTFKLVFTPKDGSSAKEWEVYNFPAGGVGMGMY
FT                   NTDESISGFAHSCFQYSIQKKWPLYLSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKN
FT                   KIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGK
FT                   TIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLE
FT                   KVCVQTVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGKQ"
FT   CDS             complement(join(17501157..17501175,17506865..17506911,
FT                   17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_a"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172343.0
FT                   protein_id=mCP95262.0 isoform=CRA_a"
FT                   /protein_id="EDL07032.1"
FT                   /translation="MAGYLRAVSSLCRASGSARTWAPAALTVPSWPEQPRRHYAEKRIK
FT                   VEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPGHH"
FT   mRNA            complement(join(<17501687..17501722,17501808..17501905,
FT                   17502032..17502144,17503813..>17504412))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172344"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172344.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(<17501687..17501722,17501808..17501905,
FT                   17502032..17502144,17503813..>17504140))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_b"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172344.0
FT                   protein_id=mCP95263.0 isoform=CRA_b"
FT                   /protein_id="EDL07033.1"
FT                   /translation="QPLMLPGGTTAPRLPCAIPTSPGEVAFLVCAWFSCEFQGGVFNLP
FT                   TPCPLPETSPFAPRHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQS
FT                   DILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWT
FT                   RGLEHRGKLDGNQDLIRFAQTLEKVCVQT"
FT   mRNA            complement(join(17505004..17505159,17506739..17506911,
FT                   17509124..17509215,17521185..17521345))
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, transcript variant mCT172345"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172345.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(17505150..17505159,17506739..17506911,
FT                   17509124..17509215,17521185..17521299))
FT                   /codon_start=1
FT                   /gene="Idh2"
FT                   /locus_tag="mCG_19451"
FT                   /product="isocitrate dehydrogenase 2 (NADP+),
FT                   mitochondrial, isoform CRA_c"
FT                   /note="gene_id=mCG19451.2 transcript_id=mCT172345.0
FT                   protein_id=mCP95264.0 isoform=CRA_c"
FT                   /protein_id="EDL07034.1"
FT                   /translation="MAGYLRAVSSLCRASGSARTWAPAALTVPSWPEQPRRHYAEKRIK
FT                   VEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALAT
FT                   QKYSVAVKCATITPDEARVEGMISS"
FT   gap             17526587..17527909
FT                   /estimated_length=1323
FT   gap             17531322..17531341
FT                   /estimated_length=20
FT   gap             17548355..17548374
FT                   /estimated_length=20
FT   gap             17549552..17549571
FT                   /estimated_length=20
FT   gap             17552877..17552896
FT                   /estimated_length=20
FT   gap             17555950..17555969
FT                   /estimated_length=20
FT   gap             17557061..17559166
FT                   /estimated_length=2106
FT   gap             17563925..17564059
FT                   /estimated_length=135
FT   gap             17565713..17565813
FT                   /estimated_length=101
FT   gap             17569828..17569847
FT                   /estimated_length=20
FT   gap             17584965..17585023
FT                   /estimated_length=59
FT   gap             17592477..17592997
FT                   /estimated_length=521
FT   gap             17594581..17595613
FT                   /estimated_length=1033
FT   gene            17595619..17634311
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /note="gene_id=mCG19462.2"
FT   mRNA            join(17595619..17595732,17607448..17607699,
FT                   17621718..17621881,17622184..17622246,17624541..17624639,
FT                   17625246..17625357,17625647..17625760,17625865..17626016,
FT                   17627800..17627981,17628103..17628253,17629038..17629248,
FT                   17629359..17629474,17629705..17629871,17632822..17632904,
FT                   17633484..17634311)
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4B"
FT                   /note="gene_id=mCG19462.2 transcript_id=mCT20086.2 created
FT                   on 16-DEC-2002"
FT   gap             17601317..17601431
FT                   /estimated_length=115
FT   gap             17605471..17605795
FT                   /estimated_length=325
FT   CDS             join(17607582..17607699,17621718..17621881,
FT                   17622184..17622246,17624541..17624639,17625246..17625357,
FT                   17625647..17625760,17625865..17626016,17627800..17627981,
FT                   17628103..17628253,17629038..17629248,17629359..17629474,
FT                   17629705..17629871,17632822..17632904,17633484..17634223)
FT                   /codon_start=1
FT                   /gene="Sema4b"
FT                   /locus_tag="mCG_19462"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4B"
FT                   /note="gene_id=mCG19462.2 transcript_id=mCT20086.2
FT                   protein_id=mCP7317.1"
FT                   /protein_id="EDL07031.1"
FT                   /translation="MGRASRSAVLRRALLLLLLLLLLRTTTTRALGPRISVPLGSEERL
FT                   IRKFEAENISNYTALLLSQDGKTLYVGAREALFALNSNLSFLPGGEYQELLWSADADRK
FT                   QQCSFKGKDPKRDCQNYIKILLPLNSSHLLTCGTAAFSPLCAYIHIASFTLAQDEAGNV
FT                   ILEDGKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSSRPTKTESSLNWL
FT                   QDPAFVASAYVPESLGSPIGDDDKIYFFFSETGQEFEFFENTIVSRVARVCKGDEGGER
FT                   VLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLNPNPQDWRKTLFYGVFTSQWHRGTT
FT                   EGSAICVFTMNDVQKAFDGLYKKVNRETQQWYTETHQVPTPRPGACITNSARERKINSS
FT                   LQLPDRVLNFLKDHFLMDGQVRSRLLLLQPRARYQRVAVHRVPGLHSTYDVLFLGTGDG
FT                   RLHKAVTLSSRVHIIEELQIFPQGQPVQNLLLDSHGGLLYASSHSGVVQVPVANCSLYP
FT                   TCGDCLLARDPYCAWTGSACRLASLYQPDLASRPWTQDIEGASVKELCKNSSYKARFLV
FT                   PGKPCKQVQIQPNTVNTLACPLLSNLATRLWVHNGAPVNASASCRVLPTGDLLLVGSQQ
FT                   GLGVFQCWSIEEGFQQLVASYCPEVMEEGVMDQKNQRDGTPVIINTSRVSAPAGGRASW
FT                   GADKSYWNEFLVMCTLFVFAMVLLFLFFLYRHRDGMKLFLKQGECASVHPKTRPIVLPP
FT                   ETRPLNGVGPPSTPLDHRGYQALSDSSPGPRVFTESEKRPLSIQDSFVEVSPVCPRPRV
FT                   RLGSEIRDSVV"
FT   gene            complement(17636036..17641618)
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /note="gene_id=mCG19448.1"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT177763"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177763.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637417,17639200..17639308,
FT                   17641228..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT177762"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177762.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(17636036..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17639200..17639308,
FT                   17641228..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT19839"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT19839.2 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177763.1
FT                   protein_id=mCP100685.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C2K4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1344418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C2K4"
FT                   /protein_id="EDL07028.1"
FT                   /translation="MGGSGSRLSKELLAEYQANPFKERICMVFSTSPTRDSLSFEDFLD
FT                   LLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSQLVNCLTGEGEDTRLSASEMKQL
FT                   IDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637417,17639200..17639308,
FT                   17641228..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT177762.1
FT                   protein_id=mCP100684.1 isoform=CRA_a"
FT                   /protein_id="EDL07027.1"
FT                   /translation="MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEQRTV
FT                   EESLHTRVSFEQILSLPELKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSH
FT                   YAFRIFDFDDDGTLDREDLSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTI
FT                   NLSEFQHVISRSPDFASSFKIVL"
FT   CDS             complement(join(17636254..17636275,17636878..17636966,
FT                   17637046..17637164,17637282..17637432,17639200..17639308,
FT                   17641228..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT19839.2
FT                   protein_id=mCP7282.0 isoform=CRA_c"
FT                   /protein_id="EDL07029.1"
FT                   /translation="MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEQRTV
FT                   EESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATP
FT                   DIKSHYAFRIFDFDDDGTLDREDLSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDID
FT                   RDGTINLSEFQHVISRSPDFASSFKIVL"
FT   mRNA            complement(join(17640450..17641262,17641394..17641618))
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   transcript variant mCT172341"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT172341.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(17641224..17641262,17641394..17641444))
FT                   /codon_start=1
FT                   /gene="Cib1"
FT                   /locus_tag="mCG_19448"
FT                   /product="calcium and integrin binding 1 (calmyrin),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19448.1 transcript_id=mCT172341.0
FT                   protein_id=mCP95260.0 isoform=CRA_d"
FT                   /protein_id="EDL07030.1"
FT                   /translation="MGGSGSRLSKELLAEYQDLTFLTKQEILL"
FT   gene            17641801..17649533
FT                   /locus_tag="mCG_131044"
FT                   /note="gene_id=mCG131044.1"
FT   mRNA            join(17641801..17642093,17648252..17649533)
FT                   /locus_tag="mCG_131044"
FT                   /product="mCG131044"
FT                   /note="gene_id=mCG131044.1 transcript_id=mCT132372.1
FT                   created on 11-NOV-2002"
FT   gap             17647727..17648251
FT                   /estimated_length=525
FT   CDS             17648395..17649144
FT                   /codon_start=1
FT                   /locus_tag="mCG_131044"
FT                   /product="mCG131044"
FT                   /note="gene_id=mCG131044.1 transcript_id=mCT132372.1
FT                   protein_id=mCP88792.1"
FT                   /protein_id="EDL07026.1"
FT                   /translation="MQREPKGPATPKQEDDVLVVINVSPLEWGHVLLVPAPAQGLPQRL
FT                   LPGVLRVGLEAVLLSLHPGFRVGFNSLGGLASVNHLHLHCYYLAHPLPVEGAPSTPLDP
FT                   KGCIHLLQALPAPGFLFYTSGPGPDLEVLISRVCRATDYLSDREIAHNLFVTRGAPPGP
FT                   TSSTSDLSGIRVILWARKSSFGIKESGAFNVALCELAGHLPVKTSQDFSSLTEAAAVAL
FT                   IQDCLLPETQAGEVRAALVALMAQEEL"
FT   gap             17655880..17656056
FT                   /estimated_length=177
FT   gene            17656214..17670914
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /note="gene_id=mCG141534.0"
FT   mRNA            join(17656214..17656320,17656941..17657208,
FT                   17657953..17657993,17662531..17662750,17663160..17663316,
FT                   17663698..17663841,17664207..17664292,17664593..17664824,
FT                   17665434..17665618,17666939..17667124,17668274..17668454,
FT                   17668740..17668919,17669472..17669790,17670425..17670914)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175839"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175839.0
FT                   created on 11-NOV-2002"
FT   mRNA            join(17656651..17657208,17657953..>17658006)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175840"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175840.0
FT                   created on 11-NOV-2002"
FT   CDS             join(17656952..17657208,17657953..17657993,
FT                   17662531..17662750,17663160..17663316,17663698..17663841,
FT                   17664207..17664292,17664593..17664824,17665434..17665618,
FT                   17666939..17667124,17668274..17668454,17668740..17668919,
FT                   17669472..17669790,17670425..17670621)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_c"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175839.0
FT                   protein_id=mCP98763.0 isoform=CRA_c"
FT                   /protein_id="EDL07025.1"
FT                   /translation="MEPNNCKTSESEEDDIEEEESEEECVREESTTPNSTQQALRKADY
FT                   KEFENGVALSVVAKKIPKKILSATDTDDLEVGRRRRKRKRRPLAINLTNCKYESDLFHG
FT                   FLGRPGPRNYHLLQQRLNNQLTMFQKINHFPGMTEICRKDLLARNLNRMQKLYPTEYNI
FT                   FPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTPKEIKPGEHMICQQY
FT                   ITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARFATMPYVEPSHNNLEEVCMHLT
FT                   NYAINKHNENFVRDDAVGSKRKLSTLNAWLREHSHDPQELWGDIEDIIIKTIISAHSVL
FT                   RHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSRLDREVKDA
FT                   LLCDAMNLVNLRGCDKKKVIEEDKRRVKERLFPCHQQPRETRREQFELSQAAMHDQERY
FT                   EDSHLGGYRRIYPGPDSEKYAPFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQE
FT                   NPGTKKRKENKEQNQGESAGEKSRSRTATRVLATSLAYRNRNREKELLPVQLDTTQPQD
FT                   IVEEEELERMKLLLQRENLIRSLGIVEQLTRMLYPSHRSHRKLHEYRPRFHQDGLSSQE
FT                   LQPVNLVPLVLLRGAASEQIPPHFLQPLRPHELIPRILGPLSSINPAIAQHSRYHLQPK
FT                   NFNWIGDSAATGPCSLSMKKSGRHYISSSRVRLTSRKRRKAQHSTKTANGLQSLLIERL
FT                   PTSSRLKSSGQDLCLQKAKNTETPRVLQHSKILWGSVKTKR"
FT   CDS             join(17656952..17657208,17657953..>17658006)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_a"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175840.0
FT                   protein_id=mCP98762.0 isoform=CRA_a"
FT                   /protein_id="EDL07023.1"
FT                   /translation="MEPNNCKTSESEEDDIEEEESEEECVREESTTPNSTQQALRKADY
FT                   KEFENGVALSVVAKKIPKKILSATDTDDLEVGRRRRKRKRRPLAINLTNCKYESGKHRA
FT                   "
FT   gap             17660217..17660236
FT                   /estimated_length=20
FT   gap             17661730..17661899
FT                   /estimated_length=170
FT   mRNA            join(<17668371..17668454,17668740..17669285)
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, transcript variant
FT                   mCT175841"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175841.0
FT                   created on 11-NOV-2002"
FT   CDS             join(<17668371..17668454,17668740..17669012)
FT                   /codon_start=1
FT                   /gene="1700111A04Rik"
FT                   /locus_tag="mCG_141534"
FT                   /product="RIKEN cDNA 1700111A04, isoform CRA_b"
FT                   /note="gene_id=mCG141534.0 transcript_id=mCT175841.0
FT                   protein_id=mCP98761.0 isoform=CRA_b"
FT                   /protein_id="EDL07024.1"
FT                   /translation="AGEKSRSRTATRVLATSLAYRNRNREKELLPVQLDTTQPQDIVEE
FT                   EELERMKLLLQRENLIRSLGIVEQLTRMLYPSHRSHRKLHEYRVRVPAKPLTKQGNKGC
FT                   DANTWWWFHQRRFL"
FT   gene            17671344..17674073
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /note="gene_id=mCG19449.1"
FT   mRNA            join(17671344..17671519,17671917..17672027,
FT                   17673106..17674073)
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, transcript
FT                   variant mCT20072"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT20072.1 created
FT                   on 23-AUG-2002"
FT   mRNA            join(17671344..17672027,17673106..17673213)
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, transcript
FT                   variant mCT172342"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT172342.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(17671356..17671519,17671917..17672027,
FT                   17673106..17673712)
FT                   /codon_start=1
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT20072.1
FT                   protein_id=mCP7326.2 isoform=CRA_b"
FT                   /protein_id="EDL07022.1"
FT                   /translation="MALSLSLFLGGRVRTSLARCGFASQVMAGPGSVSCEPDPDSDWEP
FT                   EERELQEVESALKRQKKAMRFQKIRRQMEAPGAPPRTLTWEAMEQIRYLHKEFAESWSV
FT                   PRLAEGFDVSTDVIRRVLKSKFVPTLEQKLRQDQKVLKKAGFTREIGQLPVSEDTLKAL
FT                   SAGRSVSGLLMAGDEVSSKSQNHSTALKVAKSHPHSTDAQKKREGRDKRIQVLEESLVP
FT                   ATTALGHQRELQKSATSDSEATGRAGSDTLPSAVLLEELKPGEPGDQSFSSKVVQRGHD
FT                   FFDSNGNFLYRI"
FT   CDS             17671356..17671556
FT                   /codon_start=1
FT                   /gene="Ngrn"
FT                   /locus_tag="mCG_19449"
FT                   /product="neugrin, neurite outgrowth associated, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19449.1 transcript_id=mCT172342.0
FT                   protein_id=mCP95261.0 isoform=CRA_a"
FT                   /protein_id="EDL07021.1"
FT                   /translation="MALSLSLFLGGRVRTSLARCGFASQVMAGPGSVSCEPDPDSDWEP
FT                   EERELQEVERYLLRGEPSAWS"
FT   gap             17674074..17674300
FT                   /estimated_length=227
FT   gene            17678569..17699970
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /note="gene_id=mCG19446.2"
FT   mRNA            join(17678569..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17690890..17690984,17691827..17691931,17692379..17692456)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT175836"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175836.0 created
FT                   on 08-NOV-2002"
FT   mRNA            join(17678593..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17688364..17688409,17690890..17690984,17691827..17691931,
FT                   17692379..17692475,17692683..17692760,17692941..17693014,
FT                   17693417..17693503,17693649..17693739,17693955..17694029,
FT                   17694233..17694297,17694410..17694464,17695507..17695553,
FT                   17696177..17696309,17696799..17696872,17698382..17698483,
FT                   17698668..17698743,17698848..17698964,17699515..17699970)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT20070"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT20070.2 created
FT                   on 08-NOV-2002"
FT   CDS             join(17678883..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17688364..17688409,17690890..17690984,17691827..17691931,
FT                   17692379..17692475,17692683..17692760,17692941..17693014,
FT                   17693417..17693503,17693649..17693739,17693955..17694029,
FT                   17694233..17694297,17694410..17694464,17695507..17695553,
FT                   17696177..17696309,17696799..17696872,17698382..17698483,
FT                   17698668..17698743,17698848..17698964,17699515..17699594)
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT20070.2
FT                   protein_id=mCP7270.2 isoform=CRA_c"
FT                   /protein_id="EDL07020.1"
FT                   /translation="MAFPHRLDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADL
FT                   MSPLDRIANVSILKQHEVDKLYKVENKPALSANEQLCFLVRPRIKNMRYIASLVNADKL
FT                   AGRIRKYKVILSPQKFYACEMVLEEEGVYGDVSCDEWAFSLLPLDVDLLSMELPEFFRD
FT                   YFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMSYDLWRKLEEEEDSETKGRK
FT                   PEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNA
FT                   EDKVFSEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRL
FT                   LSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRL
FT                   MCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESK
FT                   VSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAY
FT                   VPLSCRIIEQVLDRRSWQGLDEVVRLLNCSEFAFTDTAKEDKASSESLRLILVVFLGGC
FT                   TFSEISALRFLGREKGYRFIFLTTAVTNSARLMEAMSEVKS"
FT   CDS             join(17678883..17678978,17682642..17682722,
FT                   17683037..17683098,17684455..17684504,17684807..17684874,
FT                   17690890..17690895)
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175836.0
FT                   protein_id=mCP98757.0 isoform=CRA_b"
FT                   /protein_id="EDL07019.1"
FT                   /translation="MAFPHRLDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADL
FT                   MSPLDRIANVSILKQHEVDKLYKVENKPALSANEQLCFLVRPRIKNMRYIASLVNADKL
FT                   AGRIRKYKVILSPQKM"
FT   gap             17680592..17680611
FT                   /estimated_length=20
FT   gap             17688534..17688624
FT                   /estimated_length=91
FT   mRNA            join(<17698440..17698483,17698668..17698743,
FT                   17699515..17699970)
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), transcript
FT                   variant mCT175835"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175835.0 created
FT                   on 08-NOV-2002"
FT   CDS             <17699644..17699910
FT                   /codon_start=1
FT                   /gene="Vps33b"
FT                   /locus_tag="mCG_19446"
FT                   /product="vacuolar protein sorting 33B (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19446.2 transcript_id=mCT175835.0
FT                   protein_id=mCP98758.0 isoform=CRA_a"
FT                   /protein_id="EDL07018.1"
FT                   /translation="DAGVWHLPSTIPVTHTHTHTHTHTHIYTYTHTHTHTHTHTHTHTH
FT                   TPQLHLILRAGNFGTNFGGENSCPILQDTPLAYKLYIVHAAKI"
FT   gene            complement(17701631..>17733640)
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /note="gene_id=mCG131045.1"
FT   mRNA            complement(join(17701631..17703341,17704396..17704442,
FT                   17711204..17711299,17714010..17714201,17719293..17719367,
FT                   17725011..17725197,17725600..17725629,17726707..17726874,
FT                   17727094..>17727723))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180397"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180397.0
FT                   created on 04-FEB-2003"
FT   gene            17702858..17724575
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /note="gene_id=mCG19465.2"
FT   mRNA            join(17702858..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17721052)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT185137"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185137.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702873..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721437,17723427..17724568)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT185136"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185136.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702876..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721514,17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT20087"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT20087.2 created
FT                   on 04-JUN-2003"
FT   mRNA            join(17702911..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17721836..17721874,
FT                   17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT175846"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT175846.0 created
FT                   on 04-JUN-2003"
FT   mRNA            join(<17702911..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17723427..17724575)
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, transcript
FT                   variant mCT189936"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT189936.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<17702912..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT189936.0
FT                   protein_id=mCP110921.0 isoform=CRA_d"
FT                   /protein_id="EDL07015.1"
FT                   /translation="RSPSRAWQVEGLDSGQLGASTMRRSEVLADESITCLQKALTHLRE
FT                   IWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSEL
FT                   QVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDV
FT                   DSTSVPTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVV
FT                   CEDESAFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPV
FT                   EAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFA
FT                   PYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRF
FT                   TNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWE
FT                   LHRLEKERAKQERQLKNKKQTEAEMLYGSTPRTPSKRPGQTPKKSGKMNTTTMSSATPN
FT                   SSIRPVFGGSVYRSPMSRLPPSGSKSVVTSLCSGKKTPRAAQLRANKENLDLNGSILSG
FT                   GYPGSTPLQHNCSIKSVASTYSEFSRELSKASRSDATSRILNSTNIQS"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721514,17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT20087.2
FT                   protein_id=mCP7267.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3UW86"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="MGI:MGI:1858961"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW86"
FT                   /protein_id="EDL07016.1"
FT                   /translation="MRRSEVLADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKK
FT                   HIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLR
FT                   TQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDVDSTSVPTLEELKLFRQRVATL
FT                   RETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESAFCLSLENIATLQKLL
FT                   KQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDR
FT                   LEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVR
FT                   LRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTL
FT                   PKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQT
FT                   EAEMLYGSTPRTPSKRPGQTPKKSGKVRKMNTTTMSSATPNSSIRPVFGGSVYRSPMSR
FT                   LPPSGSKSVVTSLCSGKKTPRAAQLRANKENLDLNGSILSGGYPGSTPLQHNCSIKSVA
FT                   STYSEFSRELSKASRSDATSRILNSTNIQS"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719466,
FT                   17720518..17720628,17721338..17721514,17721836..17721874,
FT                   17723427..17723498)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT175846.0
FT                   protein_id=mCP98768.0 isoform=CRA_a"
FT                   /protein_id="EDL07012.1"
FT                   /translation="MRRSEVLADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKK
FT                   HIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLR
FT                   TQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDVDSTSVPTLEELKLFRQRVATL
FT                   RETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESAFCLSLENIATLQKLL
FT                   KQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDR
FT                   LEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVR
FT                   LRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTL
FT                   PKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQT
FT                   EAEMLYGSTPRTPSKRPGQTPKKSGKMNTTTMSSATPNSSIRPVFGGSVYRSPMSRLPP
FT                   SGSKSVVTSLCSGKKTPRAAQLRANKENLDLNGSILSGGYPGSTPLQHNCSIKSVASTY
FT                   SEFSDPSLSDSSTVGLQRELSKASRSDATSRILNSTNIQS"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719475,
FT                   17720518..17720628,17721338..17721437,17723427..17723455)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185136.0
FT                   protein_id=mCP106395.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UY19"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="MGI:MGI:1858961"
FT                   /db_xref="UniProtKB/TrEMBL:G3UY19"
FT                   /protein_id="EDL07013.1"
FT                   /translation="MRRSEVLADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKK
FT                   HIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLR
FT                   TQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDVDSTSVPTLEELKLFRQRVATL
FT                   RETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESAFCLSLENIATLQKLL
FT                   KQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDR
FT                   LEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVR
FT                   LRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTL
FT                   PKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQT
FT                   EAEMLYGSTPRTPSKRPGQTPKKSGKVRKMNTTTMSSATPNSSIRPVFGGSVYRSPMSR
FT                   LPPSGSKSVVTSLCSGKKTPRAAQLRANKENLDLNGSILSARTFKGFQI"
FT   CDS             join(17702975..17702985,17708694..17708826,
FT                   17709310..17709432,17712645..17712878,17712965..17713135,
FT                   17714202..17714351,17714663..17714810,17715846..17715982,
FT                   17717680..17717775,17719036..17719182,17719365..17719505)
FT                   /codon_start=1
FT                   /gene="Prc1"
FT                   /locus_tag="mCG_19465"
FT                   /product="protein regulator of cytokinesis 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19465.2 transcript_id=mCT185137.0
FT                   protein_id=mCP106394.0 isoform=CRA_c"
FT                   /protein_id="EDL07014.1"
FT                   /translation="MRRSEVLADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKK
FT                   HIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLR
FT                   TQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDVDSTSVPTLEELKLFRQRVATL
FT                   RETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESAFCLSLENIATLQKLL
FT                   KQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDR
FT                   LEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVR
FT                   LRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTL
FT                   PKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQT
FT                   EAEMLYGSTPRTPSKRPGQTPKKSGKVRKVNLSSCCCC"
FT   gene            17706125..17708009
FT                   /locus_tag="mCG_147197"
FT                   /note="gene_id=mCG147197.0"
FT   mRNA            join(17706125..17706663,17707360..17708009)
FT                   /locus_tag="mCG_147197"
FT                   /product="mCG147197"
FT                   /note="gene_id=mCG147197.0 transcript_id=mCT187460.0
FT                   created on 13-JAN-2004"
FT   CDS             17706206..17706304
FT                   /codon_start=1
FT                   /locus_tag="mCG_147197"
FT                   /product="mCG147197"
FT                   /note="gene_id=mCG147197.0 transcript_id=mCT187460.0
FT                   protein_id=mCP109603.0"
FT                   /protein_id="EDL07017.1"
FT                   /translation="MYVNVWFSHQQRSEVLHSMAVTDGCDDIGAAN"
FT   mRNA            complement(join(17723599..17723800,17726157..>17726216))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT175833"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT175833.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(17723606..>17723725)
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT175833.0
FT                   protein_id=mCP98755.0 isoform=CRA_b"
FT                   /protein_id="EDL07007.1"
FT                   /translation="PLRSLLNQKQVFVTSVRPGQLPSVLLMSELGAVNRTCPR"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728045..17728137,
FT                   17728226..17728622,17728786..17729105,17729201..17729267,
FT                   17732934..>17733610))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180396"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180396.0
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728226..17728622,
FT                   17728786..17729267,17731675..17732080))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT132373"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT132373.1
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(17724822..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..17727189,17728045..17729105,
FT                   17729201..17729267,17731675..>17732055))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180399"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180399.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(17725046..17725197,17725600..17725629,
FT                   17726707..17726874,17727094..>17727265))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180397.0
FT                   protein_id=mCP103321.0 isoform=CRA_c"
FT                   /protein_id="EDL07008.1"
FT                   /translation="WGCLEEVGWVKGSHSVLHGFSWSLAETGDIYIWGWNESGQLALPT
FT                   RSGTENKAEREEATELNEDGLKEELAVADAGAPAHFIAIQPFPALLDLPLGSDAVMASC
FT                   GSRHTAVVTRTGELYTWGWGKYGQLGHKDSTSLDRPCCVEYFVERQLEVRAVTCGPWNT
FT                   YVYAMERDKS"
FT   CDS             complement(join(17727156..17727189,17728226..17728392))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT132373.1
FT                   protein_id=mCP88795.1 isoform=CRA_a"
FT                   /protein_id="EDL07006.1"
FT                   /translation="MGTLPLLPCARAYVTPEPPFCQPLAPELRVRQLELGAEHVLLLCA
FT                   AGQVFSWGAGRNGGYLYMGLE"
FT   gap             17727724..17728038
FT                   /estimated_length=315
FT   mRNA            complement(join(17728046..17728137,17728226..17729105,
FT                   17729201..17729267,17732934..>17733640))
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, transcript variant
FT                   mCT180398"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180398.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(17728053..17728137,17728226..17728622,
FT                   17728786..>17729056))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_f"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180396.0
FT                   protein_id=mCP103319.0 isoform=CRA_f"
FT                   /protein_id="EDL07011.1"
FT                   /translation="GVLFARVSLVCNLNLASLNPHHSQVSTHRGLNLDMAEKRHGAWFG
FT                   FGFCGFGQALGSGNSHHSVYSPEPLHASDDICQVSAGWSYTALVTRGGRVELSGSVSGA
FT                   ADGCRDVWASEELLVLLRNKGGSSTEVQAWVPGSALQGEPLWVQNLVSGAKGQGEDEPS
FT                   RESRMGTLPLLPCARAYVTPEPPFCQPLAPELRVRQLELGAEHVLLLCAAGQVFSWGAG
FT                   RHGQLGHGTLGGRTRAKTVGGTAGPADG"
FT   CDS             complement(join(17728053..17728137,17728226..>17728788))
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_d"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180398.0
FT                   protein_id=mCP103318.0 isoform=CRA_d"
FT                   /protein_id="EDL07009.1"
FT                   /translation="PVSALTIPTPDLYHVYLPNPPNMPVQKYPTPVHPYSGSLELPRSM
FT                   ACVPPNSAHTGGGRVELSGSVSGAADGCRDVWASEELLVLLRNKGGSSTEVQAWVPGSA
FT                   LQGEPLWVQNLVSGAKGQGEDEPSRESRMGTLPLLPCARAYVTPEPPFCQPLAPELRVR
FT                   QLELGAEHVLLLCAAGQVFSWGAGRHGQLGHGTLGGRTRAKTVGGTAGPADG"
FT   CDS             complement(17728222..>17728788)
FT                   /codon_start=1
FT                   /gene="Rccd1"
FT                   /locus_tag="mCG_131045"
FT                   /product="RCC1 domain containing 1, isoform CRA_e"
FT                   /note="gene_id=mCG131045.1 transcript_id=mCT180399.0
FT                   protein_id=mCP103320.0 isoform=CRA_e"
FT                   /protein_id="EDL07010.1"
FT                   /translation="PVSALTIPTPDLYHVYLPNPPNMPVQKYPTPVHPYSGSLELPRSM
FT                   ACVPPNSAHTGGGRVELSGSVSGAADGCRDVWASEELLVLLRNKGGSSTEVQAWVPGSA
FT                   LQGEPLWVQNLVSGAKGQGEDEPSRESRMGTLPLLPCARAYVTPEPPFCQPLAPELRVR
FT                   QLELGAEHVLLLCAAGQVFSWGAGR"
FT   gap             17732126..17732145
FT                   /estimated_length=20
FT   gene            complement(17734476..17749189)
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /note="gene_id=mCG19459.1"
FT   mRNA            complement(join(17734476..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738343,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749189))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT20082"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT20082.1 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(17734476..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738312,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749171))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT185135"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT185135.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(<17734479..17734638,17738776..17738828,
FT                   17739529..17739623,17740744..>17740954))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172347"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172347.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(<17734479..17734638,17738776..17738828,
FT                   17739529..17739623,17740744..>17740953))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172347.0
FT                   protein_id=mCP95267.0 isoform=CRA_b"
FT                   /protein_id="EDL07002.1"
FT                   /translation="RALELSGVMESVIALCASEREEEQLVAVEALIHAAGKAKRASFIT
FT                   ANGVSLLKDLYKGSERDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWL
FT                   CNDQIDAGTRRWAVEGPCLYCRELRLGDVHPIQACGLWASRRKDTTASSHAGSIIRACQ
FT                   QAHPANKFCG"
FT   mRNA            complement(join(17734506..17734669,17746113..17746165,
FT                   17748037..17748212,17748510..>17748547))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172346"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172346.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(17734612..17734669,17746113..17746165,
FT                   17748037..17748212,17748510..>17748546))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172346.0
FT                   protein_id=mCP95265.0 isoform=CRA_a"
FT                   /protein_id="EDL07001.1"
FT                   /translation="EDYSKAESEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLK
FT                   RCVSLEPKNKVFQESLRNIGGQIQEKVRYMSSTDAKVEQMFQILIQPCPASTQEGPVCT
FT                   VES"
FT   CDS             complement(join(17734800..17735057,17735195..17735350,
FT                   17735491..17735608,17736765..17736880,17737099..17737212,
FT                   17737632..17737698,17737872..17737999,17738203..17738343,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749119))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_e"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT20082.1
FT                   protein_id=mCP7246.1 isoform=CRA_e"
FT                   /protein_id="EDL07005.1"
FT                   /translation="MTVSGPETPEPRPSDPGASSAEQLRKEGNELFKCGDYEGALTAYT
FT                   QALSLGATPQDQAILHRNRAACHLKLEDYSKAESEASKAIEKDGGDVKALYRRSQALEK
FT                   LGRLDQAVLDLKRCVSLEPKNKVFQESLRNIGGQIQEKVRYMSSTDAKVEQMFQILLDP
FT                   KEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLLQRLLDTEETDLMLAALRTLVGI
FT                   CSEHQSRTVATLSVLGTRRVVSILGVENQAVSLAACHLLQVIFDALKEGVKKGFRGKEG
FT                   AIIVDPARELKVLINSLLELLTEVGVSGQGRDNALTLLIKMVPRKSPKDPNNSLTLWVI
FT                   DQGLKKILEVGGSLQDAAGELTVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYI
FT                   RSWFEGHGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEREEEQLVAV
FT                   EALIHAAGKAKRASFITANGVSLLKDLYKGSERDSIRIRALVGLCKLGSAGGTDFSMKQ
FT                   FAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLTFDADVKEEFVEDEAALKALFQ
FT                   LSRSEERSVLFAVGSALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRAR
FT                   VKKLLAAGVVSAMTCMVKTESPVLTNSCRELLSRVFLALVEEVEDRGTVVAQGGGKALL
FT                   PLALEGTDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVRPLVSLLHLSCSGLQNFEA
FT                   LMALTNLAGISERLRQKILKEKAVPMIEGYMFEEHEMIRRAATECMCNLAMSKEVQDLF
FT                   EAQGNDRLKLLVLYSGEDDELLRRAAAGGLAMLTSMRPTLCSRIPQVTTHWLEILQALL
FT                   LSPNQELQHRGTVVVLNMMQSSKEIAGTLMESEVLEILSVLAKGEESPVTRAAAACLEK
FT                   AVEYRLIQPNQDGE"
FT   CDS             complement(join(17737969..17737999,17738203..17738312,
FT                   17738687..17738828,17739529..17739623,17740744..17741044,
FT                   17742126..17742297,17743169..17743339,17743843..17744011,
FT                   17745454..17745621,17746073..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..17748908,17749069..17749119))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_d"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT185135.0
FT                   protein_id=mCP106393.0 isoform=CRA_d"
FT                   /protein_id="EDL07004.1"
FT                   /translation="MTVSGPETPEPRPSDPGASSAEQLRKEGNELFKCGDYEGALTAYT
FT                   QALSLGATPQDQAILHRNRAACHLKLEDYSKAESEASKAIEKDGGDVKALYRRSQALEK
FT                   LGRLDQAVLDLKRCVSLEPKNKVFQESLRNIGGQIQEKVRYMSSTDAKVEQMFQILLDP
FT                   KEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLLQRLLDTEETDLMLAALRTLVGI
FT                   CSEHQSRTVATLSVLGTRRVVSILGVENQAVSLAACHLLQVIFDALKEGVKKGFRGKEG
FT                   AIIVDPARELKVLINSLLELLTEVGVSGQGRDNALTLLIKMVPRKSPKDPNNSLTLWVI
FT                   DQGLKKILEVGGSLQDAAGELTVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYI
FT                   RSWFEGHGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEREEEQLVAV
FT                   EALIHAAGKAKRASFITANGVSLLKDLYKGSERDSIRIRALVGLCKLGSAGGTDFSMKQ
FT                   FAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLTFDADVKEEFVEDEAALKALFQ
FT                   LSRARHWSIAPTATTMRSLTPRWWSWPSMPSSTFQNSTPRTNQASCGLV"
FT   mRNA            complement(join(<17746133..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..>17748999))
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), transcript variant
FT                   mCT172348"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172348.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(<17746133..17746165,17748037..17748212,
FT                   17748510..17748546,17748747..>17748998))
FT                   /codon_start=1
FT                   /gene="Unc45a"
FT                   /locus_tag="mCG_19459"
FT                   /product="unc-45 homolog A (C. elegans), isoform CRA_c"
FT                   /note="gene_id=mCG19459.1 transcript_id=mCT172348.0
FT                   protein_id=mCP95266.0 isoform=CRA_c"
FT                   /protein_id="EDL07003.1"
FT                   /translation="ILALHGTRPRPGSSPRRAALPNAFLSLSLQASSAEQLRKEGNELF
FT                   KCGDYEGALTAYTQALSLGATPQDQAILHRNRAACHLKLEDYSKAESEASKAIEKDGGD
FT                   VKALYRRSQALEKLGRLDQAVLDLKRCVSLEPKNKVFQESLRNIGGQIQEKVRYMSSTD
FT                   AKV"
FT   gap             17746591..17746754
FT                   /estimated_length=164
FT   gene            17752135..17754336
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /note="gene_id=mCG19441.3"
FT   mRNA            join(17752135..17752265,17752555..17752610,
FT                   17752695..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT185199"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT185199.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(17752135..17752265,17752555..17752610,
FT                   17752732..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT19836"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT19836.3 created
FT                   on 12-JUN-2003"
FT   mRNA            join(17752143..17752471,17752555..17752610,
FT                   17752732..17752972,17753280..17754336)
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, transcript variant
FT                   mCT175834"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT175834.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(17752154..17752265,17752555..17752610,
FT                   17752732..17752972,17753280..17753410)
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT19836.3
FT                   protein_id=mCP7256.2 isoform=CRA_c"
FT                   /protein_id="EDL07000.1"
FT                   /translation="MGSEAAQLLEAADFAAHKHRQQRRKDPEGTPYINHPIGVARILTH
FT                   EAGITDIVVLQAALLHDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRQQ
FT                   VEQAPHSSPGAKLVKLADKLYNLRDLNRCTPTGWSEHRVQEYFEWAAQVVKGLQGTNQQ
FT                   LEEALKQLFEERGLTL"
FT   CDS             join(17752154..17752265,17752555..17752610,
FT                   17752695..17752748)
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT185199.0
FT                   protein_id=mCP106457.0 isoform=CRA_b"
FT                   /protein_id="EDL06999.1"
FT                   /translation="MGSEAAQLLEAADFAAHKHRQQRRKDPEGTPYINHPIGVARILTH
FT                   EAGITDIVVLQVSVTGLNGNLSPGRPAP"
FT   CDS             17752154..17752429
FT                   /codon_start=1
FT                   /gene="Hddc3"
FT                   /locus_tag="mCG_19441"
FT                   /product="HD domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG19441.3 transcript_id=mCT175834.1
FT                   protein_id=mCP98756.0 isoform=CRA_a"
FT                   /protein_id="EDL06998.1"
FT                   /translation="MGSEAAQLLEAADFAAHKHRQQRRKDPEGTPYINHPIGGRASWEA
FT                   ALAARGGWGLTGTGTQSAYKLLSAFFESQALYQPLFMRYACKPHLG"
FT   gap             17755236..17756178
FT                   /estimated_length=943
FT   gene            complement(17756492..17778661)
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /note="gene_id=mCG19442.2"
FT   mRNA            complement(join(17756492..17757032,17761742..>17761865))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT175212"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175212.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(17756627..>17756806)
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_b"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175212.0
FT                   protein_id=mCP98130.0 isoform=CRA_b"
FT                   /protein_id="EDL06996.1"
FT                   /translation="VCSEFCHCWRKVCFDFSENVTRVCPAAPKDSVVTRLSSCRVSMVY
FT                   VARLRPHGFLFMSW"
FT   mRNA            complement(join(17758697..17759252,17760325..17760432,
FT                   17760561..17760761,17763750..17763886,17765651..17765792,
FT                   17766318..17766451,17766688..17766802,17767044..17767166,
FT                   17768353..17768589,17769756..17769921,17770066..17770133,
FT                   17770346..17770460,17770611..17770793,17770924..17771126,
FT                   17771385..17771562,17774320..17774506,17774762..17774935,
FT                   17775148..17775275,17775665..17775836,17775957..17776101,
FT                   17776171..17776428,17777064..17777216,17778208..17778405,
FT                   17778578..17778661))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT19841"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT19841.2 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(17759100..17759252,17760325..17760432,
FT                   17760561..17760761,17763750..17763886,17765651..17765792,
FT                   17766318..17766451,17766688..17766802,17767044..17767166,
FT                   17768353..17768589,17769756..17769921,17770066..17770133,
FT                   17770346..17770460,17770611..17770793,17770924..17771126,
FT                   17771385..17771562,17774320..17774506,17774762..17774935,
FT                   17775148..17775275,17775665..17775836,17775957..17776101,
FT                   17776171..17776428,17777064..17777195))
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_c"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT19841.2
FT                   protein_id=mCP7225.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q197W7"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="MGI:MGI:2150656"
FT                   /db_xref="UniProtKB/TrEMBL:Q197W7"
FT                   /protein_id="EDL06997.1"
FT                   /translation="MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQNGGNFPRS
FT                   QISVLQNRIEQLEQLLEENHDIISRIKDSVLELTANAEGPPALLPYHTANGSWAVLPEP
FT                   RPSFFSVSPQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDT
FT                   EDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKW
FT                   WDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGAT
FT                   PRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDS
FT                   STDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADR
FT                   AALLLDQYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQ
FT                   AQFGTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSL
FT                   DRVLEAHLRGAEILYSLALAHARRSGLAGQYPLSDFALLTEARRTLGLFQHHDAITGTA
FT                   KEAVVVDYGVRLLRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDAL
FT                   PERTVIRLDSSPRFVVVFNPLEQERLSVVSLLVNSPRVRVLSEEGQPLSVQISVHWSSA
FT                   TDMVPDVYQVSVPVRLPGLGLGVLQLQPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPV
FT                   RVVDSGASDFAISNRYMQVWFSGLTGLLKSIRRVDEEQEQQMELEFLVYGTRTSKDKSG
FT                   AYLFLPDSEAKPYVPKKPPVLRVTEGPFFSEVAVYYEHFHQVIRLYNLPGVEGLSLDMS
FT                   FQVDIRDYVNKELALRIHTDIDSQGTFFTDLNGFQIQPRQYLKKLPLQANFYPMPVMAY
FT                   IQDSQRRLTLHTAQALGVSSLGNGQLEVILDRRLMQDDNRGLGQGLKDNKITCNRFRLL
FT                   LERRTTMSPEVHQEQERSTSYPSLLSHLTSMYLSTPPLVLPVAKRQGTSPALRSFHPLA
FT                   SPLPCDFHLLNLRMLPAEDTLPATDSALILHRKGFDCGLEAKNLGFNCTTSQGKLALGS
FT                   LFHGLDVTFLQPTSLTLLYPLASPSNSTDISLEPMEISTFRLRLG"
FT   mRNA            complement(join(<17760565..17760761,17763396..17763470,
FT                   17763750..17763886,17765651..17765792,17766318..17766451,
FT                   17766688..17766802,17767044..>17767153))
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, transcript variant
FT                   mCT175211"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175211.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(<17760565..17760761,17763396..17763470,
FT                   17763750..17763886,17765651..17765792,17766318..17766451,
FT                   17766688..17766802,17767044..>17767151))
FT                   /codon_start=1
FT                   /gene="Man2a2"
FT                   /locus_tag="mCG_19442"
FT                   /product="mannosidase 2, alpha 2, isoform CRA_a"
FT                   /note="gene_id=mCG19442.2 transcript_id=mCT175211.0
FT                   protein_id=mCP98131.0 isoform=CRA_a"
FT                   /protein_id="EDL06995.1"
FT                   /translation="DEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPV
FT                   LRVTEGPFFSEVAVYYEHFHQVIRLYNLPGVEGLSLDMSFQVDIRDYVNKELALRIHTD
FT                   IDSQGTFFTDLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSS
FT                   LGNGQLEVILDRRLMQDDNRGLGQGLKDNKITCNRFRLLLERRTTMSPEPGFFSKLADM
FT                   FRDLIFSSNTIRSSKVHQEQERSTSYPSLLSHLTSMYLSTPPLVLPVAKRQGTSPALRS
FT                   FHPLASPLPCDFHLLNLRMLPA"
FT   gap             17767403..17767542
FT                   /estimated_length=140
FT   gene            complement(17785270..17795471)
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /note="gene_id=mCG19444.1"
FT   mRNA            complement(join(17785270..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789909,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794857,17795348..17795471))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT19842"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT19842.1 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785270..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787217,17787331..17787425,
FT                   17787722..17788405,17788678..17788800,17789114..17789323,
FT                   17789826..17789909,17790034..17790220,17790324..17790702,
FT                   17790782..17790919,17791347..17791530,17791704..17791800,
FT                   17794326..17794499,17794636..17794857,17795348..17795448))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174597"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174597.0 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785278..17785542,17786156..17786178,
FT                   17786292..17786449,17787124..>17787143))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174596"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174596.0 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(17785287..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789903,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..>17794906))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT189930"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT189930.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(17785304..17785542,17786156..>17786156))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_f"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174596.0
FT                   protein_id=mCP97516.0 isoform=CRA_f"
FT                   /protein_id="EDL06994.1"
FT                   /translation="CSWSSAGPMSLGRDLVSASSARSSTVSASGIGETRRQECTSSAVP
FT                   THCWTAPRPGFQPPATGLRAGCDSPSFFLPKFLS"
FT   CDS             complement(join(17785446..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789903,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..>17794875))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_d"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT189930.0
FT                   protein_id=mCP110919.0 isoform=CRA_d"
FT                   /protein_id="EDL06992.1"
FT                   /translation="PGFCPQDTIMGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQ
FT                   RVKSDREYAGLLHHMSLQDSGGQSWSSGPDSPVSQSWAEITSQTENLSRVLRQHAEDLN
FT                   SGPLSKLSVLIRERQHLRKTYNEQWQQLQQELTKTHSQDIEKLKTQYRTLVRDSTQARR
FT                   KYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHHHHHRFMLPGLLQSLQ
FT                   DLHEEMAGILKDILQEYLEISSLVQDDVASIHRELAAAAARIQPEFEYLGFLRQYGSTP
FT                   DVPPCVTFDESLLEDGEQLEPGELQLNELTLESVQHTLTSVTDELAVATKEVLSRQEMV
FT                   SQLQRELQSEEQNTHPRERVQLLSKRQMLQEAIQGLQIALCSQDKLQAQQELLQSKMEQ
FT                   LGTGEPPAVPLLQDDRHSTSSTEREGGRTPTLEILKSHFSGIFRPKFSIPPPLQLVPEV
FT                   QKPLYEQLWYHGAIPRAEVAELLTHSGDFLVRESQGKQEYVLSVMWDGQPRHFIIQSSD
FT                   NLYRLEGDGFPSIPLLITHLLSSQQPLTKKSGVVLFRAVPKDKWVLKHEDLVLGEQIGR
FT                   GNFGEVFSGRLRADNTPVAVKSCRETLPPDLKAKFLQEARILKQYNHPNIVRLIGVCTQ
FT                   KQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAAR
FT                   NCLVTEKNVLKISDFGMSREEADGIYAASAGLRQVPVKWTAPEALNYGRYSSESDVWSF
FT                   GILLWETFSLGASPYPNLTNQQTREFVEKGHRLPCPELCPDAVFRLMEQCWAYEPGQRP
FT                   SFSIICQELHSIRKRHR"
FT   CDS             complement(join(17785446..17785588,17786056..17786178,
FT                   17786292..17786449,17787124..17787247,17787331..17787425,
FT                   17787722..17787840,17788352..17788405,17788678..17788800,
FT                   17789114..17789323,17789826..17789909,17790034..17790220,
FT                   17790324..17790446,17790583..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794848))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_e"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT19842.1
FT                   protein_id=mCP7259.1 isoform=CRA_e"
FT                   /protein_id="EDL06993.1"
FT                   /translation="MGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYA
FT                   GLLHHMSLQDSGGQSWSSGPDSPVSQSWAEITSQTENLSRVLRQHAEDLNSGPLSKLSV
FT                   LIRERQHLRKTYNEQWQQLQQELTKTHSQDIEKLKTQYRTLVRDSTQARRKYQEASKDK
FT                   DRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHHHHHRFMLPGLLQSLQDLHEEMAGI
FT                   LKDILQEYLEISSLVQDDVASIHRELAAAAARIQPEFEYLGFLRQYGSTPDVPPCVTFD
FT                   ESLLEDGEQLEPGELQLNELTLESVQHTLTSVTDELAVATKEVLSRQEMVSQLQRELQS
FT                   EEQNTHPRERVQLLSKRQMLQEAIQGLQIALCSQDKLQAQQELLQSKMEQLGTGEPPAV
FT                   PLLQDDRHSTSSTEQEREGGRTPTLEILKSHFSGIFRPKFSIPPPLQLVPEVQKPLYEQ
FT                   LWYHGAIPRAEVAELLTHSGDFLVRESQGKQEYVLSVMWDGQPRHFIIQSSDNLYRLEG
FT                   DGFPSIPLLITHLLSSQQPLTKKSGVVLFRAVPKDKWVLKHEDLVLGEQIGRGNFGEVF
FT                   SGRLRADNTPVAVKSCRETLPPDLKAKFLQEARILKQYNHPNIVRLIGVCTQKQPIYIV
FT                   MELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEK
FT                   NVLKISDFGMSREEADGIYAASAGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWET
FT                   FSLGASPYPNLTNQQTREFVEKGHRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSIICQ
FT                   ELHSIRKRHR"
FT   mRNA            complement(join(<17786332..17786449,17787124..17787247,
FT                   17787331..>17787948))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174599"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174599.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(<17786332..17786449,17787124..17787247,
FT                   17787331..>17787442))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_c"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174599.0
FT                   protein_id=mCP97518.0 isoform=CRA_c"
FT                   /protein_id="EDL06991.1"
FT                   /translation="AAVLPRILKQYNHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFL
FT                   RTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSRE
FT                   EADGIYAASAGLRQ"
FT   mRNA            complement(join(<17789281..17789323,17789826..17789909,
FT                   17790034..17790220,17790324..17790446,17790583..17790702,
FT                   17790782..17790836,17794357..>17794491))
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, transcript variant
FT                   mCT174598"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174598.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(<17789281..17789323,17789826..17789909,
FT                   17790034..17790220,17790324..17790446,17790583..17790702,
FT                   17790782..17790836,17794357..>17794375))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_b"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174598.0
FT                   protein_id=mCP97517.0 isoform=CRA_b"
FT                   /protein_id="EDL06990.1"
FT                   /translation="ERRTTSTAARIQPEFEYLGFLRQYGSTPDVPPCVTFDESLLEDGE
FT                   QLEPGELQLNELTLESVQHTLTSVTDELAVATKEVLSRQEMVSQLQRELQSEEQNTHPR
FT                   ERVQLLSKRQMLQEAIQGLQIALCSQDKLQAQQELLQSKMEQLGTGEPPAVPLLQDDRH
FT                   STSSTEQEREGGRTPTLEILKSHFSGIFRPKFSIPPPLQLVPEVQKP"
FT   CDS             complement(join(17790426..17790702,17790782..17790919,
FT                   17791347..17791530,17791704..17791800,17794326..17794499,
FT                   17794636..17794848))
FT                   /codon_start=1
FT                   /gene="Fes"
FT                   /locus_tag="mCG_19444"
FT                   /product="feline sarcoma oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG19444.1 transcript_id=mCT174597.0
FT                   protein_id=mCP97515.0 isoform=CRA_a"
FT                   /protein_id="EDL06989.1"
FT                   /translation="MGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYA
FT                   GLLHHMSLQDSGGQSWSSGPDSPVSQSWAEITSQTENLSRVLRQHAEDLNSGPLSKLSV
FT                   LIRERQHLRKTYNEQWQQLQQELTKTHSQDIEKLKTQYRTLVRDSTQARRKYQEASKDK
FT                   DRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHHHHHRFMLPGLLQSLQDLHEEMAGI
FT                   LKDILQEYLEISSLVQDDVASIHRELAAAAARIQPEFEYLGFLRQYGSTPDVPPCVTFD
FT                   ESLLEDGEQLEPGELQLNELTLESVQHTCVLLCHATHVWVWAGSPWPGGQARLALLGCM
FT                   WWGPSFHSPALGVQADFCDR"
FT   gene            complement(17796719..17806455)
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /note="gene_id=mCG19445.1"
FT   mRNA            complement(join(17796719..17798817,17799029..17799139,
FT                   17799249..17799373,17799708..17799887,17799991..17800108,
FT                   17800195..17800298,17800405..17800505,17800930..17801142,
FT                   17802856..17803028,17803481..17803569,17804450..17804526,
FT                   17804643..17804771,17805417..17805512,17805614..17805712,
FT                   17806113..17806455))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT19838"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT19838.1 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(17796719..17796865,17797681..>17797720))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172340"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172340.0 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(17796720..17796887,17803494..17803569,
FT                   17804450..17804526,17804643..17804771,17805417..>17805435))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT173475"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT173475.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(17796777..17796887,17803494..17803569,
FT                   17804450..17804526,17804643..17804771,17805417..>17805434))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT173475.0
FT                   protein_id=mCP96394.0 isoform=CRA_d"
FT                   /protein_id="EDL06987.1"
FT                   /translation="PQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDL
FT                   AGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNPTPH
FT                   GHPGWFCKMLGWCTVIFFFPCNLNRPGIVGSI"
FT   CDS             complement(join(17796777..17796865,17797681..>17797720))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172340.0
FT                   protein_id=mCP95258.0 isoform=CRA_c"
FT                   /protein_id="EDL06986.1"
FT                   /translation="ACTFLLSACLCTPGWFCKMLGWCTVIFFFPCNLNRPGIVGSI"
FT   mRNA            complement(join(<17796869..17796907,17798239..17798618,
FT                   17802958..>17802989))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172339"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172339.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(<17796869..17796907,17798239..17798618,
FT                   17802958..>17802968))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172339.0
FT                   protein_id=mCP95259.0 isoform=CRA_b"
FT                   /protein_id="EDL06985.1"
FT                   /translation="IPTTHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQ
FT                   AGLASHLPEVLAGLSCLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDRGLISYKGLPPE
FT                   AWQEECPSDSEEDEGRGERTAFIKDQRVPLALLPTPHGH"
FT   CDS             complement(join(17798228..17798817,17799029..17799139,
FT                   17799249..17799373,17799708..17799887,17799991..17800108,
FT                   17800195..17800298,17800405..17800505,17800930..17801142,
FT                   17802856..17803028,17803481..17803569,17804450..17804526,
FT                   17804643..17804771,17805417..17805512,17805614..17805712,
FT                   17806113..17806289))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT19838.1
FT                   protein_id=mCP7258.1 isoform=CRA_e"
FT                   /db_xref="GOA:P23188"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="MGI:MGI:97513"
FT                   /db_xref="PDB:1P8J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23188"
FT                   /protein_id="EDL06988.1"
FT                   /translation="MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVA
FT                   DRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRR
FT                   AKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDL
FT                   AGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIG
FT                   GVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQG
FT                   RGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATT
FT                   YSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQ
FT                   TSKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEP
FT                   KDIGKRLEVRKAVTACLGEPNHITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLA
FT                   ARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPE
FT                   GLSTPPESSGCKTLTSSQACVVCEEGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEI
FT                   IRASVCTPCHASCATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESRPQQQPPAL
FT                   RPEVEMEPRLQAGLASHLPEVLAGLSCLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDR
FT                   GLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL"
FT   mRNA            complement(join(<17800262..17800298,17800405..17800505,
FT                   17800930..17800957,17805413..>17805447))
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   transcript variant mCT172338"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172338.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(<17800262..17800298,17800405..17800505,
FT                   17800930..17800957,17805413..>17805447))
FT                   /codon_start=1
FT                   /gene="Furin"
FT                   /locus_tag="mCG_19445"
FT                   /product="furin (paired basic amino acid cleaving enzyme),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19445.1 transcript_id=mCT172338.0
FT                   protein_id=mCP95257.0 isoform=CRA_a"
FT                   /protein_id="EDL06984.1"
FT                   /translation="GPQVPPAVVPGISGNQNEKQIVTTDLRQKCTESHTGTSASAPLAA
FT                   GIIALTLEANKNLTWRDMQHLV"
FT   gap             17809725..17810292
FT                   /estimated_length=568
FT   gene            17836654..17838365
FT                   /pseudo
FT                   /locus_tag="mCG_19464"
FT                   /note="gene_id=mCG19464.2"
FT   mRNA            join(17836654..17837855,17837945..17838365)
FT                   /pseudo
FT                   /locus_tag="mCG_19464"
FT                   /note="gene_id=mCG19464.2 transcript_id=mCT20085.2 created
FT                   on 30-OCT-2002"
FT   gap             17844640..17845253
FT                   /estimated_length=614
FT   gap             17845535..17845809
FT                   /estimated_length=275
FT   gap             17856140..17857069
FT                   /estimated_length=930
FT   gene            complement(17862503..17943277)
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /note="gene_id=mCG19443.2"
FT   mRNA            complement(join(17862503..17862648,17862881..17863443,
FT                   17866819..17867002,17868736..17868858,17871776..17871968,
FT                   17872741..17872940,17874778..17874916,17877562..17877752,
FT                   17881990..17882185,17888373..17888533,17889442..17889548,
FT                   17902081..17902229,17902412..17902510,17903969..17904082,
FT                   17905383..17905501,17907731..17907922,17910261..17910931,
FT                   17911218..17911350,17913831..17913958,17917414..17917573,
FT                   17920790..17921508,17922605..17922706,17943223..17943277))
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), transcript
FT                   variant mCT19837"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT19837.2 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(17863099..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922706,17942831..17943168))
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), transcript
FT                   variant mCT173474"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT173474.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(17863266..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922706,17942831..17942835))
FT                   /codon_start=1
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT173474.0
FT                   protein_id=mCP96393.0 isoform=CRA_a"
FT                   /protein_id="EDL06982.1"
FT                   /translation="MRIMAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTS
FT                   EGDVSVTSVSVVKTPALSDKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKG
FT                   TCSEPSLPATVQTAQDTLCTTPKTPTAKKPPVAVFKKLEFSSSADSLSDWADMDDFDMS
FT                   ASDAFASLAKNPATRVSTAQKMKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKE
FT                   SEEEEEEEEEEAEGADCLSRDVICIDNDSASEELTEKDTQESQSLKAHLGAERGDSEKK
FT                   SHEDEAVFHSVQNTEYFEHNDNDYDIDFVPPSPEEIISTASSSLKCSSMLKDLDDSDKE
FT                   KGILSTSEELLSKPEEMTTHKSDAGTSKDCDAQQIRIQQQLIHVMEHICKLVDTVPTDE
FT                   LEALNCGTELLQQRNIRRKLLAEAGFNGNDVRLLGSLWRHRPDSLDNTVQGDSCPVGHP
FT                   NKELNSPYLLSHSPSTEECLPTTTPGKTGFSATPKNLFERPLLNSHLQKSFVSSNWAET
FT                   PRMENRNESTDFPGSVLTSTTVKAQSKQAASGWNVERHGQASYDIDNFNIDDFDDDDDD
FT                   DDWENIMHNFPASKSSTATYPPIKEGGPVKSLSERISSAKAKFLPVVSTAQNTNLSESI
FT                   QNCSDKLAQNLSSKNPKHEHFQSLNFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLG
FT                   EDCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPATYLTGDK
FT                   TDSEAANIYLQLSKKDPIIKLLYVTPEKVCASNRLISTLENLYERKLLARFVIDEAHCV
FT                   SQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNR
FT                   HNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQREGLAALAY
FT                   HAGLSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRFVIHASLPKSMEGYYQES
FT                   GRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNYHTKETHVNNLYSMVHYCENITEC
FT                   RRIQLLAYFGEKGFNPDFCKKYPDVSCDNCCKTKDYKTKDVTDDVKNIIRFVQEHSSSP
FT                   GTRNIGPAGRFTLNMLVDIFLGSKSAKVKSGIFGKGTTYSRHNAERLFKKLILDKILDE
FT                   DLYINANDQPIAYVMLGTKAHSVLSGHLKVDFMETENSSSIKKQKALVAKVSQREEVVK
FT                   KCLGELTEVCKLLGKVFGVHYFNIFNTATLKKLAESLSSDPEVLLQIDGVTEDKLEKYG
FT                   AEVIPVLQKYSEWTLPAEDGSPGARGAPEDTEEEEEEAPVSSHYFANQTRNERKRKKMS
FT                   ATHKPKRRRTSYGGFRAKGGSTTCRKTTSKSKFYGVTGSRSASCASQATSSASRKLGIM
FT                   APPKPVNRTFLRPSYAFS"
FT   CDS             complement(join(17863266..17863443,17866819..17867002,
FT                   17868736..17868858,17871776..17871968,17872741..17872940,
FT                   17874778..17874916,17877562..17877752,17881990..17882185,
FT                   17888373..17888533,17889442..17889548,17902081..17902229,
FT                   17902412..17902510,17903969..17904082,17905383..17905501,
FT                   17907731..17907922,17910261..17910931,17911218..17911350,
FT                   17913831..17913958,17917414..17917573,17920790..17921508,
FT                   17922605..17922702))
FT                   /codon_start=1
FT                   /gene="Blm"
FT                   /locus_tag="mCG_19443"
FT                   /product="Bloom syndrome homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG19443.2 transcript_id=mCT19837.2
FT                   protein_id=mCP7353.2 isoform=CRA_b"
FT                   /protein_id="EDL06983.1"
FT                   /translation="MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEGD
FT                   VSVTSVSVVKTPALSDKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKGTCS
FT                   EPSLPATVQTAQDTLCTTPKTPTAKKPPVAVFKKLEFSSSADSLSDWADMDDFDMSASD
FT                   AFASLAKNPATRVSTAQKMKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKESEE
FT                   EEEEEEEEAEGADCLSRDVICIDNDSASEELTEKDTQESQSLKAHLGAERGDSEKKSHE
FT                   DEAVFHSVQNTEYFEHNDNDYDIDFVPPSPEEIISTASSSLKCSSMLKDLDDSDKEKGI
FT                   LSTSEELLSKPEEMTTHKSDAGTSKDCDAQQIRIQQQLIHVMEHICKLVDTVPTDELEA
FT                   LNCGTELLQQRNIRRKLLAEAGFNGNDVRLLGSLWRHRPDSLDNTVQGDSCPVGHPNKE
FT                   LNSPYLLSHSPSTEECLPTTTPGKTGFSATPKNLFERPLLNSHLQKSFVSSNWAETPRM
FT                   ENRNESTDFPGSVLTSTTVKAQSKQAASGWNVERHGQASYDIDNFNIDDFDDDDDDDDW
FT                   ENIMHNFPASKSSTATYPPIKEGGPVKSLSERISSAKAKFLPVVSTAQNTNLSESIQNC
FT                   SDKLAQNLSSKNPKHEHFQSLNFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDC
FT                   FILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPATYLTGDKTDS
FT                   EAANIYLQLSKKDPIIKLLYVTPEKVCASNRLISTLENLYERKLLARFVIDEAHCVSQW
FT                   GHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNL
FT                   KYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQREGLAALAYHAG
FT                   LSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRFVIHASLPKSMEGYYQESGRA
FT                   GRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNYHTKETHVNNLYSMVHYCENITECRRI
FT                   QLLAYFGEKGFNPDFCKKYPDVSCDNCCKTKDYKTKDVTDDVKNIIRFVQEHSSSPGTR
FT                   NIGPAGRFTLNMLVDIFLGSKSAKVKSGIFGKGTTYSRHNAERLFKKLILDKILDEDLY
FT                   INANDQPIAYVMLGTKAHSVLSGHLKVDFMETENSSSIKKQKALVAKVSQREEVVKKCL
FT                   GELTEVCKLLGKVFGVHYFNIFNTATLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEV
FT                   IPVLQKYSEWTLPAEDGSPGARGAPEDTEEEEEEAPVSSHYFANQTRNERKRKKMSATH
FT                   KPKRRRTSYGGFRAKGGSTTCRKTTSKSKFYGVTGSRSASCASQATSSASRKLGIMAPP
FT                   KPVNRTFLRPSYAFS"
FT   gap             17886329..17886389
FT                   /estimated_length=61
FT   gap             17888175..17888194
FT                   /estimated_length=20
FT   gap             17940149..17940216
FT                   /estimated_length=68
FT   gap             17950399..17950418
FT                   /estimated_length=20
FT   gap             17955092..17955450
FT                   /estimated_length=359
FT   gap             17961733..17962457
FT                   /estimated_length=725
FT   gap             17967505..17967524
FT                   /estimated_length=20
FT   gap             17977272..17977291
FT                   /estimated_length=20
FT   gap             17991832..17991851
FT                   /estimated_length=20
FT   gene            complement(18000812..18090975)
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /note="gene_id=mCG60560.2"
FT   mRNA            complement(join(18000812..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041402..18041521,18090866..>18090974))
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   transcript variant mCT189940"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT189940.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(18000813..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041427..18041521,18090866..18090975))
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   transcript variant mCT60743"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT60743.2 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(18002349..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18029083,18031113..18031175,
FT                   18033031..18033092,18041402..18041521,18090866..>18090973))
FT                   /codon_start=1
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT189940.0
FT                   protein_id=mCP110928.0 isoform=CRA_a"
FT                   /protein_id="EDL06980.1"
FT                   /translation="CFQVQFQKLQQLRLTQYHGGSLPNVSQLRNSAPEFQPSLHQADNV
FT                   RGTRHHGLVERPARNRFHPLHRRSGDKPGRQFDGNAFAASYSSQHLDESWPRQQPPWKE
FT                   EKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENDGHAE
FT                   VAAFPGLLKEENLLNVPKPLPKHLWESKEIQSLSGRPRSCDVGGGNAFPHNGQNTGLSP
FT                   FLGTLNTGGSLPDLTNLHYSAPLPASLDTSDHLFGSMSVGNSVGNLPAAMTHLGIRTSS
FT                   GLQSSRSNPSIQATLSKMALSSSLKCHPQPSVANASALHPSLRLFSLSNPSLSTTNLSG
FT                   PSRRRQPPVSPLTLSPGPEAHQGFSRQLSATSPLNPYPASQMVTSEQSPLSFLPTDAQA
FT                   QVSPPPPYPTPQELPQPLLQQPHAQEPPTQQPQAAPSLPQSDFQLLTAQGSALTSFFPD
FT                   VRFDQQPMRPSPAFPQQVPLVQQSHREPQDSFHLRPNPYSSCGSFPGTILTEDTNSNLF
FT                   KGLSGGLSGMPEVSLDMDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRAD
FT                   RL"
FT   CDS             complement(join(18002349..18002557,18002968..18003070,
FT                   18005122..18005202,18005284..18005484,18008219..18008517,
FT                   18011315..18011532,18016928..18016977,18018325..18018410,
FT                   18022434..18022469,18028983..18028986))
FT                   /codon_start=1
FT                   /gene="Crtc3"
FT                   /locus_tag="mCG_60560"
FT                   /product="CREB regulated transcription coactivator 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG60560.2 transcript_id=mCT60743.2
FT                   protein_id=mCP29933.2 isoform=CRA_b"
FT                   /protein_id="EDL06981.1"
FT                   /translation="MGFCDGENDGHAEVAAFPGLLKEENLLNVPKPLPKHLWESKEIQS
FT                   LSGRPRSCDVGGGNAFPHNGQNTGLSPFLGTLNTGGSLPDLTNLHYSAPLPASLDTSDH
FT                   LFGSMSVGNSVGNLPAAMTHLGIRTSSGLQSSRSNPSIQATLSKMALSSSLKCHPQPSV
FT                   ANASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSATS
FT                   PLNPYPASQMVTSEQSPLSFLPTDAQAQVSPPPPYPTPQELPQPLLQQPHAQEPPTQQP
FT                   QAAPSLPQSDFQLLTAQGSALTSFFPDVRFDQQPMRPSPAFPQQVPLVQQSHREPQDSF
FT                   HLRPNPYSSCGSFPGTILTEDTNSNLFKGLSGGLSGMPEVSLDMDTPFPLEEELQIEPL
FT                   SLDGLNMLSDSSMGLLDPSVEETFRADRL"
FT   gap             18009586..18009605
FT                   /estimated_length=20
FT   gap             18018637..18018818
FT                   /estimated_length=182
FT   gap             18035021..18035040
FT                   /estimated_length=20
FT   gap             18059855..18059874
FT                   /estimated_length=20
FT   gene            complement(18086784..18360592)
FT                   /locus_tag="mCG_1050959"
FT                   /note="gene_id=mCG1050959.0"
FT   mRNA            complement(join(18086784..18089119,18099596..18099632,
FT                   18360465..18360592))
FT                   /locus_tag="mCG_1050959"
FT                   /product="mCG1050959"
FT                   /note="gene_id=mCG1050959.0 transcript_id=mCT194748.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(18088792..18088947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050959"
FT                   /product="mCG1050959"
FT                   /note="gene_id=mCG1050959.0 transcript_id=mCT194748.0
FT                   protein_id=mCP115777.0"
FT                   /protein_id="EDL06967.1"
FT                   /translation="MMVMGTQRCSQLRAYACLHCLLIPWAALLATPPPSFKGRSSLLRK
FT                   LGSLFL"
FT   gap             18101995..18102730
FT                   /estimated_length=736
FT   gap             18118931..18118983
FT                   /estimated_length=53
FT   gene            complement(<18124421..18219371)
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /note="gene_id=mCG131033.1"
FT   mRNA            complement(join(<18124421..18124444,18136065..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..>18141038))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173471"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173471.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(<18124421..18124444,18136065..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..>18141036))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173471.0
FT                   protein_id=mCP96391.0 isoform=CRA_a"
FT                   /protein_id="EDL06975.1"
FT                   /translation="KMFLGDNAHLSIINEYLSQSYQKFRRFFQVACDVPELQDKFNVDE
FT                   YSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIG
FT                   ESCGNSNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPG
FT                   ETLTEILETPATNEQEAEHQRAMQRRAIRDAKTPSPKKREKE"
FT   mRNA            complement(join(18124908..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..18141195,18142182..18142266,
FT                   18142355..18142495,18146099..18146323,18147587..18147750,
FT                   18148369..18148524,18150239..18150447,18150798..18150867,
FT                   18150958..18151029,18151120..18151203,18151915..18152085,
FT                   18155137..18155279,18155894..18156061,18156219..18156309,
FT                   18160933..18161096,18163438..18163562,18163981..18164141,
FT                   18164302..18164465,18168202..18168286,18169422..18169585,
FT                   18170192..18170276,18171777..18171955,18172835..18172948,
FT                   18174507..18174574,18177304..18177380,18178894..18178971,
FT                   18180318..18180474,18215902..18216001,18219218..18219371))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT132361"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT132361.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(18125967..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18136121,
FT                   18137737..18137824,18138116..18138251,18138893..18138995,
FT                   18140107..18140239,18140963..18141195,18142182..18142266,
FT                   18142355..18142495,18146099..18146323,18147587..18147750,
FT                   18148369..18148524,18150239..18150447,18150798..18150867,
FT                   18150958..18151029,18151120..18151203,18151915..18152085,
FT                   18155137..18155279,18155894..18156061,18156219..18156309,
FT                   18160933..18161096,18163438..18163562,18163981..18164141,
FT                   18164302..18164465,18168202..18168286,18169422..18169585,
FT                   18170192..18170276,18171777..18171955,18172835..18172948,
FT                   18174507..18174574,18177304..18177380,18178894..18178971,
FT                   18180318..18180474,18215902..18216001,18219218..18219272))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT132361.1
FT                   protein_id=mCP88706.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9JKF1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1352757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JKF1"
FT                   /protein_id="EDL06977.1"
FT                   /translation="MSAAEEVDGLGVVRPHYGSVLDNERLTAEEMDERRRQNVAYEYLC
FT                   HLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYK
FT                   ATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLG
FT                   LAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVI
FT                   AINEAIDRRVAADTFTALKNPNAMLVNLEEGLAPTYQDVLYQAKQDKMTNAKNRTENSD
FT                   RERDVYEELLTQAEIQGNVNKVNTSSALANISLALEQGCAVTLLKALQSLALGLRGLQT
FT                   QNSDWYMKQLQSDLQQKRQSGQTDPLQKEEVQAGVDAANSAAQQYQRRLAAVAAINAAI
FT                   QKGIAEKTVLELMNPEAQLPQVYPFAADLYQKELATLQQQSPEHSLTHPELTVAVEMLS
FT                   SVALINRALESGDMTTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNAFIT
FT                   WNDIQACVDHVNLVVHEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVA
FT                   QHYQDTLIRAKREKAQETQDESAVLWLDEIQGGIWQSNKDTQEAQRFALGISAINEAVD
FT                   SGDVGRTLSALRSPDVGLYGVIPECGETYQSDLAEAKKKRLAAGDNNSKWVKHWVKGGY
FT                   HYYHNLETQAGGWAEPPDFVQNSVQLSREEIQSSISGVTAAYNREQLWLANEGLITKLQ
FT                   ACCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLHSHKDEVVKI
FT                   QSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYKTLINAEDPPMIVVRK
FT                   FVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIKIGLLVKNKITLQDV
FT                   VSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKL
FT                   IFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFQTALQEEIKSKVDQIQEIVTGN
FT                   PTVIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTG
FT                   EASKLPYDVTPEQALSHEEVKTRLDNSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKV
FT                   LKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNL
FT                   GSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQVACDVPELQDKFNVDEY
FT                   SDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGE
FT                   SCGNSNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPGE
FT                   TLTEILETPATNEQEAEHQRAMQRRAIRDAKTPDKMKKSKPMKEDNNLSLQEKKEKIQT
FT                   GLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRKAELVKLQQTYSALNSKATFY
FT                   GEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIED
FT                   LQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDR
FT                   AKVNVNLLIFLLNKKFYGK"
FT   mRNA            complement(join(<18126027..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18135998,
FT                   18148406..>18148473))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173473"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173473.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(<18126027..18126080,18129144..18129252,
FT                   18133029..18133151,18135121..18135287,18135909..18135998,
FT                   18148406..>18148471))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173473.0
FT                   protein_id=mCP96392.0 isoform=CRA_d"
FT                   /protein_id="EDL06978.1"
FT                   /translation="RHDDDKQAEGRAQGFEQREEGEKIQTGLKKLTELGTVDPKNRYQE
FT                   LINDIAKDIRNQRRYRQRRKAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLA
FT                   SKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEV
FT                   GDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDR"
FT   gap             18130294..18130364
FT                   /estimated_length=71
FT   mRNA            complement(join(18146099..18146217,18180325..18180474,
FT                   18215902..18216001,18219218..>18219332))
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   transcript variant mCT173472"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173472.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(18146199..18146217,18180325..18180474,
FT                   18215902..18216001,18219218..>18219332))
FT                   /codon_start=1
FT                   /gene="Iqgap1"
FT                   /locus_tag="mCG_131033"
FT                   /product="IQ motif containing GTPase activating protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG131033.1 transcript_id=mCT173472.0
FT                   protein_id=mCP96390.0 isoform=CRA_b"
FT                   /protein_id="EDL06976.1"
FT                   /translation="RSPASSRSLRFLTGDLDSAAMSAAEEVDGLGVVRPHYGSVLDNER
FT                   LTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNF
FT                   FSPKVVSLKKIYDREQTRSWPLS"
FT   gene            <18163932..18170630
FT                   /locus_tag="mCG_145909"
FT                   /note="gene_id=mCG145909.0"
FT   mRNA            join(<18163932..18164115,18168657..18168745,
FT                   18170267..18170630)
FT                   /locus_tag="mCG_145909"
FT                   /product="mCG145909"
FT                   /note="gene_id=mCG145909.0 transcript_id=mCT186017.0
FT                   created on 04-JUL-2003"
FT   CDS             <18170306..18170563
FT                   /codon_start=1
FT                   /locus_tag="mCG_145909"
FT                   /product="mCG145909"
FT                   /note="gene_id=mCG145909.0 transcript_id=mCT186017.0
FT                   protein_id=mCP107705.0"
FT                   /protein_id="EDL06979.1"
FT                   /translation="ARVSEEPREVCVCFLPPHQHDKTKNKSKYGVQIFCKWQSYTTIPK
FT                   HQVHLVQTVMGSCRVEPGARRQEPGRKPLEEPPCLLRSEG"
FT   gap             18181997..18182271
FT                   /estimated_length=275
FT   gap             18197218..18197237
FT                   /estimated_length=20
FT   gap             18198247..18198266
FT                   /estimated_length=20
FT   gap             18199301..18199320
FT                   /estimated_length=20
FT   gap             18206971..18206990
FT                   /estimated_length=20
FT   gap             18209436..18210976
FT                   /estimated_length=1541
FT   gap             18217443..18217462
FT                   /estimated_length=20
FT   gap             18222976..18223161
FT                   /estimated_length=186
FT   gap             18237619..18237748
FT                   /estimated_length=130
FT   gap             18240987..18241022
FT                   /estimated_length=36
FT   gap             18250050..18250069
FT                   /estimated_length=20
FT   gap             18263309..18264706
FT                   /estimated_length=1398
FT   gene            18279118..18292364
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /note="gene_id=mCG15309.1"
FT   mRNA            join(18279118..18279622,18290878..18292364)
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /product="zinc finger and SCAN domain containing 2"
FT                   /note="gene_id=mCG15309.1 transcript_id=mCT15818.1 created
FT                   on 23-AUG-2002"
FT   CDS             join(18279220..18279622,18290878..18292319)
FT                   /codon_start=1
FT                   /gene="Zscan2"
FT                   /locus_tag="mCG_15309"
FT                   /product="zinc finger and SCAN domain containing 2"
FT                   /note="gene_id=mCG15309.1 transcript_id=mCT15818.1
FT                   protein_id=mCP7232.1"
FT                   /protein_id="EDL06974.1"
FT                   /translation="MAAEVPAVSTPLSPLVQVPQEEDEQAEVTTMILEDDAWVQEAVLQ
FT                   EDGPESEPFPQSAGKGSPQEEDAAEGPQGALVRFRELCRRWLRPEVHTKEQMLTVLPRE
FT                   IQAWLQEHRPESSEEAVALVEDLTQTFRHSDFEIQSENGENSNEDMFEGVESHGMFLNI
FT                   SGGEGGQQSDGDSDFERDCGSGGAQGHAPGEDPRVVPSEGREVGQLIGLQGTYLGEKPY
FT                   ECPQCGKTFSRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCR
FT                   DCGKSFSRSANLITHQRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECG
FT                   KSFGNRSSLNTHQGIHTGEKPYACKECGESFSYNSNLIRHQRIHTGEKPYKCTECGQKF
FT                   SQSSALITHRRTHTGEKPYQCGECGKNFSRSSNLATHRRTHLVEKPYKCGLCGKSFSQS
FT                   SSLIAHQGTHTGEKPYECLTCGESFSWSSNLIKHQRTHTGEKPYRCGDCGKGFSQRSQL
FT                   VVHQRTHTGEKPYKCLLCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIH
FT                   QRIHTGEKPYRCPECGKGFSNSSNFITHQRTHLKEKLY"
FT   gap             18292365..18292963
FT                   /estimated_length=599
FT   gene            complement(18306859..18317377)
FT                   /locus_tag="mCG_15313"
FT                   /note="gene_id=mCG15313.2"
FT   mRNA            complement(join(18306859..18309474,18309782..18309946,
FT                   18314063..18314127,18314643..18314731,18316488..18316576,
FT                   18316784..18316851,18317325..18317373))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT185134"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT185134.0 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(18306860..18308042,18309109..18309474,
FT                   18309782..18309946,18314063..18314127,18314643..18314731,
FT                   18316488..18316576,18316784..18316851,18317325..18317377))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT15822"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT15822.1 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(18307394..18309474,18309782..18309946,
FT                   18314063..18314127,18314643..18314731,18316488..18316576,
FT                   18316784..18317374))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT174594"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT174594.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(18307810..18308042,18309109..18309474,
FT                   18309782..18309946,18314063..18314127,18314643..18314731,
FT                   18316488..18316576,18316784..18316851,18317325..18317365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, isoform CRA_a"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT15822.1
FT                   protein_id=mCP7276.2 isoform=CRA_a"
FT                   /protein_id="EDL06970.1"
FT                   /translation="MELAEDWLVESLRLYQDFHAFDLSGATRVLEWIGEKGVFVAGYES
FT                   LKKNEILHLILPLRLSVQENQGLHPERDFKVRHGGFSDRSVFDLKHVPDTRLLVTSGLP
FT                   GCYIQMWQVREDNDVIEAVSTIDVQDKEESLWPRVSVFCSKAPGILHGARLSGLRTVDV
FT                   ESQKITYSSGTADSESLSCLQVLDANTFAFCGNSGRLGLVDTRQKWAALETVSPGSGCS
FT                   GERWCAEVRNKGQGPGPCIASLGSDGQLCLLDSRNLCHPVSSAQCPVFKPSPDPELLRV
FT                   TWAPGLDNCLAISGFDGTVQIYDVTSWDGKKTQAEPLFTHKGHIFLDGNDVDSAPLVTT
FT                   HTWHPRKPRTLLSAASDSSLHVWDWVDLQAS"
FT   CDS             complement(join(18309053..18309474,18309782..18309946,
FT                   18314063..18314127,18314643..18314731,18316488..18316576,
FT                   18316784..18316851,18317325..18317365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, isoform CRA_d"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT185134.0
FT                   protein_id=mCP106392.0 isoform=CRA_d"
FT                   /protein_id="EDL06973.1"
FT                   /translation="MELAEDWLVESLRLYQDFHAFDLSGATRVLEWIGEKGVFVAGYES
FT                   LKKNEILHLILPLRLSVQENQGLHPERDFKVRHGGFSDRSVFDLKHVPDTRLLVTSGLP
FT                   GCYIQMWQVREDNDVIEAVSTIDVQDKEESLWPRVSVFCSKAPGILHGARLSGLRTVDV
FT                   ESQKITYSSGTADSESLSCLQVLDANTFAFCGNSGRLGLVDTRQKWAALETVSPGSGCS
FT                   GERWCAEVRNKGQGPGPCIASLGSDGQLCLLDSRNLCHPVSSAQCPVFKPSPDPELLRV
FT                   TWAPGLDNCLAISGTVENVSLHCSLPEAVGA"
FT   mRNA            complement(join(18309134..18309474,18309782..18309946,
FT                   18314063..18314127,18316488..18316593,18316784..18316851,
FT                   18317325..>18317365))
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, transcript variant mCT174595"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT174595.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(18316547..18316593,18316784..18316851,
FT                   18317325..18317365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, isoform CRA_c"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT174595.0
FT                   protein_id=mCP97514.0 isoform=CRA_c"
FT                   /protein_id="EDL06972.1"
FT                   /translation="MELAEDWLVESLRLYQDFHAFDLSGATRVLEWIGEKVTVLFQESL
FT                   LLVMKV"
FT   CDS             complement(18317321..18317365)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15313"
FT                   /product="mCG15313, isoform CRA_b"
FT                   /note="gene_id=mCG15313.2 transcript_id=mCT174594.0
FT                   protein_id=mCP97513.0 isoform=CRA_b"
FT                   /protein_id="EDL06971.1"
FT                   /translation="MELAEDWLVESLRL"
FT   gene            complement(18318376..18321167)
FT                   /gene="Nmb"
FT                   /locus_tag="mCG_15307"
FT                   /note="gene_id=mCG15307.1"
FT   mRNA            complement(join(18318376..18318643,18320262..18320434,
FT                   18320949..18321167))
FT                   /gene="Nmb"
FT                   /locus_tag="mCG_15307"
FT                   /product="neuromedin B"
FT                   /note="gene_id=mCG15307.1 transcript_id=mCT15490.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(18318608..18318643,18320262..18320434,
FT                   18320949..18321105))
FT                   /codon_start=1
FT                   /gene="Nmb"
FT                   /locus_tag="mCG_15307"
FT                   /product="neuromedin B"
FT                   /note="gene_id=mCG15307.1 transcript_id=mCT15490.0
FT                   protein_id=mCP7228.1"
FT                   /protein_id="EDL06969.1"
FT                   /translation="MTRQAGSSWLLRGLLLFAVFASGVAPFNWDLPEPRSRASKIRVHP
FT                   RGNLWATGHFMGKKSLEPPSLSLVGTAPPNTPRDQRLQLSHDLLRILLRKKALGMNFSG
FT                   PAPPIQYRRLLEPLLQK"
FT   gene            complement(18323875..18363865)
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /note="gene_id=mCG15305.4"
FT   mRNA            complement(join(18323875..18324168,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363518..18363865))
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), transcript variant
FT                   mCT177756"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177756.1 created
FT                   on 28-APR-2003"
FT   CDS             complement(join(18323914..18324168,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363518..18363568))
FT                   /codon_start=1
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177756.1
FT                   protein_id=mCP100678.0 isoform=CRA_d"
FT                   /db_xref="GOA:D3YTS1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="MGI:MGI:1929464"
FT                   /db_xref="UniProtKB/TrEMBL:D3YTS1"
FT                   /protein_id="EDL06965.1"
FT                   /translation="MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGS
FT                   ESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEK
FT                   QDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFK
FT                   PADPHRAGVDAHVDGYAITLSGPHLFSVDDTLPSVHLDRLANLLTFVVSLDNLNFIFLS
FT                   NGHYTSVSAFGEWKTSCSCKRELVH"
FT   gene            complement(18326504..18329674)
FT                   /locus_tag="mCG_147191"
FT                   /note="gene_id=mCG147191.0"
FT   mRNA            complement(18326504..18329674)
FT                   /locus_tag="mCG_147191"
FT                   /product="mCG147191"
FT                   /note="gene_id=mCG147191.0 transcript_id=mCT187454.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(18328341..18328718)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147191"
FT                   /product="mCG147191"
FT                   /note="gene_id=mCG147191.0 transcript_id=mCT187454.0
FT                   protein_id=mCP109598.0"
FT                   /protein_id="EDL06968.1"
FT                   /translation="MACFHSTSALHASSAQALDAASDEHEHLHAIVHGVLAVLPLSLLC
FT                   ACLKLVVFRHDVVLPLVLYSVLDLGYSLKIAGELWTPLLQEPRFIDTVLCFSRSMKQRL
FT                   LSAGYSHALEAEAWYLRLVLL"
FT   mRNA            complement(join(18331512..18332037,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363518..18363865))
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), transcript variant
FT                   mCT15815"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT15815.1 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(18331512..18332037,18332308..18332365,
FT                   18338492..18338529,18339246..18339365,18343884..18344033,
FT                   18351166..18351275,18363518..18363865))
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), transcript variant
FT                   mCT177755"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177755.1 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(18331512..18332037,18332308..18332365,
FT                   18339246..18339365,18341743..18341775,18343884..18344033,
FT                   18351166..18351275,18363518..18363865))
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), transcript variant
FT                   mCT177757"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177757.1 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(18331512..18332037,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363522..18363642))
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), transcript variant
FT                   mCT172336"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT172336.1 created
FT                   on 28-APR-2003"
FT   CDS             complement(join(18331987..18332037,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363518..18363568))
FT                   /codon_start=1
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT15815.1
FT                   protein_id=mCP7217.1 isoform=CRA_a"
FT                   /protein_id="EDL06962.1"
FT                   /translation="MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGS
FT                   ESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEK
FT                   QDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFK
FT                   YAVLFLLGLFVLVHRE"
FT   CDS             complement(join(18331987..18332037,18332308..18332365,
FT                   18339246..18339365,18341743..18341775,18343884..18344033,
FT                   18351166..18351275,18363518..18363568))
FT                   /codon_start=1
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), isoform CRA_e"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177757.1
FT                   protein_id=mCP100679.1 isoform=CRA_e"
FT                   /db_xref="GOA:D3Z569"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="MGI:MGI:1929464"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z569"
FT                   /protein_id="EDL06966.1"
FT                   /translation="MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGS
FT                   ESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEN
FT                   SAGERKHSICWQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIV
FT                   TILMNDYPKFKYAVLFLLGLFVLVHRE"
FT   CDS             complement(join(18331987..18332037,18332308..18332365,
FT                   18339246..18339365,18343884..18344033,18351166..18351248))
FT                   /codon_start=1
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT172336.1
FT                   protein_id=mCP95255.1 isoform=CRA_b"
FT                   /protein_id="EDL06963.1"
FT                   /translation="MIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTN
FT                   RVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQ
FT                   HWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE"
FT   CDS             complement(join(18332340..18332365,18338492..18338529,
FT                   18339246..18339365,18343884..18344033,18351166..18351275,
FT                   18363518..18363568))
FT                   /codon_start=1
FT                   /gene="Sec11l1"
FT                   /locus_tag="mCG_15305"
FT                   /product="Sec11-like 1 (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG15305.4 transcript_id=mCT177755.1
FT                   protein_id=mCP100677.0 isoform=CRA_c"
FT                   /protein_id="EDL06964.1"
FT                   /translation="MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGS
FT                   ESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEK
FT                   QDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGYYQENRSVEDRNCLFLTLE
FT                   L"
FT   gap             18367021..18367085
FT                   /estimated_length=65
FT   gap             18380719..18381012
FT                   /estimated_length=294
FT   gene            complement(18396897..>18404660)
FT                   /locus_tag="mCG_1028349"
FT                   /note="gene_id=mCG1028349.1"
FT   mRNA            complement(join(18396897..18397885,18403736..18404057,
FT                   18404593..>18404660))
FT                   /locus_tag="mCG_1028349"
FT                   /product="mCG1028349"
FT                   /note="gene_id=mCG1028349.1 transcript_id=mCT146053.1
FT                   created on 30-OCT-2002"
FT   CDS             complement(join(18403814..18404057,18404593..>18404660))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028349"
FT                   /product="mCG1028349"
FT                   /note="gene_id=mCG1028349.1 transcript_id=mCT146053.1
FT                   protein_id=mCP88723.0"
FT                   /protein_id="EDL06961.1"
FT                   /translation="PSSSPTVPLTLNPKGHLRPIEPSIQKAEADGSHSKPAWSTSSSRT
FT                   ARTTQRNPVLKNSNKMSGCGDTLVMKVLRLYRLADSWDSLASSIGPCDKYFQKHSGHT"
FT   gap             18409933..18410371
FT                   /estimated_length=439
FT   gene            <18419696..18461840
FT                   /gene="Zfp592"
FT                   /locus_tag="mCG_49051"
FT                   /note="gene_id=mCG49051.2"
FT   mRNA            join(<18419696..18420148,18452999..>18453027)
FT                   /gene="Zfp592"
FT                   /locus_tag="mCG_49051"
FT                   /product="zinc finger protein 592, transcript variant
FT                   mCT175517"
FT                   /note="gene_id=mCG49051.2 transcript_id=mCT175517.0 created
FT                   on 04-NOV-2002"
FT   CDS             join(<18419887..18420148,18452999..>18453027)
FT                   /codon_start=1
FT                   /gene="Zfp592"
FT                   /locus_tag="mCG_49051"
FT                   /product="zinc finger protein 592, isoform CRA_a"
FT                   /note="gene_id=mCG49051.2 transcript_id=mCT175517.0
FT                   protein_id=mCP98439.0 isoform=CRA_a"
FT                   /protein_id="EDL06959.1"
FT                   /translation="GYYYTWLETFMAIRCCSPEVFVCLFVCFVRQGFSLQPGSLGTSSV
FT                   DQADLKLTDPPASDFQILGLKVCPSTASPSQAFFFFFGFSRQARAIQRNPVS"
FT   gap             18422905..18422924
FT                   /estimated_length=20
FT   mRNA            join(18426075..18426186,18439965..18442203,
FT                   18446157..18446335,18454043..18454219,18454498..18454657,
FT                   18454757..18455044,18455246..18455358,18455823..18455958,
FT                   18458026..18461840)
FT                   /gene="Zfp592"
FT                   /locus_tag="mCG_49051"
FT                   /product="zinc finger protein 592, transcript variant
FT                   mCT49234"
FT                   /note="gene_id=mCG49051.2 transcript_id=mCT49234.2 created
FT                   on 30-OCT-2002"
FT   gap             18436393..18436412
FT                   /estimated_length=20
FT   CDS             join(18439984..18442203,18446157..18446335,
FT                   18454043..18454219,18454498..18454657,18454757..18455044,
FT                   18455246..18455358,18455823..18455958,18458026..18458541)
FT                   /codon_start=1
FT                   /gene="Zfp592"
FT                   /locus_tag="mCG_49051"
FT                   /product="zinc finger protein 592, isoform CRA_b"
FT                   /note="gene_id=mCG49051.2 transcript_id=mCT49234.2
FT                   protein_id=mCP29866.2 isoform=CRA_b"
FT                   /protein_id="EDL06960.1"
FT                   /translation="MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQAPSEENESPLKSSG
FT                   MCIDENVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHIAPSLLHNGFRGSDLPPDS
FT                   HHCGKFDSTFINGDSARSFTSKLEPSKSEPLPTFNQFSPISSPEPEDPVKDNGFGIKSK
FT                   HSDSYFPPPPGTVGGPVLEALSKFPVPELHMFDHFCKKEPKPEPLPLESQQEHEQGGQK
FT                   VVEPHKDLDSSRFFGEALEFNSHPSNSIGEPKKLAPELSACSSVPPRQRLKPAHSKLSS
FT                   CVAALVALQAKRVANVTKEDQPGHTKDSSGPTKEGSKGSPKMPKSPKSPRSPLEATRKS
FT                   IKPSDSPRSICSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDP
FT                   SKSPAESPAGSTITEAPSEAPGDEGTAMPVEEHFSEAGIHSGSPQGDRKGDENMIKTSD
FT                   SSSPCRISGSRVPKGSALNSQASKKQQSTAPQASTPAASLLPKAVHLANLNLVPHSVAA
FT                   SVTAKSSAQRRSQPQVTQMTVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNLSPPA
FT                   DSRIHVPASGYCCLECGDAFALEKSLSQHYSRRSVHIEVLCTLCSKTLLFFNKCSLLRH
FT                   ARDHKSKGLVMQCSQLLVKPISADQMFVAAPVNSTAPATPAASSSPKPSPTLDNASSVI
FT                   PALPLYPDPVRLIRYGTKCPECHKQMRDYMVLATHFQRTTEETEGLTCQVCQMLLPNQC
FT                   SFCAHQRVHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYRCIHCGVIHLTLA
FT                   LLKSHIQERHCQVFHKCAFCPMAFKTASSTMDHSTTQHPTQPHKPSQLIYKCSCEMVFN
FT                   KKRHIQQHFYQNVSKTQAGVFKCPECPLLFLQKPELMQHVKNTHGVPRNVEELSSLQSS
FT                   TDTSSNRPGSRAPAEPPATNVAARGSSLTAGRWGRPEAHRRAEARPRMRSTGWTCQECQ
FT                   EWVPDRESYVSHMKKSHGRTLKRYPCRQCEQSFHNPSSLRKHIRNNHDTVKKVYTCGYC
FT                   TEDSPSFPRPSLLESHISLMHGIRNPDLSQTSKVRHPGGPSPQVNHLKRPVSRMADAPG
FT                   TSNGATVSSTKRHKSLFQCAKCTFATDSELEFQSHIPQHQVDSSTAQCLLCGLCYTSTS
FT                   SLNRHLFIVHKVRDQEEGGEDIVEVKVEAPDSEACSGEEVAMETKENGLEECASEPLVT
FT                   DLGGQQGLALDEDSAQDPQNQPQASQDQNSHALSPQV"
FT   gap             18465695..18465714
FT                   /estimated_length=20
FT   gene            18474439..18522406
FT                   /gene="Alpk3"
FT                   /locus_tag="mCG_141468"
FT                   /note="gene_id=mCG141468.0"
FT   mRNA            join(18474439..18474611,18480732..18480770,
FT                   18484653..18484774,18493850..18493967,18494523..18495810,
FT                   18508908..18510936,18511659..18511806,18512154..18512281,
FT                   18512410..18512445,18515499..18515773,18516924..18517012,
FT                   18517675..18517898,18520143..18520191,18520763..18522406)
FT                   /gene="Alpk3"
FT                   /locus_tag="mCG_141468"
FT                   /product="alpha-kinase 3"
FT                   /note="gene_id=mCG141468.0 transcript_id=mCT175511.0
FT                   created on 30-OCT-2002"
FT   CDS             join(18474469..18474611,18480732..18480770,
FT                   18484653..18484774,18493850..18493967,18494523..18495810,
FT                   18508908..18510936,18511659..18511806,18512154..18512281,
FT                   18512410..18512445,18515499..18515773,18516924..18517012,
FT                   18517675..18517898,18520143..18520191,18520763..18521108)
FT                   /codon_start=1
FT                   /gene="Alpk3"
FT                   /locus_tag="mCG_141468"
FT                   /product="alpha-kinase 3"
FT                   /note="gene_id=mCG141468.0 transcript_id=mCT175511.0
FT                   protein_id=mCP98433.0"
FT                   /protein_id="EDL06958.1"
FT                   /translation="MGSRRAAGRGWGLGGRAGAGGDSEDDGPVWTPGPASRNYLLSVRP
FT                   EASLSSNRLSHPSSGRSTFCSIIAQLTEETQPLFETTLKSRAVSEDSDVRFTCIVTGYP
FT                   EPEVTWYKDDIELDRYCGLPKYEITHQGNRHTLQLYRCQEEDAAIYQASARNTKGIVSC
FT                   SGVLEVGTMTEYKIHQRWFAKLKRKAAAKMREIEQSWKHGKEASGEADTLLRKISPDRF
FT                   QRKRRLSGVEEAVLSTPVREMEEGSSAAWQEGETESAQHPGLGLINSFAPGEAPTNGEP
FT                   APENGEDEERGLLTYICEVMELGPQNSPPKESGAKKKRKDEESKPGEQKLELEKAEGSQ
FT                   CSSENVVPSTDKPNSSRREKSTDTQPAQTQPRGRVARGPGIESTRKTASVLGIQDKVQD
FT                   VPAPAPAPAPAPAPAPAPVPVPAPTPVPSRSSEQVYFSLKDMFMETTRAGRSQEEEKPP
FT                   PPSTRVAGESPPGKTPVKSRLEKVPMVSSQPTSSMVPPPIKPLNRKRFAPPKSKVESTT
FT                   TSLSSQTSESMAQSLGKALPSASTQVPTPPARRRHGTRDSPLQGQTSHKTPGEALESPA
FT                   TVAPTKSANSSSDTVSVDHDSSGNQGATEPMDTETQEDGRTLVDGRTGSRKKTHTDGKL
FT                   QVDGRTQGDGAQDRAHASPRTQAGEKDVVTQGSERPQSDRSSWKNLVTQRRVDMQVGQM
FT                   QAGERWQQDPGDARIQEEEKETQSAAGSIPVAFETQSEQLSMASLSSLPGALKGSPSGC
FT                   PRESQAIECFEKSTEAPCVQERSDLMLRSEEAAFRSHEDGLLGPPSGNRTYPTQLPPEG
FT                   HSEHLGGQTHQRSEQEDSLSQCPKKEQPQEPLHVGLSGGHSTGLSQEVPAMPSLPGTGL
FT                   TSSLQEELPGTAASLHTNTDVPLPSRDQDFPSSAPTLQLGPGSPTQSHPPEAMTTSSEG
FT                   ACAKEPNVDGRSSGTRSCDPGLIDSLKNYLLLLLKLSSPETSEARAESQEVADTGGLTS
FT                   SSTLVPTMEVAGLSPRTSRRILERVENNHLVQSAQTLLLSPCTSRRLTGLLDREVQAGQ
FT                   QALAAAQCSRGPCPTPLTIPAIVVGEEGSAGEDSEERTSQESDKKGLLGEVEGHTVESR
FT                   TQEPCQEEAMPGEALTGLPAATPEELALGARRKRFLPKVRAGSDGEANKAEERESPTVS
FT                   PRGPRKGLTPGSPGTPGRERRSPTQARKASMLEVPGAEEEPATGDLVSRSKDSGLDSEP
FT                   AVDEGKQEALAKQRKAKDLLKAPQVIRKIRVEQFPDSSGSLKLWCQFFNIVSDSVLTWA
FT                   KDQHPVGEVNRSAGDEGPAALAIVQASPTDCGVYRCTIQNEHGSASTDFCLSPEVLSGF
FT                   ISREEGEVGEEIEMTPMVFAKGLADSGCWGDKLFGRLVSEELRGGGHGLQKASRAKVIY
FT                   GLEPIFESGRTCIIKVSSLLVFGPSSETSLLGRNYDVTIQGCKIQNMSREYCKIFAAEA
FT                   RAASGFGEVPEIIPLYLIYRPANNIPYATLEEDLGKPLQTYCSRQWGCAGAPAAASSSE
FT                   ALQKCQTFQHWLYQWTNGSFLVTDLTGADWKMTDVQIATKLRGYQGLKESCFPALLDQF
FT                   ASSHQCNTYCDMLGLKPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQG
FT                   SRKSAPSSRATLQASQAATVQLLGQPPVQDGSSKAQSMR"
FT   gap             18478411..18478611
FT                   /estimated_length=201
FT   gap             18490794..18491230
FT                   /estimated_length=437
FT   gap             18498412..18498934
FT                   /estimated_length=523
FT   gene            <18532433..18586130
FT                   /gene="Slc28a1"
FT                   /locus_tag="mCG_15304"
FT                   /note="gene_id=mCG15304.2"
FT   mRNA            join(<18532433..18532528,18533365..18533453,
FT                   18534481..18534572,18539174..18539357,18542000..18542141,
FT                   18543293..18543406,18544845..18544922,18555938..18556018,
FT                   18559743..18559823,18569310..18569435,18576900..18577030,
FT                   18580207..18580375,18580462..18580659,18584155..18584236,
FT                   18585169..18585267,18585372..18585483,18585743..18586130)
FT                   /gene="Slc28a1"
FT                   /locus_tag="mCG_15304"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 1"
FT                   /note="gene_id=mCG15304.2 transcript_id=mCT15814.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(18532433..18532528,18533365..18533453,
FT                   18534481..18534572,18539174..18539357,18542000..18542141,
FT                   18543293..18543406,18544845..18544922,18555938..18556018,
FT                   18559743..18559823,18569310..18569435,18576900..18577030,
FT                   18580207..18580375,18580462..18580659,18584155..18584236,
FT                   18585169..18585267,18585372..18585483,18585743..18585815)
FT                   /codon_start=1
FT                   /gene="Slc28a1"
FT                   /locus_tag="mCG_15304"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 1"
FT                   /note="gene_id=mCG15304.2 transcript_id=mCT15814.2
FT                   protein_id=mCP7347.2"
FT                   /protein_id="EDL06957.1"
FT                   /translation="MADDTPRQRESISLTPVAHGLENMGAEFLEIMEEGQLPHRHSSLP
FT                   EGGGSRSKAVWKPFSRWRSLQPTVQARSLCREHWQLFEWISKGLLSTAYIGFLIVACLL
FT                   DFPRALALFVITCVVLVFLAYNLLKRLLGSKLKKCVKFQGHSCLSLWLKRGLALAAGLG
FT                   VILWLSLDTAQRPEQLVSFAGICVFLVLLFAGSKHHRAVSWRAVSWGLGLQFVLGLFAI
FT                   RTEPGFVAFQWLGDQIRVFLSYTEAGSSFVFGEALVKDVFAFQVLPIIVFFSCVMSVLY
FT                   YLGLMQWVILKIAWLMQVTMGTSATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHV
FT                   VMTGGYATIAGSLLGAYISFGIDASSLIAASVMAAPCALALSKLVYPEVEESKFRSEEG
FT                   VKLTYGDAQNLVEAASAGAAISVKVVANIAANLIAFLAVLAFINAALSWLGDMVDIQGL
FT                   SFQLICSYVLRPVAFLMGVAWEDCPVVAELLGIKLFLNEFVAYQELSQYKQRRLAGAEE
FT                   WLGDKKQWISVRAEILTTYALCGFANFSSIGIMLGGLTSMVPQRRSDFSQIVLRALITG
FT                   AFVSLVNACVAGILYVPRGVEVDCMSLLNQTLSSSSFEVYLCCRQVFQNTSLEFGQEAL
FT                   GNCCRFYNHTVCT"
FT   gap             18535885..18535904
FT                   /estimated_length=20
FT   gap             18553070..18553089
FT                   /estimated_length=20
FT   gap             18570277..18570391
FT                   /estimated_length=115
FT   gap             18581458..18581477
FT                   /estimated_length=20
FT   gap             18587172..18587262
FT                   /estimated_length=91
FT   gap             18610412..18610431
FT                   /estimated_length=20
FT   gap             18616126..18616145
FT                   /estimated_length=20
FT   gap             18617759..18617880
FT                   /estimated_length=122
FT   gap             18620017..18623066
FT                   /estimated_length=3050
FT   gene            complement(18624881..>18625869)
FT                   /locus_tag="mCG_141421"
FT                   /note="gene_id=mCG141421.0"
FT   mRNA            complement(18624881..>18625869)
FT                   /locus_tag="mCG_141421"
FT                   /product="mCG141421"
FT                   /note="gene_id=mCG141421.0 transcript_id=mCT175213.0
FT                   created on 30-OCT-2002"
FT   CDS             complement(18625037..>18625327)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141421"
FT                   /product="mCG141421"
FT                   /note="gene_id=mCG141421.0 transcript_id=mCT175213.0
FT                   protein_id=mCP98132.0"
FT                   /protein_id="EDL06956.1"
FT                   /translation="NWRATPLGVHLIPRASHFEGLPALLCSLGPPGPWRDRDVASFPQS
FT                   TPFLHAPGCDPEWLRLLPADWLLLRPGDVLRAEVPAVTDTGAWSLWQLQRP"
FT   gap             18626233..18626776
FT                   /estimated_length=544
FT   gene            complement(18634737..18635568)
FT                   /locus_tag="mCG_51133"
FT                   /note="gene_id=mCG51133.1"
FT   mRNA            complement(18634737..18635568)
FT                   /locus_tag="mCG_51133"
FT                   /product="mCG51133"
FT                   /note="gene_id=mCG51133.1 transcript_id=mCT51316.1 created
FT                   on 30-OCT-2002"
FT   CDS             complement(18635037..18635549)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51133"
FT                   /product="mCG51133"
FT                   /note="gene_id=mCG51133.1 transcript_id=mCT51316.1
FT                   protein_id=mCP29971.0"
FT                   /protein_id="EDL06955.1"
FT                   /translation="MEEYVREPCPWQIVDDCGSTFMGTIGGGIFQAFKGFRNSPVGINH
FT                   RLRGSLTAIKTRTPQLGGSFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAA
FT                   RNGPVAMVGSAAMGAILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSLF
FT                   GDHRQYQ"
FT   gap             18635917..18636027
FT                   /estimated_length=111
FT   gap             18642212..18642656
FT                   /estimated_length=445
FT   gap             18655789..18655808
FT                   /estimated_length=20
FT   gap             18657034..18657053
FT                   /estimated_length=20
FT   gap             18676635..18676700
FT                   /estimated_length=66
FT   gap             18682996..18683015
FT                   /estimated_length=20
FT   gene            18693773..18747252
FT                   /gene="Pde8a"
FT                   /locus_tag="mCG_15310"
FT                   /note="gene_id=mCG15310.1"
FT   mRNA            join(18693773..18693831,18695420..18695610,
FT                   18704840..18704896,18705735..18705789,18708281..18708369,
FT                   18713243..18713321,18714758..18714895,18719299..18719387,
FT                   18721424..18721475,18721558..18721600,18727704..18727781,
FT                   18729556..18729626,18729880..18730041,18731662..18731710,
FT                   18731917..18732052,18733246..18733444,18736673..18736890,
FT                   18738908..18739037,18740675..18740842,18745594..18745723,
FT                   18746140..18747252)
FT                   /gene="Pde8a"
FT                   /locus_tag="mCG_15310"
FT                   /product="phosphodiesterase 8A"
FT                   /note="gene_id=mCG15310.1 transcript_id=mCT15819.1 created
FT                   on 22-AUG-2002"
FT   CDS             join(18693805..18693831,18695420..18695610,
FT                   18704840..18704896,18705735..18705789,18708281..18708369,
FT                   18713243..18713321,18714758..18714895,18719299..18719387,
FT                   18721424..18721475,18721558..18721600,18727704..18727781,
FT                   18729556..18729626,18729880..18730041,18731662..18731710,
FT                   18731917..18732052,18733246..18733444,18736673..18736890,
FT                   18738908..18739037,18740675..18740842,18745594..18745723,
FT                   18746140..18746246)
FT                   /codon_start=1
FT                   /gene="Pde8a"
FT                   /locus_tag="mCG_15310"
FT                   /product="phosphodiesterase 8A"
FT                   /note="gene_id=mCG15310.1 transcript_id=mCT15819.1
FT                   protein_id=mCP7339.2"
FT                   /protein_id="EDL06954.1"
FT                   /translation="MRFHQDQLQVLLVFTKEDSQCNGFHRACEKAGFKCTVTKEVQTVL
FT                   TCFQDKLHDIIIIDHRYPRQMDAETLCRSIRSSKFSENTVIVGVVRRVDKEESSLMPFL
FT                   AAGFTRRFIENPNVMACYNELLQLACGEVRSQLKLRACNSVFTALEKSQEAIEITSEDH
FT                   IIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQK
FT                   KNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKVETTTECVQTDSQTDNQAGKHK
FT                   DRRKHSMDAKAVSSRTSDVSSQRRHSSLARIHSMMIEAPITKVINIINAAQENSPVPVT
FT                   EALNRVLDILRTTELYSPQFNAQDDPHATDLVGGLMSDGLRRFSGNEYILATKNLPPLS
FT                   NNLATPVSLHDVPPRIALAIENEEQWDFDIFELEVATQNRPLIYLGLKTFARFGMCEFL
FT                   QCSETTLRSWFQMIESNYHSSNPYHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAAL
FT                   IAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAFQLTLENDQCNIFKQM
FT                   ERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSINKPLTAQESEEPDRSLEDIKAMLK
FT                   TPESRALIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVMPVFD
FT                   RNTCSIPKSQISFIDYFITDMFDAWDAFVDLPNLMQHLDDNFRYWKGLDEKKLRSLRPP
FT                   PE"
FT   gap             18735405..18735453
FT                   /estimated_length=49
FT   gap             18743523..18743650
FT                   /estimated_length=128
FT   gene            complement(18755456..18757967)
FT                   /locus_tag="mCG_15301"
FT                   /note="gene_id=mCG15301.2"
FT   mRNA            complement(join(18755456..18755573,18756460..18756525,
FT                   18757036..18757141,18757664..18757733,18757927..18757957))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175205"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175205.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(18755459..18755573,18756460..18756525,
FT                   18757036..18757141,18757582..18757733,18757927..18757967))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT15485"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT15485.1 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(18755466..18755573,18756460..18756525,
FT                   18757036..18757057,18757106..18757141,18757582..18757733,
FT                   18757927..18757951))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175204"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175204.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(18755467..18755573,18756460..18756525,
FT                   18757036..18757501))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175202"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175202.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(18755493..18755573,18756460..18756525,
FT                   18757036..18757057,18757106..18757141,18757582..18757733,
FT                   18757927..18757929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_f"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175204.0
FT                   protein_id=mCP98124.0 isoform=CRA_f"
FT                   /protein_id="EDL06952.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAGYVTHLMKRIQRGRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVT
FT                   QPTVGMNFKTPRGAV"
FT   CDS             complement(join(18755493..18755573,18756460..18756525,
FT                   18757036..18757141,18757582..18757733,18757927..18757929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_a"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT15485.1
FT                   protein_id=mCP7354.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5M9L7"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="MGI:MGI:1309526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9L7"
FT                   /protein_id="EDL06947.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKE
FT                   MLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV"
FT   CDS             complement(join(18755493..18755573,18756460..18756525,
FT                   18757036..18757125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_d"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175202.0
FT                   protein_id=mCP98119.0 isoform=CRA_d"
FT                   /protein_id="EDL06950.1"
FT                   /translation="MKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDT
FT                   KEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV"
FT   mRNA            complement(join(18755507..18755573,18756460..>18756870))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175203"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175203.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(18756126..18756525,18757036..18757141,
FT                   18757582..18757733,18757927..18757957))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175200"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175200.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(18756445..18756525,18757036..18757141,
FT                   18757582..18757733,18757927..18757929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_b"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175200.0
FT                   protein_id=mCP98122.0 isoform=CRA_b"
FT                   /protein_id="EDL06948.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKE
FT                   MLKLLVSVA"
FT   CDS             complement(18756497..>18756679)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_e"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175203.0
FT                   protein_id=mCP98120.0 isoform=CRA_e"
FT                   /protein_id="EDL06951.1"
FT                   /translation="FQHLGGRCLSSKPAWSTWCFPGQLRLCVALGAEEVKDNPRIHNLN
FT                   LILSLSGLSPRSGDH"
FT   CDS             complement(join(18757125..18757141,18757664..18757733,
FT                   18757927..18757929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_g"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175205.0
FT                   protein_id=mCP98123.0 isoform=CRA_g"
FT                   /protein_id="EDL06953.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLAMSRI"
FT   mRNA            complement(join(18757165..18757733,18757927..18757945))
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, transcript variant mCT175201"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175201.0 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(18757578..18757733,18757927..18757929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15301"
FT                   /product="mCG15301, isoform CRA_c"
FT                   /note="gene_id=mCG15301.2 transcript_id=mCT175201.0
FT                   protein_id=mCP98121.0 isoform=CRA_c"
FT                   /protein_id="EDL06949.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAG"
FT   gene            complement(18760167..18867605)
FT                   /gene="Cpeb1"
FT                   /locus_tag="mCG_15299"
FT                   /note="gene_id=mCG15299.1"
FT   mRNA            complement(join(18760167..18761163,18762619..18762699,
FT                   18763172..18763266,18764571..18764769,18768702..18768838,
FT                   18769721..18769825,18770132..18770245,18772561..18772813,
FT                   18774418..18774641,18784895..18785083,18849130..18849304,
FT                   18867562..18867605))
FT                   /gene="Cpeb1"
FT                   /locus_tag="mCG_15299"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 1"
FT                   /note="gene_id=mCG15299.1 transcript_id=mCT15486.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(18761065..18761163,18762619..18762699,
FT                   18763172..18763266,18764571..18764769,18768702..18768838,
FT                   18769721..18769825,18770132..18770245,18772561..18772813,
FT                   18774418..18774641,18784895..18785083,18849130..18849304,
FT                   18867562..18867576))
FT                   /codon_start=1
FT                   /gene="Cpeb1"
FT                   /locus_tag="mCG_15299"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 1"
FT                   /note="gene_id=mCG15299.1 transcript_id=mCT15486.0
FT                   protein_id=mCP7320.1"
FT                   /protein_id="EDL06946.1"
FT                   /translation="MAFSLEEAAGRIKDCWDNQEVPALSTCSNANIFRRINAILDDSLD
FT                   FSKVCTTPINRGIHDQLPDFQDSEETVTSRMLFPTSAQESPRGLPDANGLCLGLQSLSL
FT                   TGWDRPWSTQDSDSSAQSSTQSVLSMLQNPLGNVLGKAPLSFLSLDPLGSDLDKFPAPS
FT                   VRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSMTGNGPRD
FT                   PLKMGVGSRMDQEQAALAAVAPSPTSAPKRWPGASVWPSWDLLGAPKDPFSIEREARLH
FT                   RQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEW
FT                   PGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRR
FT                   MRCKEVQVIPWVLADSNFVWSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVY
FT                   AGIDTDKHKYPIGSGRVTFNNQRSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLIC
FT                   SSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKN"
FT   gap             18762009..18762084
FT                   /estimated_length=76
FT   gap             18775684..18775835
FT                   /estimated_length=152
FT   gap             18808494..18808664
FT                   /estimated_length=171
FT   gene            complement(18873312..18907074)
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /note="gene_id=mCG114671.1"
FT   mRNA            complement(join(18873312..18873713,18873840..18873978,
FT                   18875816..18875913,18876153..18876237,18876596..18876804,
FT                   18876968..18877109,18877354..18877469,18877589..18877765,
FT                   18878052..18878169,18878569..18878677,18879083..18879201,
FT                   18880347..18880533,18884737..18884913,18885950..18886059,
FT                   18886337..18886469,18886807..18886869,18889707..18889761,
FT                   18889912..18890195,18890282..18890464,18890554..18890621,
FT                   18890873..18891033,18897372..18897459,18898039..18898113,
FT                   18898237..18898312,18906722..18906950))
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, transcript variant mCT115765"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT115765.2
FT                   created on 06-AUG-2003"
FT   gap             18885136..18885155
FT                   /estimated_length=20
FT   mRNA            complement(join(18887344..18889011,18889706..18889761,
FT                   18889912..18890195,18890282..18890464,18890554..18890621,
FT                   18890873..18891033,18897372..18897459,18898039..18898113,
FT                   18898237..18898312,18906722..18906950))
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, transcript variant mCT175187"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT175187.1
FT                   created on 06-AUG-2003"
FT   gap             18889012..18889474
FT                   /estimated_length=463
FT   CDS             complement(join(18890987..18891033,18897372..18897459,
FT                   18898039..18898113,18898237..18898312,18906722..18906834))
FT                   /codon_start=1
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT115765.2
FT                   protein_id=mCP89110.2 isoform=CRA_a"
FT                   /protein_id="EDL06943.1"
FT                   /translation="MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEM
FT                   LDTNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVACKNIELVYVYLVRYAEEQQEP
FT                   RSTVHLYFPTWPKGSQPADPCQCAPGSL"
FT   CDS             complement(join(18890987..18891033,18897372..18897459,
FT                   18898039..18898113,18898237..18898312,18906722..18906834))
FT                   /codon_start=1
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT175187.1
FT                   protein_id=mCP98106.1 isoform=CRA_a"
FT                   /protein_id="EDL06944.1"
FT                   /translation="MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEM
FT                   LDTNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVACKNIELVYVYLVRYAEEQQEP
FT                   RSTVHLYFPTWPKGSQPADPCQCAPGSL"
FT   gap             18892431..18893782
FT                   /estimated_length=1352
FT   gap             18897460..18897725
FT                   /estimated_length=266
FT   mRNA            complement(18905644..18907074)
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, transcript variant mCT186655"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT186655.0
FT                   created on 06-AUG-2003"
FT   CDS             complement(18906718..18906834)
FT                   /codon_start=1
FT                   /gene="Ap3b2"
FT                   /locus_tag="mCG_114671"
FT                   /product="adaptor-related protein complex 3, beta 2
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG114671.1 transcript_id=mCT186655.0
FT                   protein_id=mCP107890.0 isoform=CRA_b"
FT                   /protein_id="EDL06945.1"
FT                   /translation="MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKR"
FT   gene            complement(18907489..18911497)
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /note="gene_id=mCG114673.2"
FT   mRNA            complement(join(18907489..18907592,18908340..18908469,
FT                   18908793..18908994,18909357..18909374,18910017..18910034,
FT                   18911399..>18911448))
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, transcript variant
FT                   mCT189934"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT189934.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(18907493..18907592,18908340..18908587,
FT                   18908793..18908994,18909357..18909374,18910017..18910034,
FT                   18911399..18911451))
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, transcript variant
FT                   mCT115767"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT115767.0
FT                   created on 30-OCT-2002"
FT   mRNA            complement(join(18907494..18907592,18908340..18908587,
FT                   18908793..18909012,18910017..18910034,18911399..18911419))
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, transcript variant
FT                   mCT175188"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT175188.0
FT                   created on 30-OCT-2002"
FT   mRNA            complement(join(<18907560..18907592,18908340..18908587,
FT                   18908793..18908994,18910017..18910034,18911399..18911497))
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, transcript variant
FT                   mCT175189"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT175189.0
FT                   created on 30-OCT-2002"
FT   CDS             complement(join(18907560..18907592,18908340..18908587,
FT                   18908793..18908994,18910017..18910034))
FT                   /codon_start=1
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, isoform CRA_c"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT175189.0
FT                   protein_id=mCP98108.0 isoform=CRA_c"
FT                   /protein_id="EDL06941.1"
FT                   /translation="MSFKCQTLVGASSTIQFFFSEALMGQNFQEVELENYEPQPGDLFL
FT                   FKLQTPKAQWCGAHVGVYCGQGEIIHFEGRTSNQNGVQTFLGYCEGVVCKQGHRALQRS
FT                   RQLWRVLRRRGGVDPRVLESRVREAMDNDPPPYHPTSSNCVHFALNLLGMDSMSMDRNL
FT                   TSD"
FT   CDS             complement(join(18907560..18907592,18908340..18908587,
FT                   18908793..18908994,18909357..18909374,18910017..18910034))
FT                   /codon_start=1
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, isoform CRA_a"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT115767.0
FT                   protein_id=mCP88860.1 isoform=CRA_a"
FT                   /db_xref="GOA:D3YXE9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="MGI:MGI:3510776"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXE9"
FT                   /protein_id="EDL06939.1"
FT                   /translation="MSFKCQSLISTQTLVGASSTIQFFFSEALMGQNFQEVELENYEPQ
FT                   PGDLFLFKLQTPKAQWCGAHVGVYCGQGEIIHFEGRTSNQNGVQTFLGYCEGVVCKQGH
FT                   RALQRSRQLWRVLRRRGGVDPRVLESRVREAMDNDPPPYHPTSSNCVHFALNLLGMDSM
FT                   SMDRNLTSD"
FT   CDS             complement(join(18907560..18907592,18908340..18908587,
FT                   18908793..18908943))
FT                   /codon_start=1
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, isoform CRA_b"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT175188.0
FT                   protein_id=mCP98107.0 isoform=CRA_b"
FT                   /protein_id="EDL06940.1"
FT                   /translation="MGQNFQEVELENYEPQPGDLFLFKLQTPKAQWCGAHVGVYCGQGE
FT                   IIHFEGRTSNQNGVQTFLGYCEGVVCKQGHRALQRSRQLWRVLRRRGGVDPRVLESRVR
FT                   EAMDNDPPPYHPTSSNCVHFALNLLGMDSMSMDRNLTSD"
FT   CDS             complement(join(18908360..18908469,18908793..18908994,
FT                   18909357..18909374,18910017..18910034,18911399..>18911413))
FT                   /codon_start=1
FT                   /gene="BC048679"
FT                   /locus_tag="mCG_114673"
FT                   /product="cDNA sequence BC048679, isoform CRA_d"
FT                   /note="gene_id=mCG114673.2 transcript_id=mCT189934.0
FT                   protein_id=mCP110912.0 isoform=CRA_d"
FT                   /protein_id="EDL06942.1"
FT                   /translation="GGHCKMSFKCQSLISTQTLVGASSTIQFFFSEALMGQNFQEVELE
FT                   NYEPQPGDLFLFKLQTPKAQWCGAHVGVYCGQGEIIHFEGAVALTLGCWRAACEKLWTT
FT                   ILLPTIPLAATVCTLH"
FT   gap             18916706..18916725
FT                   /estimated_length=20
FT   gap             18917752..18917771
FT                   /estimated_length=20
FT   gap             18924141..18924160
FT                   /estimated_length=20
FT   gene            complement(18939165..>18946241)
FT                   /locus_tag="mCG_1028347"
FT                   /note="gene_id=mCG1028347.1"
FT   mRNA            complement(join(18939165..18939273,18939318..18940273,
FT                   18944283..>18946241))
FT                   /locus_tag="mCG_1028347"
FT                   /product="mCG1028347"
FT                   /note="gene_id=mCG1028347.1 transcript_id=mCT146051.1
FT                   created on 30-OCT-2002"
FT   gene            <18942520..18945205
FT                   /locus_tag="mCG_145906"
FT                   /note="gene_id=mCG145906.0"
FT   mRNA            join(<18942520..18942668,18942885..18942987,
FT                   18943076..18943256,18944934..18945205)
FT                   /locus_tag="mCG_145906"
FT                   /product="mCG145906"
FT                   /note="gene_id=mCG145906.0 transcript_id=mCT186014.0
FT                   created on 04-JUL-2003"
FT   CDS             <18944996..18945175
FT                   /codon_start=1
FT                   /locus_tag="mCG_145906"
FT                   /product="mCG145906"
FT                   /note="gene_id=mCG145906.0 transcript_id=mCT186014.0
FT                   protein_id=mCP107703.0"
FT                   /protein_id="EDL06938.1"
FT                   /translation="VSSASTWDYKDLEYITNPAGFPPSFFFLRFIFLPKDNMLKQSSLW
FT                   LVTVMLEVGYPLLQ"
FT   CDS             complement(18945439..>18945768)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028347"
FT                   /product="mCG1028347"
FT                   /note="gene_id=mCG1028347.1 transcript_id=mCT146051.1
FT                   protein_id=mCP88712.1"
FT                   /protein_id="EDL06937.1"
FT                   /translation="LHLRKTRTLLSTKSPDAANAGVSYSLPRETLFSLEFCFLAHPNSD
FT                   AVTTLVSFWTLLVQAAAQIPDLSLAHRACLSVCVSLSLCLSFSHTHTHTHTHTHTHTQL
FT                   LLTLT"
FT   gene            complement(18949011..>18983747)
FT                   /gene="Fsd2"
FT                   /locus_tag="mCG_114670"
FT                   /note="gene_id=mCG114670.1"
FT   mRNA            complement(join(18949011..18949383,18950853..18951029,
FT                   18954033..18954165,18955761..18955894,18958734..18958884,
FT                   18959631..18959765,18962588..18962743,18963634..18963755,
FT                   18965639..18965661,18966705..18966935,18972834..18972929,
FT                   18973294..18973875,18983643..>18983747))
FT                   /gene="Fsd2"
FT                   /locus_tag="mCG_114670"
FT                   /product="fibronectin type III and SPRY domain containing
FT                   2"
FT                   /note="gene_id=mCG114670.1 transcript_id=mCT115764.1
FT                   created on 30-OCT-2002"
FT   CDS             complement(join(18949338..18949383,18950853..18951029,
FT                   18954033..18954165,18955761..18955894,18958734..18958884,
FT                   18959631..18959765,18962588..18962743,18963634..18963755,
FT                   18965639..18965661,18966705..18966935,18972834..18972929,
FT                   18973294..>18973716))
FT                   /codon_start=1
FT                   /gene="Fsd2"
FT                   /locus_tag="mCG_114670"
FT                   /product="fibronectin type III and SPRY domain containing
FT                   2"
FT                   /note="gene_id=mCG114670.1 transcript_id=mCT115764.1
FT                   protein_id=mCP89086.1"
FT                   /protein_id="EDL06936.1"
FT                   /translation="DSSRIRREVTQAEDDRELGDEFVDEHRLGTLGYPSYGMRRRDPGR
FT                   EQRDWGEAAEAEDLGYGGGQGPLDQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEPA
FT                   DVFCITCKTPVRTVEKDFDTHKEHEVTPISKALEHAKDEVHKNMCKLEQQIIEMENFAS
FT                   HLEEVFITVEENFGRQEQNFECHYNGILETLAQKYEEKIQALGEKKREKLEALYGQLVS
FT                   CGENLDACRELMETVEEMCHEEKVEFLKDAVAMTDRLGKFLKTKTDVELSAQPEFEDQT
FT                   LDFSDVEQLMDAINTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPV
FT                   QDSSSGKDRAEFTMMVKETYCSVTNLEPNTQYEFWVIAQNRTGPSPCSEHAVYMTAPSP
FT                   PSIKTEAIRSCEEAVLICWESGNLNPVDSYTVELIQAETPEASGVTESVVGIPTCESLI
FT                   QLQPRHSYTIYVRALNVGGTSARSEPATVHTTGSYFQLNKDTCHPWLTISEDGFTVVRS
FT                   EKKSFRKELPPSKTQFTRCVAVMGNLIPVRGRHYWEVEVAEHLDYTVGVACEDVPKQED
FT                   LGANSLSWCMRHTFVSKRIHSKGVQVMPSTHL"
FT   gap             18958359..18958378
FT                   /estimated_length=20
FT   gap             18975242..18979148
FT                   /estimated_length=3907
FT   gene            18988079..19013406
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /note="gene_id=mCG15314.2"
FT   mRNA            join(18988079..18988229,18988407..18988709,
FT                   18991344..18991517,18994947..>18995025)
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, transcript variant mCT175206"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT175206.0 created
FT                   on 08-NOV-2002"
FT   mRNA            join(18988080..18988709,18991344..18991517,
FT                   18994947..18995097,19001837..19002006,19002869..19003034,
FT                   19006079..19006266,19008556..19008642,19008801..19008896,
FT                   19010494..19010944,19012702..19013406)
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, transcript variant mCT15823"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT15823.2 created
FT                   on 08-NOV-2002"
FT   CDS             join(18988122..18988709,18991344..18991517,
FT                   18994947..18995097,19001837..19002006,19002869..19003034,
FT                   19006079..19006266,19008556..19008642,19008801..19008896,
FT                   19010494..19010944,19012702..19012760)
FT                   /codon_start=1
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT15823.2
FT                   protein_id=mCP7361.2 isoform=CRA_a partial"
FT                   /protein_id="EDL06932.1"
FT                   /translation="MDSEQPDSLDGWVPLREDLFPEPERHQLRFLVAWNAAKGQFAVTC
FT                   HDRTAQRRRRERREAGDGGCSWAGVLSPAGFRGAHRQLAALWPALEPCFPPLPPELDAA
FT                   SGAGWGLGRGLWALLWPLLWPAPADPGDSALQELCRQLEHYLGLAAEGCGGATVRDVLF
FT                   PAPGDSADCEGLSEFRERTLRARLGQTATRLHQVLQDHGKANTMVALMKVYQEEDELYQ
FT                   ELVTMATTFFQYLLQPFRDMREVATSCKLGILKSLDEDELGPRRVAALQKEASEWTRQA
FT                   EEAVGSIQDITVNYFKETVTALTGMQKQMEQDQKRFGQAAWATAMPRLENLKLMLARET
FT                   LQLMRAKELCLKHRQAEIQRKVEDLPRQGKQLDVVDELEIQCYEIQLELYDVKLEMLRN
FT                   EEIILVTRLDSVKRLITEKQAEVIYYDPCESPEELQSLAPDLELHLGDNRELRALSQQC
FT                   QRLEAQRGRICSRRALLRNRKDHCRENHQLRLQQAKQSLRHLHQHHSIQMKRDKVKEEE
FT                   QKKKEWIDHERQKTLERLRAYKEKCPAHRSALKTTCSESMVSNLPGGRSQKRLSTAHHH
FT                   KTAHPASSKTGSAVPLPEASVRPPEHQDPCGSVPVQAFVPVSDQTLSGSSEDLSLPPQX
FT                   XXXXXXPPPPLPPALSSFQGTTHQNLGLRTLATEDRPLPLACDPSAGRPCDYQGPALWM
FT                   KCWPLSGRAKPLSGK"
FT   CDS             join(18988122..18988229,18988407..18988709,
FT                   18991344..18991517,18994947..>18995025)
FT                   /codon_start=1
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT175206.0
FT                   protein_id=mCP98126.0 isoform=CRA_b"
FT                   /protein_id="EDL06933.1"
FT                   /translation="MDSEQPDSLDGWVPLREDLFPEPERHQLRFLVAWNAPLPPELDAA
FT                   SGAGWGLGRGLWALLWPLLWPAPADPGDSALQELCRQLEHYLGLAAEGCGGATVRDVLF
FT                   PAPGDSADCEGLSEFRERTLRARLGQTATRLHQVLQDHGKANTMVALMKVYQEEDELYQ
FT                   ELVTMATTFFQYLLQPFRDMREVATSCKLGILKSLDEDELGPRRVAALQKEASEWTRQ"
FT   mRNA            join(<18988530..18988709,18991344..18991517,
FT                   19001837..19002006,19002869..19003040)
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, transcript variant mCT175207"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT175207.0 created
FT                   on 08-NOV-2002"
FT   CDS             join(<18988530..18988709,18991344..18991517,
FT                   19001837..19001911)
FT                   /codon_start=1
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT175207.0
FT                   protein_id=mCP98125.0 isoform=CRA_d"
FT                   /protein_id="EDL06935.1"
FT                   /translation="ELCRQLEHYLGLAAEGCGGATVRDVLFPAPGDSADCEGLSEFRER
FT                   TLRARLGQTATRLHQVLQDHGKANTMVALMKVYQEEDELYQELVTMATTFFQYLLQPFR
FT                   DMREVATSCKLGILECRNKWSRIRRDLARLPGPQPCPG"
FT   mRNA            join(<18988744..18988824,18991344..18991517,
FT                   18994947..18995097,19001837..19002006,19002869..19003034,
FT                   19006079..19006266,19008556..19008642,19008801..19008896,
FT                   19010494..19010560,19010837..19010944,19012701..19013293)
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, transcript variant mCT189938"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT189938.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<18988819..18988824,18991344..18991517,
FT                   18994947..18995097,19001837..19002006,19002869..19003034,
FT                   19006079..19006266,19008556..19008642,19008801..19008896,
FT                   19010494..19010560,19010837..19010944,19012701..19012993)
FT                   /codon_start=1
FT                   /gene="Whdc1"
FT                   /locus_tag="mCG_15314"
FT                   /product="WAS protein homology region 2 domain containing
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG15314.2 transcript_id=mCT189938.0
FT                   protein_id=mCP110918.0 isoform=CRA_c"
FT                   /protein_id="EDL06934.1"
FT                   /translation="NTVLQDHGKANTMVALMKVYQEEDELYQELVTMATTFFQYLLQPF
FT                   RDMREVATSCKLGILKSLDEDELGPRRVAALQKEASEWTRQAEEAVGSIQDITVNYFKE
FT                   TVTALTGMQKQMEQDQKRFGQAAWATAMPRLENLKLMLARETLQLMRAKELCLKHRQAE
FT                   IQRKVEDLPRQGKQLDVVDELEIQCYEIQLELYDVKLEMLRNEEIILVTRLDSVKRLIT
FT                   EKQAEVIYYDPCESPEELQSLAPDLELHLGDNRELRALSQQCQRLEAQRGRICSRRALL
FT                   RNRKDHCRENHQLRLQQAKQSLRHLHQHHSIQMKRDKVKEEEQKKKEWIDHERQKTLER
FT                   LRAYKEKCPAHRSALKTTCSESMVSNLPGTTHQNLGLRTLATEDRPLPLACDPSAGRPC
FT                   DYQGPGSMDEVLASLRQGKASLRKVETPTLPHPGTSVNEQVLAAIRQGVQLKKVHTGQG
FT                   VDPGKKSTSDLERSIREALERIKKVSADSEEDNDEPSPTEWDR"
FT   gap             18997888..18998079
FT                   /estimated_length=192
FT   gap             19010777..19010796
FT                   /estimated_length=20
FT   gap             19013408..19013447
FT                   /estimated_length=40
FT   gap             19022238..19022257
FT                   /estimated_length=20
FT   gene            complement(19026202..>19068139)
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /note="gene_id=mCG15300.2"
FT   mRNA            complement(join(19026202..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..19035514,
FT                   19041117..19041209,19054653..19054784,19067983..>19068139))
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), transcript variant
FT                   mCT15487"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT15487.2 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(19026591..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..>19035737))
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), transcript variant
FT                   mCT174593"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174593.0 created
FT                   on 17-OCT-2002"
FT   mRNA            complement(join(19026985..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..19035547,
FT                   19041117..19041209,19054653..19054784,19067983..>19068139))
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), transcript variant
FT                   mCT174591"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174591.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(19027114..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..19035514,
FT                   19041117..19041209,19054653..19054784,19067983..>19068138))
FT                   /codon_start=1
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT15487.2
FT                   protein_id=mCP7301.2 isoform=CRA_d"
FT                   /protein_id="EDL06931.1"
FT                   /translation="EQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRI
FT                   ISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEV
FT                   REAARLARDKSQEKTETSSNHSQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQS
FT                   AANVKKWEMELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQ
FT                   CSEINREKEKNTQLKRRIEELESEVRDKEMELKDLRKQSEIIPQLMSECEYVSEKLEAA
FT                   ERDNQNLEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTD
FT                   N"
FT   CDS             complement(join(19027114..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..19035547,
FT                   19041117..19041209,19054653..19054784,19067983..>19068039))
FT                   /codon_start=1
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174591.0
FT                   protein_id=mCP97510.0 isoform=CRA_a"
FT                   /protein_id="EDL06928.1"
FT                   /translation="YFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADS
FT                   RANTVFGLGFSSELQLTKFAEKFQEVREAARLARDKSQEKTETSSNHSQESGCETPSST
FT                   QASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEMELQTLRESNARLT
FT                   TALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCSEINREKEKNTQLKRRIEELE
FT                   SEVRDKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESK
FT                   YRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN"
FT   CDS             complement(join(19027114..19027302,19028167..19028247,
FT                   19029122..19029232,19031204..19031360,19035408..>19035574))
FT                   /codon_start=1
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174593.0
FT                   protein_id=mCP97512.0 isoform=CRA_c"
FT                   /protein_id="EDL06930.1"
FT                   /translation="HVKIIHFGQESGCETPSSTQASSVNGTDDEKASHASPADTHLKSE
FT                   NDKLKIALTQSAANVKKWEMELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDR
FT                   LRSKIEELEEQCSEINREKEKNTQLKRRIEELESEVRDKEMELKDLRKQSEIIPQLMSE
FT                   CEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHD
FT                   FRRGLSKLGTDN"
FT   mRNA            complement(join(19035540..19035586,19041117..19041209,
FT                   19054653..19054784,19067983..>19068139))
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), transcript variant
FT                   mCT174592"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174592.0 created
FT                   on 17-OCT-2002"
FT   CDS             complement(join(19035575..19035586,19041117..19041209,
FT                   19054653..19054784,19067983..>19068138))
FT                   /codon_start=1
FT                   /gene="Homer2"
FT                   /locus_tag="mCG_15300"
FT                   /product="homer homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG15300.2 transcript_id=mCT174592.0
FT                   protein_id=mCP97511.0 isoform=CRA_b"
FT                   /protein_id="EDL06929.1"
FT                   /translation="EQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRI
FT                   ISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEV
FT                   REAARLARDKSQEKTETSSNHSQDKQ"
FT   gap             19049877..19051641
FT                   /estimated_length=1765
FT   gap             19052715..19053047
FT                   /estimated_length=333
FT   gap             19062601..19062680
FT                   /estimated_length=80
FT   gap             19068368..19068399
FT                   /estimated_length=32
FT   gap             19069432..19069457
FT                   /estimated_length=26
FT   gap             19074221..19074512
FT                   /estimated_length=292
FT   gap             19077388..19077433
FT                   /estimated_length=46
FT   gap             19082743..19083721
FT                   /estimated_length=979
FT   gap             19084828..19084847
FT                   /estimated_length=20
FT   gap             19114039..19114129
FT                   /estimated_length=91
FT   gap             19125807..19126263
FT                   /estimated_length=457
FT   gene            19182064..19188604
FT                   /locus_tag="mCG_9455"
FT                   /note="gene_id=mCG9455.1"
FT   mRNA            join(19182064..19182167,19186639..19186835,
FT                   19187481..19188604)
FT                   /locus_tag="mCG_9455"
FT                   /product="mCG9455, transcript variant mCT9321"
FT                   /note="gene_id=mCG9455.1 transcript_id=mCT9321.1 created on
FT                   17-OCT-2002"
FT   mRNA            join(19182396..19182475,19186639..19186835,
FT                   19187481..19187819)
FT                   /locus_tag="mCG_9455"
FT                   /product="mCG9455, transcript variant mCT174608"
FT                   /note="gene_id=mCG9455.1 transcript_id=mCT174608.0 created
FT                   on 17-OCT-2002"
FT   CDS             join(19186666..19186835,19187481..19187670)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9455"
FT                   /product="mCG9455, isoform CRA_a"
FT                   /note="gene_id=mCG9455.1 transcript_id=mCT174608.0
FT                   protein_id=mCP97527.0 isoform=CRA_a"
FT                   /protein_id="EDL06926.1"
FT                   /translation="MSDTSEEIPNFEEMFASRFTKDDKEYQEYLKRPPESPPIVEEWNS
FT                   RAGGNQRNRGNWLQDNRQFRGRDNRRGWPSDNRSNQWHGRSWGNNNYPQQRPEPYYQQQ
FT                   YTQYGHNQRPPYGYY"
FT   CDS             join(19186666..19186835,19187481..19187670)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9455"
FT                   /product="mCG9455, isoform CRA_a"
FT                   /note="gene_id=mCG9455.1 transcript_id=mCT9321.1
FT                   protein_id=mCP7358.1 isoform=CRA_a"
FT                   /protein_id="EDL06927.1"
FT                   /translation="MSDTSEEIPNFEEMFASRFTKDDKEYQEYLKRPPESPPIVEEWNS
FT                   RAGGNQRNRGNWLQDNRQFRGRDNRRGWPSDNRSNQWHGRSWGNNNYPQQRPEPYYQQQ
FT                   YTQYGHNQRPPYGYY"
FT   gene            complement(19199402..19208539)
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /note="gene_id=mCG9453.3"
FT   mRNA            complement(join(19199402..19199683,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208425..19208518))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT172353"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172353.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(19199402..19199683,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208429..19208508))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT177653"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177653.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(19199402..19199683,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208031..19208183))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT177654"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177654.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(19199406..19199683,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208326..19208539))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT172354"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172354.2 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(19199498..19199683,19202136..19202138))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_a"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172353.1
FT                   protein_id=mCP95272.2 isoform=CRA_a"
FT                   /protein_id="EDL06919.1"
FT                   /translation="MRETHQRTSAGILAAARGFHSLIPVGGALQFLLDQVTATDLVFCQ
FT                   WTRLLTTKIGIAPKNYF"
FT   CDS             complement(join(19199498..19199683,19202136..19202138))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_a"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177654.1
FT                   protein_id=mCP100575.1 isoform=CRA_a"
FT                   /protein_id="EDL06923.1"
FT                   /translation="MRETHQRTSAGILAAARGFHSLIPVGGALQFLLDQVTATDLVFCQ
FT                   WTRLLTTKIGIAPKNYF"
FT   mRNA            complement(join(19201107..19201694,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208429..19208537))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT9319"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT9319.2 created on
FT                   10-JUN-2003"
FT   mRNA            complement(join(19201107..19201694,19202136..19202243,
FT                   19205151..19205278,19207524..19207650,19208502..19208522))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT177655"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177655.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(19201107..19201694,19202136..19202243,
FT                   19205151..19205242,19207524..19207650,19208429..19208518))
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, transcript variant
FT                   mCT172355"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172355.1 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(19202148..19202243,19205151..19205242,
FT                   19207524..19207650,19208429..19208458))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_c"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172355.1
FT                   protein_id=mCP95274.1 isoform=CRA_c"
FT                   /protein_id="EDL06921.1"
FT                   /translation="MPKKAGATSKGKNQTKEPETAPPAAGPVATDPKGFVTIAIHAKPG
FT                   SRQNAVTAPPSQGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVL
FT                   EKLKTEAEKK"
FT   CDS             complement(join(19202148..19202243,19205151..19205278,
FT                   19207524..19207650,19208429..19208458))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_d"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177653.1
FT                   protein_id=mCP100577.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3TDI7"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="MGI:MGI:1914540"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDI7"
FT                   /protein_id="EDL06922.1"
FT                   /translation="MPKKAGATSKGKNQTKEPETAPPAAGPVATDPKGFVTIAIHAKPG
FT                   SRQNAVTDLSTEAVGVAIAAPPSQGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVV
FT                   KLLASTTPEEVLEKLKTEAEKK"
FT   CDS             complement(join(19202148..19202243,19205151..19205278,
FT                   19207524..19207650,19208429..19208458))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_d"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT9319.2
FT                   protein_id=mCP7302.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3TDI7"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="MGI:MGI:1914540"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDI7"
FT                   /protein_id="EDL06924.1"
FT                   /translation="MPKKAGATSKGKNQTKEPETAPPAAGPVATDPKGFVTIAIHAKPG
FT                   SRQNAVTDLSTEAVGVAIAAPPSQGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVV
FT                   KLLASTTPEEVLEKLKTEAEKK"
FT   CDS             complement(join(19202216..19202243,19205151..19205218))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_e"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT177655.1
FT                   protein_id=mCP100576.0 isoform=CRA_e"
FT                   /protein_id="EDL06925.1"
FT                   /translation="MRSCVGTSPRSWTSGRVTWFWIRVVNLGKRW"
FT   CDS             complement(join(19207646..19207650,19208326..19208458))
FT                   /codon_start=1
FT                   /gene="3110040N11Rik"
FT                   /locus_tag="mCG_9453"
FT                   /product="RIKEN cDNA 3110040N11, isoform CRA_b"
FT                   /note="gene_id=mCG9453.3 transcript_id=mCT172354.2
FT                   protein_id=mCP95273.1 isoform=CRA_b"
FT                   /db_xref="GOA:D6RIL2"
FT                   /db_xref="MGI:MGI:1914540"
FT                   /db_xref="UniProtKB/TrEMBL:D6RIL2"
FT                   /protein_id="EDL06920.1"
FT                   /translation="MPKKAGATSKASGKPRVVERVGHGATLAGNRRSAWRAEDLPSGPG
FT                   "
FT   gene            complement(19211149..>19248940)
FT                   /gene="Btbd1"
FT                   /locus_tag="mCG_114660"
FT                   /note="gene_id=mCG114660.1"
FT   mRNA            complement(join(19211149..19212800,19213232..19213378,
FT                   19216073..19216160,19220034..19220226,19224952..19225149,
FT                   19235124..19235229,19237404..19237560,19248609..>19248940))
FT                   /gene="Btbd1"
FT                   /locus_tag="mCG_114660"
FT                   /product="BTB (POZ) domain containing 1"
FT                   /note="gene_id=mCG114660.1 transcript_id=mCT115758.1
FT                   created on 30-OCT-2002"
FT   CDS             complement(join(19212642..19212800,19213232..19213378,
FT                   19216073..19216160,19220034..19220226,19224952..19225149,
FT                   19235124..19235229,19237404..19237560,19248609..>19248940))
FT                   /codon_start=1
FT                   /gene="Btbd1"
FT                   /locus_tag="mCG_114660"
FT                   /product="BTB (POZ) domain containing 1"
FT                   /note="gene_id=mCG114660.1 transcript_id=mCT115758.1
FT                   protein_id=mCP88865.1"
FT                   /protein_id="EDL06918.1"
FT                   /translation="PPPPAPSPSALGPLLPLQREPLYNWQATKASLKERFAFLFNSELL
FT                   SDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPA
FT                   AFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQ
FT                   ARLFDEPQLASLCLDTIDKSTVDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAIV
FT                   RWAEAECQRQQLAVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREVVNLF
FT                   LHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDRIRFTVNRRISVVG
FT                   FGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVC
FT                   YTACATLKGPDSHYGTKGLKKVVHETPAASKTVFLFFSSPGNNNGTSIEDGQIPEIIFY
FT                   T"
FT   gap             19222237..19222636
FT                   /estimated_length=400
FT   gap             19239436..19241524
FT                   /estimated_length=2089
FT   gap             19244094..19244192
FT                   /estimated_length=99
FT   gap             19248941..19249129
FT                   /estimated_length=189
FT   gene            19262961..19304692
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /note="gene_id=mCG9447.2"
FT   mRNA            join(19262961..19263079,19266843..19266963,
FT                   19282843..19282946,19284938..19285035,19288332..19288435,
FT                   19290387..19290469,19291059..19291180,19293422..19293526,
FT                   19295435..19295527,19295686..19295805,19302924..19304692)
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, transcript
FT                   variant mCT185524"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185524.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(19278688..19279229,19282843..19282946,
FT                   19284938..19285035,19288332..19288435,19290387..19290469,
FT                   19291059..19293190)
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, transcript
FT                   variant mCT185525"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185525.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(19278767..19279229,19282843..19282946,
FT                   19284938..19285035,19288332..19288435,19290387..19290469,
FT                   19291059..19291180,19293422..19293526,19295435..19295527,
FT                   19295686..19295805,19302924..19304692)
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, transcript
FT                   variant mCT9313"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT9313.1 created on
FT                   10-JUN-2003"
FT   CDS             join(19279138..19279229,19282843..19282946,
FT                   19284938..19285035,19288332..19288435,19290387..19290469,
FT                   19291059..19291180,19293422..19293526,19295435..19295527,
FT                   19295686..19295805,19302924..19303115)
FT                   /codon_start=1
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT9313.1
FT                   protein_id=mCP7238.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3TA39"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="MGI:MGI:1933209"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TA39"
FT                   /protein_id="EDL06917.1"
FT                   /translation="MSASAATGVFVLSLSAIPVTYIFNHLAAQHDSWTIVGVAALILLL
FT                   VALLARVLVRRKPPRDPLFYVYAVFGFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLN
FT                   TAYGHMICYWDGSVHYLMYLVMVAAIAWEESYRTIGLYWVGSIIMSIVVFVPGNIVGKY
FT                   GTRICPAFFLSIPYTCLPVWAGFRIYNQPSENYNYPSKVLQEAQAKALLRRPFDLVLVV
FT                   CLFLATGFCLFRGLIALDCPAELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFVI
FT                   ALYGLVVPGCSWMPDITLVHAGGLAQAQFSHIGASLHARTAYVYRVPEEAKIFFLALNI
FT                   AYGVLPQLLAYRCTYNPEFFLRTKADEKLE"
FT   CDS             join(19279138..19279229,19282843..19282946,
FT                   19284938..19285035,19288332..19288435,19290387..19290469,
FT                   19291059..19291339)
FT                   /codon_start=1
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185525.0
FT                   protein_id=mCP106781.0 isoform=CRA_c"
FT                   /protein_id="EDL06916.1"
FT                   /translation="MSASAATGVFVLSLSAIPVTYIFNHLAAQHDSWTIVGVAALILLL
FT                   VALLARVLVRRKPPRDPLFYVYAVFGFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLN
FT                   TAYGHMICYWDGSVHYLMYLVMVAAIAWEESYRTIGLYWVGSIIMSIVVFVPGNIVGKY
FT                   GTRICPAFFLSIPYTCLPVWAGFRIYNQPSENYNYPSKVILLHLDLSTVKISVLACELR
FT                   LALQQLLCLTYSQPRRAHSHLLGGEAHLGLY"
FT   mRNA            join(19282379..19282411,19282843..19282946,
FT                   19284938..19285035,19288332..19288435,19290387..19290469,
FT                   19291059..19291180,19293422..19293526,19295435..19295527,
FT                   19295686..19295805,19302924..19304692)
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, transcript
FT                   variant mCT175218"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT175218.1 created
FT                   on 10-JUN-2003"
FT   CDS             join(19285015..19285035,19288332..19288435,
FT                   19290387..19290469,19291059..19291180,19293422..19293526,
FT                   19295435..19295527,19295686..19295805,19302924..19303115)
FT                   /codon_start=1
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT175218.1
FT                   protein_id=mCP98137.1 isoform=CRA_a"
FT                   /protein_id="EDL06913.1"
FT                   /translation="MTHYLREGEPYLNTAYGHMICYWDGSVHYLMYLVMVAAIAWEESY
FT                   RTIGLYWVGSIIMSIVVFVPGNIVGKYGTRICPAFFLSIPYTCLPVWAGFRIYNQPSEN
FT                   YNYPSKVLQEAQAKALLRRPFDLVLVVCLFLATGFCLFRGLIALDCPAELCRLYTQFQE
FT                   PYLKDPAAYPKIQMLAYMFYSVPYFVIALYGLVVPGCSWMPDITLVHAGGLAQAQFSHI
FT                   GASLHARTAYVYRVPEEAKIFFLALNIAYGVLPQLLAYRCTYNPEFFLRTKADEKLE"
FT   CDS             join(19285015..19285035,19288332..19288435,
FT                   19290387..19290469,19291059..19291180,19293422..19293526,
FT                   19295435..19295527,19295686..19295805,19302924..19303115)
FT                   /codon_start=1
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185524.0
FT                   protein_id=mCP106782.0 isoform=CRA_a"
FT                   /protein_id="EDL06915.1"
FT                   /translation="MTHYLREGEPYLNTAYGHMICYWDGSVHYLMYLVMVAAIAWEESY
FT                   RTIGLYWVGSIIMSIVVFVPGNIVGKYGTRICPAFFLSIPYTCLPVWAGFRIYNQPSEN
FT                   YNYPSKVLQEAQAKALLRRPFDLVLVVCLFLATGFCLFRGLIALDCPAELCRLYTQFQE
FT                   PYLKDPAAYPKIQMLAYMFYSVPYFVIALYGLVVPGCSWMPDITLVHAGGLAQAQFSHI
FT                   GASLHARTAYVYRVPEEAKIFFLALNIAYGVLPQLLAYRCTYNPEFFLRTKADEKLE"
FT   mRNA            join(19293183..19293526,19295435..19295527,
FT                   19295686..19295805,19302924..19304692)
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, transcript
FT                   variant mCT185523"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185523.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(19295686..19295805,19302924..19303115)
FT                   /codon_start=1
FT                   /gene="Tm6sf1"
FT                   /locus_tag="mCG_9447"
FT                   /product="transmembrane 6 superfamily member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9447.2 transcript_id=mCT185523.0
FT                   protein_id=mCP106783.0 isoform=CRA_b"
FT                   /protein_id="EDL06914.1"
FT                   /translation="MLAYMFYSVPYFVIALYGLVVPGCSWMPDITLVHAGGLAQAQFSH
FT                   IGASLHARTAYVYRVPEEAKIFFLALNIAYGVLPQLLAYRCTYNPEFFLRTKADEKLE"
FT   gene            complement(19302913..>19355538)
FT                   /gene="Hdgfrp3"
FT                   /locus_tag="mCG_9451"
FT                   /note="gene_id=mCG9451.3"
FT   mRNA            complement(join(19302913..19305797,19315418..19315564,
FT                   19321279..19321434,19321890..19322028,19327176..19327252,
FT                   19355348..>19355538))
FT                   /gene="Hdgfrp3"
FT                   /locus_tag="mCG_9451"
FT                   /product="hepatoma-derived growth factor, related protein
FT                   3, transcript variant mCT9317"
FT                   /note="gene_id=mCG9451.3 transcript_id=mCT9317.2 created on
FT                   10-JUN-2003"
FT   mRNA            complement(join(19303474..19305797,19321279..19321434,
FT                   19321890..19322028,19327176..19327253,19355345..>19355524))
FT                   /gene="Hdgfrp3"
FT                   /locus_tag="mCG_9451"
FT                   /product="hepatoma-derived growth factor, related protein
FT                   3, transcript variant mCT185683"
FT                   /note="gene_id=mCG9451.3 transcript_id=mCT185683.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(19305792..19305797,19321279..19321434,
FT                   19321890..19322028,19327176..>19327252))
FT                   /codon_start=1
FT                   /gene="Hdgfrp3"
FT                   /locus_tag="mCG_9451"
FT                   /product="hepatoma-derived growth factor, related protein
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG9451.3 transcript_id=mCT185683.0
FT                   protein_id=mCP106941.0 isoform=CRA_b"
FT                   /protein_id="EDL06912.1"
FT                   /translation="IDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFG
FT                   KSNKRKGFNEGLWEIENNPGVKFTGYQTIQQQSSSETEGEGGNTADASSEEEGDRVEDG
FT                   KGKRKNEKGGSKRKKSYTSKT"
FT   CDS             complement(join(19305792..19305797,19315418..19315564,
FT                   19321279..19321434,19321890..19322028,19327176..>19327243))
FT                   /codon_start=1
FT                   /gene="Hdgfrp3"
FT                   /locus_tag="mCG_9451"
FT                   /product="hepatoma-derived growth factor, related protein
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG9451.3 transcript_id=mCT9317.2
FT                   protein_id=mCP7297.2 isoform=CRA_a"
FT                   /protein_id="EDL06911.1"
FT                   /translation="LPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSN
FT                   KRKGFNEGLWEIENNPGVKFTGYQTIQQQSSSETEGEGGNTADASSEEEGDRVEDGKGK
FT                   RKNEKGGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTAD
FT                   LQKAGEGT"
FT   gap             19312126..19312145
FT                   /estimated_length=20
FT   gap             19313611..19313630
FT                   /estimated_length=20
FT   gap             19314654..19314673
FT                   /estimated_length=20
FT   gap             19337687..19337706
FT                   /estimated_length=20
FT   gap             19349685..19349964
FT                   /estimated_length=280
FT   gap             19354945..19355344
FT                   /estimated_length=400
FT   gene            complement(19387074..19412709)
FT                   /gene="Bnc1"
FT                   /locus_tag="mCG_9457"
FT                   /note="gene_id=mCG9457.1"
FT   mRNA            complement(join(19387074..19389439,19393594..19395449,
FT                   19397615..19397850,19398824..19398923,19412608..19412709))
FT                   /gene="Bnc1"
FT                   /locus_tag="mCG_9457"
FT                   /product="basonuclin 1"
FT                   /note="gene_id=mCG9457.1 transcript_id=mCT9323.1 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(19388755..19389439,19393594..19395449,
FT                   19397615..19397850,19398824..19398923,19412608..19412703))
FT                   /codon_start=1
FT                   /gene="Bnc1"
FT                   /locus_tag="mCG_9457"
FT                   /product="basonuclin 1"
FT                   /note="gene_id=mCG9457.1 transcript_id=mCT9323.1
FT                   protein_id=mCP7362.2"
FT                   /protein_id="EDL06910.1"
FT                   /translation="MRRSPSRGGRGAARAGDARREGRLRSGCRMAEAIGCTLNCSCQCF
FT                   KPGKINHRQCEQCRHGWVAHALSKLRIPPVYPTSQVEIVQSNVVFDISSLMLYGTQAIP
FT                   VRLKILLDRLFSVLKQDEVLQILHALDWTLQDYIRGYVLQDASGKVLDHWSIMTSEEEV
FT                   ATLQQFLRFGETKSIVELMAIQEKEEQSVIVPPTTANVDIRAFIESCGHRSASLPTPVD
FT                   KGSPGGMHPFENLISNMTFMLPFQFFNPLPPALIGSLPEQYMLEQGQDQSQEPKQELHG
FT                   PFSDSSFLTSTPFQVEKEQCLNCPETVPQKEDSAHLSDSSSYSIASKLERTQLSPEAKV
FT                   KPERNSLSAKKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSR
FT                   NRHSANPNPRLHMPMNRNNRDKDLRNSLNLASSETYKRPGFTVVSPDCGPLPGYTGSVE
FT                   DSKGQPAFSSIGQNGVLFPNLKTVQPVLPFYRSPATPAELANTPGMLPSLPLLSSSIPE
FT                   QLVSTDMPFDALPKKKSRKSSMPIKIEKEAVEIAEEKRHSLSSDDEVPLQVVSEDEPED
FT                   SSPRSDRVPEEQHTQLSLEEPLPQGERACHLESVIESHGALSRTLEQTTLTEREAEQKV
FT                   ALSSVMPREVEDGGHERHFTAGLVPQIPFPDYMELQQRLLAGGLFGALSNRGMAFPFLE
FT                   ESKELEHLGEHALVRQKEEARFQCDICKKTFKNACSMKTHEKNTHARETHACTVEGCGA
FT                   AFPSRRSRDRHSSNLSLHQKVLNEEALETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQ
FT                   TSVIFKGTSGMGSLVYPISQVHSASLESYNSGPPSEGTILDLSTTSSMKSESSSHSSWD
FT                   SDGVSEEGTALMEDSDGNCEGQSLVSGEDEYPLCVLMEKADQSLASLPSGLPITCHLCQ
FT                   KIYSNKGTFRAHYKTVHLRQLHKCKVPGCNTMFSSVRSRNRHSQNPNLHKSLASSPSHL
FT                   Q"
FT   gap             19416902..19416926
FT                   /estimated_length=25
FT   gap             19426947..19426966
FT                   /estimated_length=20
FT   gap             19442748..19442767
FT                   /estimated_length=20
FT   gap             19475555..19476041
FT                   /estimated_length=487
FT   gap             19485138..19485157
FT                   /estimated_length=20
FT   gene            19490335..19502035
FT                   /locus_tag="mCG_140937"
FT                   /note="gene_id=mCG140937.1"
FT   mRNA            join(19490335..19490459,19491284..19491444,
FT                   19496242..19496310,19499445..19500611,19500934..19502035)
FT                   /locus_tag="mCG_140937"
FT                   /product="mCG140937"
FT                   /note="gene_id=mCG140937.1 transcript_id=mCT172356.1
FT                   created on 17-JUN-2003"
FT   CDS             join(19496242..19496310,19499445..19499534)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140937"
FT                   /product="mCG140937"
FT                   /note="gene_id=mCG140937.1 transcript_id=mCT172356.1
FT                   protein_id=mCP95275.0"
FT                   /protein_id="EDL06909.1"
FT                   /translation="MSAPLTGRSPVSSVEGEGISAYEKQLHLGRTFWRSLTLAIVCKCE
FT                   PEKHKVD"
FT   gap             19510960..19510979
FT                   /estimated_length=20
FT   gap             19512401..19512420
FT                   /estimated_length=20
FT   gap             19562881..19563227
FT                   /estimated_length=347
FT   gene            19591014..19722930
FT                   /gene="Sh3gl3"
FT                   /locus_tag="mCG_9450"
FT                   /note="gene_id=mCG9450.2"
FT   mRNA            join(19591014..19591176,19674811..19674879,
FT                   19682938..19683010,19685438..19685483,19688477..19688509,
FT                   19690648..19690806,19698609..19698712,19699577..19699686,
FT                   19722307..19722930)
FT                   /gene="Sh3gl3"
FT                   /locus_tag="mCG_9450"
FT                   /product="SH3-domain GRB2-like 3, transcript variant
FT                   mCT172352"
FT                   /note="gene_id=mCG9450.2 transcript_id=mCT172352.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(19591020..19591176,19674811..19674879,
FT                   19682938..19683010,19685431..19685574,19688376..19688509,
FT                   19690648..19690806,19698609..19698712,19699577..19699686,
FT                   19722307..19722927)
FT                   /gene="Sh3gl3"
FT                   /locus_tag="mCG_9450"
FT                   /product="SH3-domain GRB2-like 3, transcript variant
FT                   mCT9316"
FT                   /note="gene_id=mCG9450.2 transcript_id=mCT9316.2 created on
FT                   29-OCT-2002"
FT   CDS             join(19591135..19591176,19674811..19674879,
FT                   19682938..19683010,19685431..19685574,19688376..19688509,
FT                   19690648..19690806,19698609..19698712,19699577..19699686,
FT                   19722307..19722512)
FT                   /codon_start=1
FT                   /gene="Sh3gl3"
FT                   /locus_tag="mCG_9450"
FT                   /product="SH3-domain GRB2-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG9450.2 transcript_id=mCT9316.2
FT                   protein_id=mCP7281.2 isoform=CRA_b"
FT                   /protein_id="EDL06908.1"
FT                   /translation="MSVAGLKKQFHKASLFSEKISGAEGTKLDEEFLNMEKKIDITSKA
FT                   VAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELG
FT                   EDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGR
FT                   RLDYDYKKRRVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAAL
FT                   DYHRQSTEILQELQSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSSKTPGTD
FT                   TPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEV
FT                   IVPLPP"
FT   CDS             join(19591135..19591176,19674811..19674879,
FT                   19682938..19683010,19685438..19685448)
FT                   /codon_start=1
FT                   /gene="Sh3gl3"
FT                   /locus_tag="mCG_9450"
FT                   /product="SH3-domain GRB2-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG9450.2 transcript_id=mCT172352.0
FT                   protein_id=mCP95271.0 isoform=CRA_a"
FT                   /protein_id="EDL06907.1"
FT                   /translation="MSVAGLKKQFHKASLFSEKISGAEGTKLDEEFLNMEKKIDITSKA
FT                   VAEILSKATEYLQPNPELS"
FT   gap             19591179..19591198
FT                   /estimated_length=20
FT   gap             19613063..19613082
FT                   /estimated_length=20
FT   gap             19625693..19625712
FT                   /estimated_length=20
FT   gap             19627304..19627323
FT                   /estimated_length=20
FT   gap             19630160..19636064
FT                   /estimated_length=5905
FT   gap             19639185..19639213
FT                   /estimated_length=29
FT   gap             19650946..19651316
FT                   /estimated_length=371
FT   gap             19651622..19651641
FT                   /estimated_length=20
FT   gap             19658275..19658319
FT                   /estimated_length=45
FT   gap             19665829..19665848
FT                   /estimated_length=20
FT   gap             19667784..19668600
FT                   /estimated_length=817
FT   gap             19672843..19672913
FT                   /estimated_length=71
FT   gap             19687981..19688000
FT                   /estimated_length=20
FT   gap             19693413..19693490
FT                   /estimated_length=78
FT   gap             19715398..19715417
FT                   /estimated_length=20
FT   gap             19717792..19717811
FT                   /estimated_length=20
FT   gap             19738190..19738209
FT                   /estimated_length=20
FT   gap             19748326..19748345
FT                   /estimated_length=20
FT   gene            19753557..20037121
FT                   /locus_tag="mCG_120998"
FT                   /note="gene_id=mCG120998.1"
FT   mRNA            join(19753557..19753773,19755049..19755150,
FT                   19757768..19757884,19797154..19797273,19826233..19826310,
FT                   19846032..19846159,19858029..19858074,19865613..19865849,
FT                   19881126..19881252,19902775..19902849,19909042..19909199,
FT                   19927136..19927247,19932877..19933015,19934146..19934196,
FT                   19935260..19935464,19940979..19941126,19942698..19942782,
FT                   19952435..19952724,19959985..19960114,19968884..19969076,
FT                   19969178..19969357,19989352..19989504,19996397..19996526,
FT                   19998929..19999057,20019675..20019857,20022382..20022498,
FT                   20026445..20026628,20028080..20028284,20030850..20030947,
FT                   20036110..20036338,20036840..20037121)
FT                   /locus_tag="mCG_120998"
FT                   /product="mCG120998, transcript variant mCT122192"
FT                   /note="gene_id=mCG120998.1 transcript_id=mCT122192.1
FT                   created on 22-OCT-2002"
FT   CDS             join(19753771..19753773,19755049..19755150,
FT                   19757768..19757884,19797154..19797273,19826233..19826310,
FT                   19846032..19846159,19858029..19858074,19865613..19865849,
FT                   19881126..19881252,19902775..19902849,19909042..19909199,
FT                   19927136..19927247,19932877..19933015,19934146..19934196,
FT                   19935260..19935464,19940979..19941126,19942698..19942782,
FT                   19952435..19952724,19959985..19960114,19968884..19969076,
FT                   19969178..19969357,19989352..19989504,19996397..19996526,
FT                   19998929..19999057,20019675..20019857,20022382..20022498,
FT                   20026445..20026628,20028080..20028284,20030850..20030947,
FT                   20036110..20036338,20036840..20036878)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120998"
FT                   /product="mCG120998, isoform CRA_b"
FT                   /note="gene_id=mCG120998.1 transcript_id=mCT122192.1
FT                   protein_id=mCP88904.1 isoform=CRA_b"
FT                   /protein_id="EDL06906.1"
FT                   /translation="MAVRETPMILDPMASWTGSWWLLTRMIFTVSGLLQDLMFLVKTAV
FT                   APLPCQASIVLTAVVLTEPLHLRNRSLWKATAEKSPGAYFLPEFALSPQGSFLEDTTGE
FT                   QFLTYRYDDQEINYSRLPLNYIPALPSRQPAEAGYKTSRNAHSEEDKDGNWDAWGDWSD
FT                   CSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSNHDCPADAEDFRAQQCSAYNDVQYQG
FT                   HYYEWIPLYNDPAAPCALKCHARGQSLVVELAPKVLDGTRCNADSLDMCISGICQIVGC
FT                   DRQLGSNAKEDNCGVCAGDGSTCRLVRGQTKMHLSPEKKEENVIAVPLGSRSVRITVKG
FT                   PALIFIESKTLQGSRGEHSFNSPGVFTVENTTIEFQKGADRQTFKIAGPLMADFIFKTR
FT                   YTVAKGSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNSAECMDIRLKRVVPDHYCH
FT                   YYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQR
FT                   RSFVCVEESMHAEILQVEEWKCMYAPKPTVMQTCNLFDCPKWVAMEWSQCTVTCGRGLR
FT                   YRVVLCINHRGQHVGGCNPQMKLHIKEECVIPIPCYKPREKSPVEAKLPWLKQAQELEE
FT                   TRIATEEPKFIPEPWSACSTTCGPGIQVREVRCRVLLTFTQTEAELPEEECEGPKPPTD
FT                   RPCLRQACDQSPVSRELGGRLQEKDSEMTYDWEYAGFTPCTATCLGGHQEAIAVCLHTQ
FT                   THQTVNDSLCDTVHRPPPMSQACNMEPCPPRWHMGSWGACSATCGVGIQTRDVYCLHPE
FT                   EFPAPPEECREEKPHALRACNQFDCPPSWHIEEWQQCSRTCGGGTQNRRVTCRQLLTDG
FT                   SFLNLSDELCQGPKASSHKSCARTDCPPQLAAGDWSKCSVTCGVGFQRRKQVCQKLTAK
FT                   GRRVSVAETLCRDLPGLPLVRPCQMPICSRIILDETGKMQIRNPTRKEQGIYECSVASH
FT                   LGSDVESSLVLYAEAPVILSIERNVTKPEHNHLSVVVGGTVEAALQANVTIHCPVKGVP
FT                   QPNVTWLKRGGSLSDNVSLLFNGSLLLQSASLENEGTYICTATNALGKAVATSGLRLLE
FT                   RREPGGKAAFPKVQKTRVLQAPRSRINSNNLTGKSLPQEHFWEPGNWTHCSATCGPLGF
FT                   RLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDCPARWFTSVWSECSVSCGEGFH
FT                   SRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQQAIDPGNQCPGRCMGHA
FT                   TRMQHHHTACSHNSSSSDCEDGRRPAFGRNCTLGPCEACWRVGPWKPCTAVCGRGFQSR
FT                   KVDCIHTGSCKIVADRYCVQVKPAAWRHCFGPSCDSTYPSQETARTQLTTVCS"
FT   gap             19765958..19766318
FT                   /estimated_length=361
FT   gap             19769681..19770233
FT                   /estimated_length=553
FT   gap             19781618..19781708
FT                   /estimated_length=91
FT   gap             19792618..19792687
FT                   /estimated_length=70
FT   gap             19814668..19814687
FT                   /estimated_length=20
FT   mRNA            join(<19826157..19826310,19846032..19846159,
FT                   19858029..19858074,19865613..19865849,19881126..19881406)
FT                   /locus_tag="mCG_120998"
FT                   /product="mCG120998, transcript variant mCT175191"
FT                   /note="gene_id=mCG120998.1 transcript_id=mCT175191.0
FT                   created on 22-OCT-2002"
FT   CDS             join(<19826233..19826310,19846032..19846159,
FT                   19858029..19858074,19865613..19865849,19881126..19881263)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120998"
FT                   /product="mCG120998, isoform CRA_a"
FT                   /note="gene_id=mCG120998.1 transcript_id=mCT175191.0
FT                   protein_id=mCP98110.0 isoform=CRA_a"
FT                   /protein_id="EDL06905.1"
FT                   /translation="EINYSRLPLNYIPALPSRQPAEAGYKTSRNAHSEEDKDGNWDAWG
FT                   DWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSNHDCPADAEDFRAQQCSAYNDV
FT                   QYQGHYYEWIPLYNDPAAPCALKCHARGQSLVVELAPKVLDGTRCNADSLDMCISGICQ
FT                   IVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQTKMHLSPEKSKC"
FT   gap             19830523..19830542
FT                   /estimated_length=20
FT   gap             19844376..19844611
FT                   /estimated_length=236
FT   gap             19849651..19849670
FT                   /estimated_length=20
FT   gap             19874386..19874405
FT                   /estimated_length=20
FT   gap             19892218..19892308
FT                   /estimated_length=91
FT   gap             19918167..19919693
FT                   /estimated_length=1527
FT   gap             19922448..19922467
FT                   /estimated_length=20
FT   gap             19934676..19934695
FT                   /estimated_length=20
FT   gap             19971856..19972026
FT                   /estimated_length=171
FT   gap             19973401..19975184
FT                   /estimated_length=1784
FT   gap             19976622..19976641
FT                   /estimated_length=20
FT   gap             19978011..19983522
FT                   /estimated_length=5512
FT   gap             19994983..19995893
FT                   /estimated_length=911
FT   gap             20001180..20001212
FT                   /estimated_length=33
FT   gap             20014666..20014685
FT                   /estimated_length=20
FT   gap             20017306..20017325
FT                   /estimated_length=20
FT   gap             20027027..20027353
FT                   /estimated_length=327
FT   gap             20045089..20045108
FT                   /estimated_length=20
FT   gap             20048730..20048749
FT                   /estimated_length=20
FT   gene            complement(20057424..20072997)
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /note="gene_id=mCG55934.3"
FT   mRNA            complement(join(20057424..20059871,20070129..20070308,
FT                   20072862..20072997))
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, transcript variant
FT                   mCT56117"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT56117.3 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(20057424..20059871,20072862..20072996))
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, transcript variant
FT                   mCT175215"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175215.1 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(20057424..20059871,20068126..20068328,
FT                   20072862..20072994))
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, transcript variant
FT                   mCT175214"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175214.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(20058928..20059871,20068126..20068328,
FT                   20072862..20072899))
FT                   /codon_start=1
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, isoform CRA_a"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175214.1
FT                   protein_id=mCP98136.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BQB6"
FT                   /db_xref="InterPro:IPR024963"
FT                   /db_xref="MGI:MGI:1914618"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BQB6"
FT                   /protein_id="EDL06900.1"
FT                   /translation="MRNWCLCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTY
FT                   KRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPD
FT                   VKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARP
FT                   KEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWE
FT                   IPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTT
FT                   KEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSS
FT                   VPLDDVTMYSIQFTPKKQEICPASYPSPPGYIFENTNSQGHKFFRKIIPAVKAF"
FT   CDS             complement(20058928..20059392)
FT                   /codon_start=1
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, isoform CRA_b"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175215.1
FT                   protein_id=mCP98134.1 isoform=CRA_b"
FT                   /protein_id="EDL06901.1"
FT                   /translation="MQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDF
FT                   PAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLD
FT                   DVTMYSIQFTPKKQEICPASYPSPPGYIFENTNSQGHKFFRKIIPAVKAF"
FT   CDS             complement(join(20059868..20059871,20070129..20070308,
FT                   20072862..20072899))
FT                   /codon_start=1
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, isoform CRA_e"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT56117.3
FT                   protein_id=mCP29981.3 isoform=CRA_e"
FT                   /protein_id="EDL06904.1"
FT                   /translation="MRNWCLCQICTCGRHRCPHGTTRVYEYSDVSCPTTEYLEKYPKYG
FT                   GVLPPQSLKPKQGFQAYRGKMEGITTFK"
FT   mRNA            complement(join(20066619..20068328,20070129..20070308,
FT                   20072862..20072995))
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, transcript variant
FT                   mCT175217"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175217.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(20068109..20068328,20070129..20070308,
FT                   20072862..20072899))
FT                   /codon_start=1
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, isoform CRA_d"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175217.1
FT                   protein_id=mCP98135.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q8CAI4"
FT                   /db_xref="InterPro:IPR024963"
FT                   /db_xref="MGI:MGI:1914618"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAI4"
FT                   /protein_id="EDL06903.1"
FT                   /translation="MRNWCLCQICTCGRHRCPHGTTRVYEYSDVSCPTTEYLEKYPKYG
FT                   GVLPPQSLKPKQGFQAYRGKMEGITTFKSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTT
FT                   YKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKGNLSL"
FT   mRNA            complement(join(20070661..20070939,20072862..20072993))
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, transcript variant
FT                   mCT175216"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175216.0 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(20070912..20070939,20072862..20072899))
FT                   /codon_start=1
FT                   /gene="1700129I04Rik"
FT                   /locus_tag="mCG_55934"
FT                   /product="RIKEN cDNA 1700129I04, isoform CRA_c"
FT                   /note="gene_id=mCG55934.3 transcript_id=mCT175216.0
FT                   protein_id=mCP98133.1 isoform=CRA_c"
FT                   /protein_id="EDL06902.1"
FT                   /translation="MRNWCLCQICTCGSIRTFICT"
FT   gene            20073096..20199763
FT                   /gene="Eftud1"
FT                   /locus_tag="mCG_120997"
FT                   /note="gene_id=mCG120997.0"
FT   mRNA            join(20073096..20073148,20073980..20074085,
FT                   20076335..20076402,20082171..20082255,20095731..20095864,
FT                   20096936..20097073,20098534..20098748,20105518..20105641,
FT                   20107171..20107247,20107870..20108006,20108485..20108607,
FT                   20110831..20110930,20116631..20116782,20116998..20117164,
FT                   20122046..20122184,20170981..20171112,20173763..20173910,
FT                   20182417..20183396,20191962..20192146,20194363..20194521,
FT                   20199401..20199763)
FT                   /gene="Eftud1"
FT                   /locus_tag="mCG_120997"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 1, transcript variant mCT122191"
FT                   /note="gene_id=mCG120997.0 transcript_id=mCT122191.1
FT                   created on 16-OCT-2002"
FT   mRNA            join(<20073111..20073148,20073980..20074085,
FT                   20076335..20076402,20082171..20082255,20095731..20095864,
FT                   20096936..20097073,20098534..20098748,20105518..20105641,
FT                   20107171..20107247,20107870..20108006,20108485..20108607,
FT                   20110831..20110930,20116631..20116782,20116998..20117164,
FT                   20122046..20122184,20170981..20171112,20173763..20173910,
FT                   20182417..20183396,20191962..20192146,20199401..20199762)
FT                   /gene="Eftud1"
FT                   /locus_tag="mCG_120997"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 1, transcript variant mCT189929"
FT                   /note="gene_id=mCG120997.0 transcript_id=mCT189929.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<20073113..20073148,20073980..20074085,
FT                   20076335..20076402,20082171..20082255,20095731..20095864,
FT                   20096936..20097073,20098534..20098748,20105518..20105641,
FT                   20107171..20107247,20107870..20108006,20108485..20108607,
FT                   20110831..20110930,20116631..20116782,20116998..20117164,
FT                   20122046..20122184,20170981..20171112,20173763..20173910,
FT                   20182417..20183396,20191962..20192146,20199401..20199589)
FT                   /codon_start=1
FT                   /gene="Eftud1"
FT                   /locus_tag="mCG_120997"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG120997.0 transcript_id=mCT189929.0
FT                   protein_id=mCP110913.0 isoform=CRA_b"
FT                   /protein_id="EDL06898.1"
FT                   /translation="VLGAWVRCGVELSQEITMVLSGVDKMIRLQKNTANIRNICVLAHV
FT                   DHGKTTLADCLISSNGIISSRLAGKLRYMDSREDEQVRGITMKSSAISLHYAEGHEEYL
FT                   INLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLRQAWLENIRPVLVIN
FT                   KIDRLIVELKFTPQEAYSHLKNILEQINALTGTLFTSKVLEERAERETESQAKPHSEQG
FT                   EQVYDWSAGLEDVDDSQLYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKIGIKKEVLL
FT                   KTLWGDYYINMKAKKIMKVDQAKGKKPLFVQLILENIWSLYDAVLKKDKEKIDKIVTSL
FT                   GLKIGAREARHSDPKVQINAICSQWLPISHAVLAMVCHKLPSPLDMTSERVEKLLCTGS
FT                   QTFESLPPETQALKAAFMKCGSEDTAPVIIFVSKMFAVDVKALPQNKPRPLTQEEMAQR
FT                   RERARQRHAEKLAAAQGQTSQGPTQDGGALETSPHEDEPRGDEPDVASVSRQPVSQEES
FT                   SQEAFIAFARVFSGIARRGKKIFVLGPKYSPVDFLQRVPLGFSAPLEDLPPVPHMACCT
FT                   LENLYLLMGRELEDLEEVPPGNVLGIGGLQDFVLKSATLCSLPSCPPFIPLNFEATPIV
FT                   RVAVEPKHPSEMPQLVKGMKLLNQADPCVQVLIQETGEHVLVTAGEVHLQRCLDDLRER
FT                   FAKIHISVSEPIIPFRETITKPPKVDMVNEEIGRQQKVAVIHQTKEEQSKIPEGIHVDS
FT                   DGLITIPTPNKLATLSVRAIPLPEEVTRILEENSDLIRSMELLTSSLNEGRNTQAIHQK
FT                   TQEKIWEFKGKLEKHLTGRKWRNTVDQIWSFGPRKCGPNILVSRSEDFQNSVWSGPAGR
FT                   ESKEASRFRDFGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWELNKCAEQGASDKQHQ
FT                   GQCDLAGEGQGGGKTCHVGDENQEQQDVCSEPFEETSQKGDSPVIDCYGPFSGQLIATM
FT                   KEACRYALQVKPQRLMAAMYTCDIMATSDVLGRVYAVLSKREGRVLQEEMKEGTDMFII
FT                   KAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEVIPSDPFWVPTTEEEYLHFGEKADS
FT                   ENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK"
FT   CDS             join(20073995..20074085,20076335..20076402,
FT                   20082171..20082255,20095731..20095864,20096936..20097073,
FT                   20098534..20098748,20105518..20105641,20107171..20107247,
FT                   20107870..20108006,20108485..20108607,20110831..20110930,
FT                   20116631..20116782,20116998..20117164,20122046..20122184,
FT                   20170981..20171112,20173763..20173910,20182417..20183396,
FT                   20191962..20192146,20194363..20194521,20199401..20199589)
FT                   /codon_start=1
FT                   /gene="Eftud1"
FT                   /locus_tag="mCG_120997"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG120997.0 transcript_id=mCT122191.1
FT                   protein_id=mCP88890.1 isoform=CRA_a"
FT                   /protein_id="EDL06897.1"
FT                   /translation="MVLSGVDKMIRLQKNTANIRNICVLAHVDHGKTTLADCLISSNGI
FT                   ISSRLAGKLRYMDSREDEQVRGITMKSSAISLHYAEGHEEYLINLIDSPGHVDFSSEVS
FT                   TAVRICDGCIIVVDAVEGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAY
FT                   SHLKNILEQINALTGTLFTSKVLEERAERETESQAKPHSEQGEQVYDWSAGLEDVDDSQ
FT                   LYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKIGIKKEVLLKTLWGDYYINMKAKKIM
FT                   KVDQAKGKKPLFVQLILENIWSLYDAVLKKDKEKIDKIVTSLGLKIGAREARHSDPKVQ
FT                   INAICSQWLPISHAVLAMVCHKLPSPLDMTSERVEKLLCTGSQTFESLPPETQALKAAF
FT                   MKCGSEDTAPVIIFVSKMFAVDVKALPQNKPRPLTQEEMAQRRERARQRHAEKLAAAQG
FT                   QTSQGPTQDGGALETSPHEDEPRGDEPDVASVSRQPVSQEESSQEAFIAFARVFSGIAR
FT                   RGKKIFVLGPKYSPVDFLQRVPLGFSAPLEDLPPVPHMACCTLENLYLLMGRELEDLEE
FT                   VPPGNVLGIGGLQDFVLKSATLCSLPSCPPFIPLNFEATPIVRVAVEPKHPSEMPQLVK
FT                   GMKLLNQADPCVQVLIQETGEHVLVTAGEVHLQRCLDDLRERFAKIHISVSEPIIPFRE
FT                   TITKPPKVDMVNEEIGRQQKVAVIHQTKEEQSKIPEGIHVDSDGLITIPTPNKLATLSV
FT                   RAIPLPEEVTRILEENSDLIRSMELLTSSLNEGRNTQAIHQKTQEKIWEFKGKLEKHLT
FT                   GRKWRNTVDQIWSFGPRKCGPNILVSRSEDFQNSVWSGPAGRESKEASRFRDFGNSIVS
FT                   GFQLATLSGPMCEEPLMGVCFVLEKWELNKCAEQGASDKQHQGQCDLAGEGQGGGKTCH
FT                   VGDENQEQQDVCSEPFEETSQKGDSPVIDCYGPFSGQLIATMKEACRYALQVKPQRLMA
FT                   AMYTCDIMATSDVLGRVYAVLSKREGRVLQEEMKEGTDMFIIKAVLPVAESFGFADEIR
FT                   KRTSGLASPQLVFSHWEREGRVLQEEMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGL
FT                   ASPQLVFSHWEVIPSDPFWVPTTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKI
FT                   VEHAEKQRTLSKNK"
FT   gap             20077069..20077171
FT                   /estimated_length=103
FT   gap             20097728..20097782
FT                   /estimated_length=55
FT   gap             20138601..20138620
FT                   /estimated_length=20
FT   gap             20154019..20154038
FT                   /estimated_length=20
FT   gap             20161050..20161125
FT                   /estimated_length=76
FT   gene            complement(20163553..>20175833)
FT                   /locus_tag="mCG_145073"
FT                   /note="gene_id=mCG145073.0"
FT   mRNA            complement(join(20163553..20163969,20164660..20164919,
FT                   20174794..20175031,20175784..>20175833))
FT                   /locus_tag="mCG_145073"
FT                   /product="mCG145073"
FT                   /note="gene_id=mCG145073.0 transcript_id=mCT184497.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20164881..20164919,20174794..>20175024))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145073"
FT                   /product="mCG145073"
FT                   /note="gene_id=mCG145073.0 transcript_id=mCT184497.0
FT                   protein_id=mCP106152.0"
FT                   /protein_id="EDL06899.1"
FT                   /translation="ENGDKRRNSILEFVWITAIKQGKGKATAAFSSEEDKADSPSGRRS
FT                   CLIPQGTSAHCCTVHVICCGCRTIQSVGVTVQSRGLADTNRPER"
FT   gap             20190982..20191001
FT                   /estimated_length=20
FT   gap             20192318..20192337
FT                   /estimated_length=20
FT   gap             20205497..20206020
FT                   /estimated_length=524
FT   gap             20207409..20207428
FT                   /estimated_length=20
FT   gap             20221635..20221654
FT                   /estimated_length=20
FT   gene            20234070..20256149
FT                   /locus_tag="mCG_147206"
FT                   /note="gene_id=mCG147206.0"
FT   mRNA            join(20234070..20234102,20254578..20256149)
FT                   /locus_tag="mCG_147206"
FT                   /product="mCG147206"
FT                   /note="gene_id=mCG147206.0 transcript_id=mCT187469.0
FT                   created on 13-JAN-2004"
FT   CDS             join(20234094..20234102,20254578..20254916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147206"
FT                   /product="mCG147206"
FT                   /note="gene_id=mCG147206.0 transcript_id=mCT187469.0
FT                   protein_id=mCP109613.0"
FT                   /protein_id="EDL06896.1"
FT                   /translation="MTRPLRTDSKEGLRTAVWSHQSRGAHVAIHPQTGSHLSDEEPQAR
FT                   GTCTLHITIPLQTILQMPQTSRSPCPGLDAHLQCGTALLSGSPLLRSNFTSSGHRAGSE
FT                   GWNSCSLTSSV"
FT   gap             20245615..20245655
FT                   /estimated_length=41
FT   gene            20274273..20282440
FT                   /locus_tag="mCG_53117"
FT                   /note="gene_id=mCG53117.2"
FT   mRNA            join(20274273..20274932,20276637..20276751,
FT                   20279975..20280102,20280963..20281027,20281896..20282439)
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, transcript variant mCT53300"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT53300.2 created
FT                   on 24-DEC-2002"
FT   mRNA            join(20274638..20274932,20276637..20276751,
FT                   20279975..20280102,20280963..20281027,20282393..20282440)
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, transcript variant mCT177826"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT177826.0 created
FT                   on 24-DEC-2002"
FT   CDS             join(20274854..20274932,20276637..20276751,
FT                   20279975..20280102,20280963..20281027,20282393..20282434)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, isoform CRA_c"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT177826.0
FT                   protein_id=mCP100748.0 isoform=CRA_c"
FT                   /db_xref="GOA:J3QMA0"
FT                   /db_xref="MGI:MGI:1916583"
FT                   /db_xref="UniProtKB/TrEMBL:J3QMA0"
FT                   /protein_id="EDL06895.1"
FT                   /translation="MKSLETSPLQTYLPDSTNEYMEIPLEDLHEFNISSCLMFHSTGYG
FT                   RKELEPIQLFLAFCSLRYPRILISDACHHLNQQVSLLLSAKPIAPRSCFAERETKRSRP
FT                   QLLDETSEAQEPNEPLSQLVKDTPLNAATVFQLSDIKL"
FT   CDS             join(20274854..20274932,20276637..20276751,
FT                   20279975..20280102,20280963..20281027,20281896..20282030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, isoform CRA_b"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT53300.2
FT                   protein_id=mCP29921.2 isoform=CRA_b"
FT                   /protein_id="EDL06894.1"
FT                   /translation="MKSLETSPLQTYLPDSTNEYMEIPLEDLHEFNISSCLMFHSTGYG
FT                   RKELEPIQLFLAFCSLRYPRILISDACHHLNQQVSLLLSAKPIAPRSCFAERETKRSRP
FT                   QLLDETSEAQEPNEPLSQLVKDTPLIQEQQPHRLDSFSINCKDTSGPKYGTGKMLTRLD
FT                   FLKDEARESH"
FT   gap             20275053..20275072
FT                   /estimated_length=20
FT   gene            complement(20275196..>20290045)
FT                   /locus_tag="mCG_1028342"
FT                   /note="gene_id=mCG1028342.0"
FT   mRNA            complement(join(20275196..20275308,20286746..20287002,
FT                   20289880..>20290045))
FT                   /locus_tag="mCG_1028342"
FT                   /product="mCG1028342"
FT                   /note="gene_id=mCG1028342.0 transcript_id=mCT175186.0
FT                   created on 19-JUN-2003"
FT   gap             20277569..20277588
FT                   /estimated_length=20
FT   mRNA            join(<20278849..20278897,20279975..20280102,
FT                   20280963..20281027,20281896..20282439)
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, transcript variant mCT174607"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT174607.0 created
FT                   on 24-DEC-2002"
FT   CDS             join(<20278851..20278897,20279975..20280102,
FT                   20280963..20281027,20281896..20282030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53117"
FT                   /product="mCG53117, isoform CRA_a"
FT                   /note="gene_id=mCG53117.2 transcript_id=mCT174607.0
FT                   protein_id=mCP97526.0 isoform=CRA_a"
FT                   /protein_id="EDL06893.1"
FT                   /translation="TIEFCCQPPTRILLSWILISDACHHLNQQVSLLLSAKPIAPRSCF
FT                   AERETKRSRPQLLDETSEAQEPNEPLSQLVKDTPLIQEQQPHRLDSFSINCKDTSGPKY
FT                   GTGKMLTRLDFLKDEARESH"
FT   gap             20283841..20283860
FT                   /estimated_length=20
FT   gap             20285438..20285516
FT                   /estimated_length=79
FT   CDS             complement(join(20286896..20287002,20289880..>20290012))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028342"
FT                   /product="mCG1028342"
FT                   /note="gene_id=mCG1028342.0 transcript_id=mCT175186.0
FT                   protein_id=mCP98105.0"
FT                   /protein_id="EDL06892.1"
FT                   /translation="EEKAPNCDASRQAPKSGPSKVPLLPPNKASLEPTRPLGGRYTVQE
FT                   VCKAVLHTSCRLNTWQEEFKSPRERKLAHFNPCA"
FT   gap             20290046..20290065
FT                   /estimated_length=20
FT   gap             20291208..20291227
FT                   /estimated_length=20
FT   gene            <20291536..20294498
FT                   /locus_tag="mCG_8258"
FT                   /note="gene_id=mCG8258.2"
FT   mRNA            <20291536..20294498
FT                   /locus_tag="mCG_8258"
FT                   /product="mCG8258"
FT                   /note="gene_id=mCG8258.2 transcript_id=mCT7601.2 created on
FT                   16-OCT-2002"
FT   CDS             <20291571..20293190
FT                   /codon_start=1
FT                   /locus_tag="mCG_8258"
FT                   /product="mCG8258"
FT                   /note="gene_id=mCG8258.2 transcript_id=mCT7601.2
FT                   protein_id=mCP7334.2"
FT                   /protein_id="EDL06891.1"
FT                   /translation="RGSGSARETPPFSGRVFCCPAALGAGCPGSPRLSWDNGRVSFSIS
FT                   PTPSLEPWLPGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHF
FT                   SMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTY
FT                   IVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGIIELTDENDFHANGTDVGFDL
FT                   HHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDSYFGGGTSGSAAA
FT                   TSRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGEASVPSPDGGPELQPTFDPAPAPPP
FT                   GTPLLWAQFERSPGGGSAAPVSSSCSSSASSSASSSSVVFPGGGASSTPSNANLGLLVH
FT                   RRLHPGTSCPRLSPPLHMATGAGEHHLARRVRSDPGGGGLAYAAYANGLGTQLPGLPSS
FT                   DTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFCMECANRIC
FT                   EKSEPECPVCHTAVTQAIRIFS"
FT   gap             20296945..20297117
FT                   /estimated_length=173
FT   gap             20301272..20301291
FT                   /estimated_length=20
FT   gap             20302774..20302793
FT                   /estimated_length=20
FT   gap             20318351..20318370
FT                   /estimated_length=20
FT   gap             20328969..20329355
FT                   /estimated_length=387
FT   gap             20353408..20353427
FT                   /estimated_length=20
FT   gene            complement(20363100..>20396804)
FT                   /locus_tag="mCG_1028158"
FT                   /note="gene_id=mCG1028158.1"
FT   mRNA            complement(join(20363100..20363220,20364114..20365057,
FT                   20365599..20365850,20396678..>20396804))
FT                   /locus_tag="mCG_1028158"
FT                   /product="mCG1028158"
FT                   /note="gene_id=mCG1028158.1 transcript_id=mCT145862.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(20365692..20365850,20396678..>20396776))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028158"
FT                   /product="mCG1028158"
FT                   /note="gene_id=mCG1028158.1 transcript_id=mCT145862.1
FT                   protein_id=mCP88670.1"
FT                   /protein_id="EDL06890.1"
FT                   /translation="WKCLPPCLPLEDGLYPPNGKPKKPLKLLLVRNQIPMTTNSNNSEG
FT                   RVYVQKALRDSYSCQDIVQFQQTHVGPESTGSLPLLLLKL"
FT   gap             20377430..20377677
FT                   /estimated_length=248
FT   gap             20439973..20440479
FT                   /estimated_length=507
FT   gap             20443804..20443823
FT                   /estimated_length=20
FT   gap             20447136..20447209
FT                   /estimated_length=74
FT   gap             20452173..20452192
FT                   /estimated_length=20
FT   gap             20461988..20462007
FT                   /estimated_length=20
FT   gap             20470201..20470220
FT                   /estimated_length=20
FT   gap             20471378..20471397
FT                   /estimated_length=20
FT   gap             20472415..20473289
FT                   /estimated_length=875
FT   gap             20479185..20479204
FT                   /estimated_length=20
FT   gap             20493274..20493293
FT                   /estimated_length=20
FT   gap             20541780..20541866
FT                   /estimated_length=87
FT   gene            <20575491..20606484
FT                   /gene="A530021J07"
FT                   /locus_tag="mCG_146068"
FT                   /note="gene_id=mCG146068.0"
FT   mRNA            join(<20575491..20575722,20576126..20576225,
FT                   20582205..20582271,20582763..20582966,20605681..20606484)
FT                   /gene="A530021J07"
FT                   /locus_tag="mCG_146068"
FT                   /product="hypothetical protein A530021J07"
FT                   /note="gene_id=mCG146068.0 transcript_id=mCT186171.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<20575612..20575722,20576126..20576225,
FT                   20582205..20582271,20582763..20582952)
FT                   /codon_start=1
FT                   /gene="A530021J07"
FT                   /locus_tag="mCG_146068"
FT                   /product="hypothetical protein A530021J07"
FT                   /note="gene_id=mCG146068.0 transcript_id=mCT186171.0
FT                   protein_id=mCP107707.0"
FT                   /protein_id="EDL06889.1"
FT                   /translation="ICSSLGRLGCDVSVFLCTMDSASVDQKVLVQKLCLCLEEHRHTHQ
FT                   KDKETHRSQFSPSTMWILRLELRSSGSSRHSFQPATQLGDNEPTDSTSWWQELEGGGTF
FT                   ERWWQQSKKNKTLEDLDRSLLPDPPEWERLLPPSPVAVKSDLLLFLPCHNG"
FT   gap             20591763..20591791
FT                   /estimated_length=29
FT   gap             20593098..20593225
FT                   /estimated_length=128
FT   gap             20602477..20602606
FT                   /estimated_length=130
FT   gene            complement(20605625..>20627326)
FT                   /locus_tag="mCG_65767"
FT                   /note="gene_id=mCG65767.2"
FT   mRNA            complement(join(20605625..20605776,20627063..>20627326))
FT                   /locus_tag="mCG_65767"
FT                   /product="mCG65767"
FT                   /note="gene_id=mCG65767.2 transcript_id=mCT65950.2 created
FT                   on 16-OCT-2002"
FT   CDS             complement(join(20605718..20605776,20627063..>20627189))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65767"
FT                   /product="mCG65767"
FT                   /note="gene_id=mCG65767.2 transcript_id=mCT65950.2
FT                   protein_id=mCP29961.2"
FT                   /protein_id="EDL06888.1"
FT                   /translation="SLLEFSFPTDACKLLLLQSRQLRGSTLGSKAGIPPSNRKQERVIV
FT                   KTMGARQRGTVGSLVA"
FT   gap             20606820..20612256
FT                   /estimated_length=5437
FT   gap             20657454..20657485
FT                   /estimated_length=32
FT   gap             20670933..20670952
FT                   /estimated_length=20
FT   gap             20700374..20700698
FT                   /estimated_length=325
FT   gap             20711126..20711425
FT                   /estimated_length=300
FT   gap             20734128..20734147
FT                   /estimated_length=20
FT   gap             20792204..20792223
FT                   /estimated_length=20
FT   gene            <20831778..>20834138
FT                   /locus_tag="mCG_8262"
FT                   /note="gene_id=mCG8262.2"
FT   mRNA            <20831778..>20834138
FT                   /locus_tag="mCG_8262"
FT                   /product="mCG8262"
FT                   /note="gene_id=mCG8262.2 transcript_id=mCT7603.2 created on
FT                   30-OCT-2002"
FT   CDS             20831778..20834138
FT                   /codon_start=1
FT                   /locus_tag="mCG_8262"
FT                   /product="mCG8262"
FT                   /note="gene_id=mCG8262.2 transcript_id=mCT7603.2
FT                   protein_id=mCP7315.2"
FT                   /protein_id="EDL06887.1"
FT                   /translation="MSCVHYKFSSKLSYNTITFDGLHISLFYLKKQIMGREKLKTANSD
FT                   LQITNAETEEEYTDDNALIPKNSSVIVRRIPVVGVKSKGKTYQISHTKPVMGTTRAVND
FT                   SSAPMSLAQLIETANLAEANASEEDKIKAMMIQSGHLYNPINSMKKTPVGLPPPSYTCF
FT                   CCGKPGHYIKNCPTNANKNFESRPRIRKSTGIPRSFMMEVKDPNMKGAMLTKTGQYAIP
FT                   TLNAEAYAIGKKEKPPFLPEEPSSSSSSEEVDPVPDELLCLICKDTMTDAAIIPCCGNS
FT                   YCDECIRTALLESDEHTCPTCHQNDVSPDALVANKVLRQAVNNFKNQTDSTKSLGKQVT
FT                   PSPPPLPPPSALIQQNLQPPMKSPTSRQQDPLKVPVTSFSAHPTPSVTSLASNLSSSAP
FT                   SVPGNPSSAPAPVPDTTARVSISDHSEKSDGPFRDSDNKLLSAAALTSEHSKEASSIAV
FT                   AALMQEKCSQVPVLETSPLLEQSLLHEQFIPTTGPLRINAAHPSGGQPGWEHPNKLGKL
FT                   VSPPQQIRSEERLCYRGIKRGQDYSEQSQSSQGPPRPATPVFVPIPPPLMQLSPPHMLL
FT                   LPPGVPAPRFPPWFPPSQPPPAGYSVPPPGFPPAPANISTAWVSSGVHTAHSNTIPTTQ
FT                   APLLSREEFYREQKRLKKESKFPYSGSSYSRSSYTDSKSRSGSTHSRSYSQSFSCSHSR
FT                   SSSRSSPSSRRGRGKICNDCSQSRSHGYHRSRSRSPPYRRYHSRSRSPPAFRGQSPTKL
FT                   DVPQEEKERYQEWERKYYQWYENRQRASSRNTA"
FT   gap             20840502..20840521
FT                   /estimated_length=20
FT   gap             20874407..20874470
FT                   /estimated_length=64
FT   gap             20882679..20882864
FT                   /estimated_length=186
FT   gene            <20891348..20905002
FT                   /locus_tag="mCG_1028340"
FT                   /note="gene_id=mCG1028340.0"
FT   mRNA            join(<20891348..20891388,20902964..20903059,
FT                   20904661..20905002)
FT                   /locus_tag="mCG_1028340"
FT                   /product="mCG1028340"
FT                   /note="gene_id=mCG1028340.0 transcript_id=mCT146044.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<20891348..20891388,20902964..20903059,
FT                   20904661..20904742)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028340"
FT                   /product="mCG1028340"
FT                   /note="gene_id=mCG1028340.0 transcript_id=mCT146044.0
FT                   protein_id=mCP88661.0"
FT                   /protein_id="EDL06886.1"
FT                   /translation="FHTLVDLCIADGPGGQLAFPGQTTVLSWKTSSKHPVTFSRHGLIE
FT                   SMSTQMEGSYVLLLTVIVPSPCWISKR"
FT   gap             20933339..20933506
FT                   /estimated_length=168
FT   gap             20948156..20948175
FT                   /estimated_length=20
FT   gene            complement(20962448..20969908)
FT                   /locus_tag="mCG_147193"
FT                   /note="gene_id=mCG147193.0"
FT   mRNA            complement(join(20962448..20962755,20968380..20969908))
FT                   /locus_tag="mCG_147193"
FT                   /product="mCG147193"
FT                   /note="gene_id=mCG147193.0 transcript_id=mCT187456.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(20968790..20969275)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147193"
FT                   /product="mCG147193"
FT                   /note="gene_id=mCG147193.0 transcript_id=mCT187456.0
FT                   protein_id=mCP109600.0"
FT                   /db_xref="GOA:Q8C4H5"
FT                   /db_xref="MGI:MGI:3642045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4H5"
FT                   /protein_id="EDL06885.1"
FT                   /translation="MDLSFRHRSKEASHSSIVSIPQHAPGPVPTSPSTMATTLLILKSW
FT                   LSTVTQRHLLGGSPGCELEPQVLFSWIISCHLSRHLCLNCHPLGEVSPTILSNVIFSRL
FT                   LSRFSTDFHLALIKIKSLHFTLLCLPPLPAAIVEASRTLFGLPPPASLPLSTVCCTL"
FT   gap             20977222..20977436
FT                   /estimated_length=215
FT   gap             20999161..20999190
FT                   /estimated_length=30
FT   gap             21000649..21002005
FT                   /estimated_length=1357
FT   gene            <21003962..>21019910
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /note="gene_id=mCG121855.1"
FT   mRNA            join(<21003962..21004212,21005346..21005492,
FT                   21009646..21009721,21015067..21015148,21016453..21016559,
FT                   21017206..21017304,21017406..21017548,21018954..21019101,
FT                   21019892..>21019910)
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3,
FT                   transcript variant mCT123068"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT123068.1
FT                   created on 30-OCT-2002"
FT   mRNA            join(<21003962..21004212,21005346..21005492,
FT                   21009646..21009950)
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3,
FT                   transcript variant mCT175197"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT175197.0
FT                   created on 30-OCT-2002"
FT   mRNA            join(<21003971..21004212,21005346..21005492,
FT                   21009646..21009721,21015067..21015148,21016453..21016559,
FT                   21017206..21017304,21017406..21017906)
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3,
FT                   transcript variant mCT175198"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT175198.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<21003995..21004212,21005346..21005492,
FT                   21009646..21009721,21015067..21015148,21016453..21016559,
FT                   21017206..21017304,21017406..21017548,21018954..21019101,
FT                   21019892..>21019910)
FT                   /codon_start=1
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT123068.1
FT                   protein_id=mCP88912.1 isoform=CRA_a"
FT                   /protein_id="EDL06882.1"
FT                   /translation="RRRAGQLCRPLSDSSFGTEPCLQNQGFPIPWLSLGTIGYRPGLMK
FT                   TSKASQRYRSIRRNASQCYLYQDSLLLGNSDDSFNADETGDSSDPEQIFQNIQFQKDLM
FT                   ANIRCRPWTMGQKLRALRRAKEIVLKFEGRLTRTRGYQAAGAELWRKFARLACNFVVIF
FT                   IPWEMRIKKIESHFGSGVASYFIFLRWLFGINIVLTVMTGAFVVLPELIAGQPFGSTAS
FT                   KTIPREQITSAQDLDTVWSLGGYLQYSVLFYGYYGRERRIGRAGYRLPLAYFLVGMAVF
FT                   AYSFIVLLKKMAKNSRTSLASASNENYTFCWRVFCAWDYLIGNPEAAESKTAAILNSIR
FT                   EAILEE"
FT   CDS             join(<21003995..21004212,21005346..21005492,
FT                   21009646..21009721,21015067..21015148,21016453..21016559,
FT                   21017206..21017304,21017406..21017603)
FT                   /codon_start=1
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT175198.0
FT                   protein_id=mCP98116.0 isoform=CRA_c"
FT                   /protein_id="EDL06884.1"
FT                   /translation="RRRAGQLCRPLSDSSFGTEPCLQNQGFPIPWLSLGTIGYRPGLMK
FT                   TSKASQRYRSIRRNASQCYLYQDSLLLGNSDDSFNADETGDSSDPEQIFQNIQFQKDLM
FT                   ANIRCRPWTMGQKLRALRRAKEIVLKFEGRLTRTRGYQAAGAELWRKFARLACNFVVIF
FT                   IPWEMRIKKIESHFGSGVASYFIFLRWLFGINIVLTVMTGAFVVLPELIAGQPFGSTAS
FT                   KTIPREQITSAQDLDTVWSLGGYLQYSVLFYGYYGRERRIGRAGYRLPLAYFLVGMAVF
FT                   AYSFIVLLKKYDCLFLKTMSGVRLEHV"
FT   CDS             join(<21003995..21004212,21005346..21005492,
FT                   21009646..21009907)
FT                   /codon_start=1
FT                   /gene="Tmc3"
FT                   /locus_tag="mCG_121855"
FT                   /product="transmembrane channel-like gene family 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121855.1 transcript_id=mCT175197.0
FT                   protein_id=mCP98117.0 isoform=CRA_b"
FT                   /protein_id="EDL06883.1"
FT                   /translation="RRRAGQLCRPLSDSSFGTEPCLQNQGFPIPWLSLGTIGYRPGLMK
FT                   TSKASQRYRSIRRNASQCYLYQDSLLLGNSDDSFNADETGDSSDPEQIFQNIQFQKDLM
FT                   ANIRCRPWTMGQKLRALRRAKEIVLKFEGRLTRTRGYQAAGAEVTSTHEGWRASWMVVS
FT                   GTQHPSPHTYLGVFTINNCRISMSPQVQTPPSLDLSPGGQQLSVA"
FT   gap             21005824..21005843
FT                   /estimated_length=20
FT   gene            complement(21016054..>21050746)
FT                   /locus_tag="mCG_145907"
FT                   /note="gene_id=mCG145907.0"
FT   mRNA            complement(join(21016054..21016598,21024518..21024623,
FT                   21031351..21031487,21049668..>21050746))
FT                   /locus_tag="mCG_145907"
FT                   /product="mCG145907"
FT                   /note="gene_id=mCG145907.0 transcript_id=mCT186015.0
FT                   created on 04-JUL-2003"
FT   gap             21027997..21028016
FT                   /estimated_length=20
FT   gap             21045187..21045214
FT                   /estimated_length=28
FT   gap             21048795..21049228
FT                   /estimated_length=434
FT   CDS             complement(21050445..>21050744)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145907"
FT                   /product="mCG145907"
FT                   /note="gene_id=mCG145907.0 transcript_id=mCT186015.0
FT                   protein_id=mCP107706.0"
FT                   /protein_id="EDL06881.1"
FT                   /translation="SFSATAGFGQRQEPASLRSLDVYPLVLRCFRPPVKPCKQLRSGIL
FT                   QGGPENVEEPAGGGGRQEGYTPVSVQEACTGMSASDNRNRSDSQFYFILFFPLE"
FT   gene            21050900..21072039
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /note="gene_id=mCG8260.3"
FT   mRNA            join(21050900..21051041,21052033..21052165,
FT                   21055654..21055771,21056507..21056600,21059325..21061221)
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, transcript variant mCT173487"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT173487.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(21050900..21051041,21051639..21051688,
FT                   21052033..21052165,21055654..21055771,21056507..21056600,
FT                   21059325..21061020)
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, transcript variant mCT7602"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT7602.1 created on
FT                   11-JUN-2003"
FT   mRNA            join(21050902..21051041,21051639..21051688,
FT                   21052033..21052165,21055654..21055771,21056507..21056600,
FT                   21063345..21063445,21069844..21072039)
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, transcript variant mCT173488"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT173488.1 created
FT                   on 11-JUN-2003"
FT   CDS             join(21050943..21051041,21051639..21051688,
FT                   21052033..21052165,21055654..21055771,21056507..21056600,
FT                   21063345..21063445,21069844..21069869)
FT                   /codon_start=1
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT173488.1
FT                   protein_id=mCP96406.1 isoform=CRA_a"
FT                   /db_xref="GOA:D3YU00"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="MGI:MGI:2156765"
FT                   /db_xref="UniProtKB/TrEMBL:D3YU00"
FT                   /protein_id="EDL06878.1"
FT                   /translation="MDPSWATQESEAVAEKVLRYRRDASGWKKCREGNGVSISWRPSEE
FT                   FPGNLYRGEGILCGTPEEVWDCIKPVASGLREKWDDNVSSFEIVQSITDMLCVSRTSTP
FT                   SAAMKLISPRDFVDLVLVKKYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPL
FT                   PGDIIGNRWEEVCAAETFVKQSSHGFWLETAWEELFLLHSARR"
FT   CDS             join(21050943..21051041,21051639..21051688,
FT                   21052033..21052165,21055654..21055771,21056507..21056600,
FT                   21059325..21059472)
FT                   /codon_start=1
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, isoform CRA_b"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT7602.1
FT                   protein_id=mCP7260.1 isoform=CRA_b"
FT                   /protein_id="EDL06879.1"
FT                   /translation="MDPSWATQESEAVAEKVLRYRRDASGWKKCREGNGVSISWRPSEE
FT                   FPGNLYRGEGILCGTPEEVWDCIKPVASGLREKWDDNVSSFEIVQSITDMLCVSRTSTP
FT                   SAAMKLISPRDFVDLVLVKKYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPL
FT                   PGDPNKTNLVTFFQTDLSGYLPQSVVDSFFPRSMAEFYPNLQKAVRKFHH"
FT   CDS             join(21055654..21055771,21056507..21056600,
FT                   21059325..21059472)
FT                   /codon_start=1
FT                   /gene="Stard5"
FT                   /locus_tag="mCG_8260"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 5, isoform CRA_c"
FT                   /note="gene_id=mCG8260.3 transcript_id=mCT173487.1
FT                   protein_id=mCP96407.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q78YL5"
FT                   /db_xref="InterPro:IPR000799"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="MGI:MGI:2156765"
FT                   /db_xref="UniProtKB/TrEMBL:Q78YL5"
FT                   /protein_id="EDL06880.1"
FT                   /translation="MLCVSRTSTPSAAMKLISPRDFVDLVLVKKYEDGTISSNATHVEH
FT                   PLCPPKPGFVRGFNHPCGCFCEPLPGDPNKTNLVTFFQTDLSGYLPQSVVDSFFPRSMA
FT                   EFYPNLQKAVRKFHH"
FT   gene            complement(21061969..21154386)
FT                   /gene="Il16"
FT                   /locus_tag="mCG_8259"
FT                   /note="gene_id=mCG8259.2"
FT   mRNA            complement(join(21061969..21062980,21064732..21064854,
FT                   21065214..21065472,21067627..21067728,21069793..21069961,
FT                   21070791..21071874,21074191..21074335,21079708..21080195,
FT                   21081974..21082061,21085779..21085911,21088995..21089112,
FT                   21091937..21092153,21093389..21093462,21096896..21097010,
FT                   21099534..21099644,21101706..21101839,21106971..21107079,
FT                   21141174..21141586,21154294..21154386))
FT                   /gene="Il16"
FT                   /locus_tag="mCG_8259"
FT                   /product="interleukin 16, transcript variant mCT7598"
FT                   /note="gene_id=mCG8259.2 transcript_id=mCT7598.2 created on
FT                   17-SEP-2002"
FT   mRNA            complement(join(21062532..21062598,21062691..21062980,
FT                   21064732..21064854,21065214..21065472,21067627..21067728,
FT                   21069793..21069961,21070791..>21071842))
FT                   /gene="Il16"
FT                   /locus_tag="mCG_8259"
FT                   /product="interleukin 16, transcript variant mCT173486"
FT                   /note="gene_id=mCG8259.2 transcript_id=mCT173486.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(21062793..21062980,21064732..21064854,
FT                   21065214..21065472,21067627..21067728,21069793..21069961,
FT                   21070791..21071874,21074191..21074335,21079708..21080195,
FT                   21081974..21082061,21085779..21085911,21088995..21089112,
FT                   21091937..21092153,21093389..21093462,21096896..21097010,
FT                   21099534..21099644,21101706..21101839,21106971..21107079,
FT                   21141174..21141485))
FT                   /codon_start=1
FT                   /gene="Il16"
FT                   /locus_tag="mCG_8259"
FT                   /product="interleukin 16, isoform CRA_b"
FT                   /note="gene_id=mCG8259.2 transcript_id=mCT7598.2
FT                   protein_id=mCP7252.2 isoform=CRA_b"
FT                   /db_xref="GOA:O54824"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR020450"
FT                   /db_xref="MGI:MGI:1270855"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54824"
FT                   /protein_id="EDL06877.1"
FT                   /translation="MEPHGHSGKSRKSTKFRSISRSLILCNAKTSDDGSSPDEKYPDPF
FT                   ETSLCQGKEGFFHSSMQLADTFEAGLSNIPDLALASDSAQLAAAGSDRGKHCRKMFFMK
FT                   ESSSTSSKEKSGKPEAQSSSFLFPKACHQRTRSNSTSVNPYSAGEIDFPMTKKSAAPTD
FT                   RQPYSLCSNRKSLSQQLDYPILGTARPTRSLSTAQLGQLSGGLQASVISNIVLMKGQAK
FT                   GLGFSIVGGKDSIYGPIGIYVKSIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDAL
FT                   QKFKQAKKGLLTLTVRTRLTTPPSLCSHLSPPLCRSLSSSTCGAQDSSPFSLESPASPA
FT                   STAKPNYRIMVEVSLKKEAGVGLGIGLCSIPYFQCISGIFVHTLSPGSVAHLDGRLRCG
FT                   DEIVEINDSPVHCLTLNEVYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVEGV
FT                   KFGKDRHQWSLEGVKRLESSWHGRPTLEKEREKHSAPPHRRAQKIMVRSSSDSSYMSGS
FT                   PGGSPCSAGAEPQPSEREGSTHSPSLSPGEEQEPCPGVPSRPQQESPPLPESLERESHP
FT                   PLRLKKSFEILVRKPTSSKPKPPPRKYFKNDSEPQKKLEEKEKVTDPSGHTLPTCSQET
FT                   RELLPLLLQEDTAGRAPCTAACCPGPAASTQTSSSTEGESRRSASPETPASPGKHPLLK
FT                   RQARMDYSFDITAEDPWVRISDCIKNLFSPIMSENHSHTPLQPNTSLGEEDGTQGCPEG
FT                   GLSKMDAANGAPRVYKSADGSTVKKGPPVAPKPAWFRQSLKGLRNRAPDPRRPPEVASA
FT                   IQPTPVSRDPPGPQPQASSSIRQRISSFENFGSSQLPDRGVQRLSLQPSSGETTKFPGK
FT                   QDGGRFSGLLGQGATVTAKHRQTEVESMSTTFPNSSEVRDPGLPESPPPGQRPSTKALS
FT                   PDPLLRLLTTQSEDTQGPGLKMPSQRARSFPLTRTQSCETKLLDEKASKLYSISSQLSS
FT                   AVMKSLLCLPSSVSCGQITCIPKERVSPKSPCNNSSAAEGFGEAMASDTGFSLNLSELR
FT                   EYSEGLTEPGETEDRNHCSSQAGQSVISLLSAEELEKLIEEVRVLDEATLKQLDSIHVT
FT                   ILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGA
FT                   THNDALAILRQARDPRQAVIVTRRTTVEATHDLNSSTDSAASASAASDISVESKEATVC
FT                   TVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQG
FT                   LTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS"
FT   CDS             complement(join(21062793..21062980,21064732..21064854,
FT                   21065214..21065472,21067627..21067728,21069793..21069961,
FT                   21070791..>21071842))
FT                   /codon_start=1
FT                   /gene="Il16"
FT                   /locus_tag="mCG_8259"
FT                   /product="interleukin 16, isoform CRA_a"
FT                   /note="gene_id=mCG8259.2 transcript_id=mCT173486.0
FT                   protein_id=mCP96405.0 isoform=CRA_a"
FT                   /protein_id="EDL06876.1"
FT                   /translation="LKRQARMDYSFDITAEDPWVRISDCIKNLFSPIMSENHSHTPLQP
FT                   NTSLGEEDGTQGCPEGGLSKMDAANGAPRVYKSADGSTVKKGPPVAPKPAWFRQSLKGL
FT                   RNRAPDPRRPPEVASAIQPTPVSRDPPGPQPQASSSIRQRISSFENFGSSQLPDRGVQR
FT                   LSLQPSSGETTKFPGKQDGGRFSGLLGQGATVTAKHRQTEVESMSTTFPNSSEVRDPGL
FT                   PESPPPGQRPSTKALSPDPLLRLLTTQSEDTQGPGLKMPSQRARSFPLTRTQSCETKLL
FT                   DEKASKLYSISSQLSSAVMKSLLCLPSSVSCGQITCIPKERVSPKSPCNNSSAAEGFGE
FT                   AMASDTGFSLNLSELREYSEGLTEPGETEDRNHCSSQAGQSVISLLSAEELEKLIEEVR
FT                   VLDEATLKQLDSIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQ
FT                   KGNEVLSINGKSLKGATHNDALAILRQARDPRQAVIVTRRTTVEATHDLNSSTDSAASA
FT                   SAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMV
FT                   QPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS"
FT   gap             21096117..21096136
FT                   /estimated_length=20
FT   gap             21125181..21125200
FT                   /estimated_length=20
FT   gene            <21174767..21176689
FT                   /locus_tag="mCG_121849"
FT                   /note="gene_id=mCG121849.0"
FT   mRNA            <21174767..21176689
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT175195"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175195.0
FT                   created on 30-OCT-2002"
FT   mRNA            join(<21174767..21176169,21176228..21176689)
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT123062"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT123062.0
FT                   created on 30-OCT-2002"
FT   mRNA            join(<21174767..21176161,21176221..21176689)
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT175196"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175196.0
FT                   created on 30-OCT-2002"
FT   mRNA            join(<21174767..21175029,21175054..>21175399)
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT175194"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175194.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<21174790..21175029,21175054..>21175399)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_c"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175194.0
FT                   protein_id=mCP98112.0 isoform=CRA_c"
FT                   /protein_id="EDL06872.1"
FT                   /translation="FKKMETEEPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEM
FT                   VELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSRILSISADIETIGEILKKIIPTLE
FT                   EGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIK
FT                   ELRENTQTTIKLFQECCPHSTVRVVLIGGKPN"
FT   mRNA            join(<21174853..21175023,21175165..21175808)
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT175193"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175193.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<21174853..21175023,21175165..21175530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_b"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175193.0
FT                   protein_id=mCP98114.0 isoform=CRA_b"
FT                   /protein_id="EDL06871.1"
FT                   /translation="FGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGK
FT                   NIKALRTDYNASLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKE
FT                   LRENTQTTIKLFQECCPHSTVRVVLIGGKPNRVVECIKIILDLISESPIKGRAQPYDPN
FT                   FYDETYDYGGFKNDV"
FT   mRNA            join(<21175409..21175990,21176115..21176161,
FT                   21176221..21176406)
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, transcript variant mCT175192"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175192.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<21175409..21176169,21176228..21176387)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_f"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT123062.0
FT                   protein_id=mCP88662.0 isoform=CRA_f"
FT                   /protein_id="EDL06875.1"
FT                   /translation="NASRSSLTLYLSLPSKDVHNLTIPTFMMRPMIMVVLRMMFDDHRG
FT                   RPVGFPMRGRGGFDRMPSGRGGRLMPPSRRDYDNMSPRRGPPPPPPGRGGRGGSRARNL
FT                   PLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGG
FT                   SGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDE
FT                   PLEGSEDQIITITGTQDQIQNAQYLLQNSVKHSILESFSKTSEELKESCIFFFFYLLLF
FT                   KKPTFLCFIGVLHLRCSEIFAVHQM"
FT   CDS             join(<21175409..21176161,21176221..21176268)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_e"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175196.0
FT                   protein_id=mCP98111.0 isoform=CRA_e"
FT                   /protein_id="EDL06874.1"
FT                   /translation="NASRSSLTLYLSLPSKDVHNLTIPTFMMRPMIMVVLRMMFDDHRG
FT                   RPVGFPMRGRGGFDRMPSGRGGRLMPPSRRDYDNMSPRRGPPPPPPGRGGRGGSRARNL
FT                   PLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGG
FT                   SGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDE
FT                   PLEGSEDQIITITGTQDQIQNAQYLLQNSCEAVFWKVFLRLVKN"
FT   CDS             join(<21175409..21175990,21176115..21176161,
FT                   21176221..21176251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_a"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175192.0
FT                   protein_id=mCP98115.0 isoform=CRA_a"
FT                   /protein_id="EDL06870.1"
FT                   /translation="NASRSSLTLYLSLPSKDVHNLTIPTFMMRPMIMVVLRMMFDDHRG
FT                   RPVGFPMRGRGGFDRMPSGRGGRLMPPSRRDYDNMSPRRGPPPPPPGRGGRGGSRARNL
FT                   PLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGG
FT                   SGYDYSYAGGRGSYGDLGGPIITTQVTIPKDEHRTRYRTHSICCRTVVKQYSGKFF"
FT   CDS             <21175409..21176194
FT                   /codon_start=1
FT                   /locus_tag="mCG_121849"
FT                   /product="mCG121849, isoform CRA_d"
FT                   /note="gene_id=mCG121849.0 transcript_id=mCT175195.0
FT                   protein_id=mCP98113.0 isoform=CRA_d"
FT                   /protein_id="EDL06873.1"
FT                   /translation="NASRSSLTLYLSLPSKDVHNLTIPTFMMRPMIMVVLRMMFDDHRG
FT                   RPVGFPMRGRGGFDRMPSGRGGRLMPPSRRDYDNMSPRRGPPPPPPGRGGRGGSRARNL
FT                   PLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGG
FT                   SGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDE
FT                   PLEGSEDQIITITGTQDQIQNAQYLLQNSVKQYADVEGF"
FT   gap             21188203..21188446
FT                   /estimated_length=244
FT   gene            complement(21194643..21214166)
FT                   /gene="1700026D08Rik"
FT                   /locus_tag="mCG_21865"
FT                   /note="gene_id=mCG21865.1"
FT   mRNA            complement(join(21194643..21195186,21196094..21196167,
FT                   21199819..21199977,21210970..21211060,21212547..21212782,
FT                   21213334..21213423,21214080..21214166))
FT                   /gene="1700026D08Rik"
FT                   /locus_tag="mCG_21865"
FT                   /product="RIKEN cDNA 1700026D08"
FT                   /note="gene_id=mCG21865.1 transcript_id=mCT21686.1 created
FT                   on 16-OCT-2002"
FT   CDS             complement(join(21194994..21195186,21196094..21196167,
FT                   21199819..21199977,21210970..21211060,21212547..21212782,
FT                   21213334..21213423,21214080..21214148))
FT                   /codon_start=1
FT                   /gene="1700026D08Rik"
FT                   /locus_tag="mCG_21865"
FT                   /product="RIKEN cDNA 1700026D08"
FT                   /note="gene_id=mCG21865.1 transcript_id=mCT21686.1
FT                   protein_id=mCP7290.1"
FT                   /protein_id="EDL06869.1"
FT                   /translation="MAQNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRR
FT                   VKKNILRPMQLSVSEDGYVHYGDKVIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQL
FT                   SDDLEIPCGVSAVQTIAPMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLEGKML
FT                   YLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVI
FT                   YHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGNPRNKSNTM
FT                   LDISKPITEDTRALEQAMGINT"
FT   gap             21199301..21199320
FT                   /estimated_length=20
FT   gap             21202438..21202457
FT                   /estimated_length=20
FT   gap             21204227..21208696
FT                   /estimated_length=4470
FT   gap             21224843..21224862
FT                   /estimated_length=20
FT   gap             21229009..21229028
FT                   /estimated_length=20
FT   gap             21233426..21233445
FT                   /estimated_length=20
FT   gap             21234736..21234786
FT                   /estimated_length=51
FT   gap             21259060..21259079
FT                   /estimated_length=20
FT   gene            <21299089..21299583
FT                   /locus_tag="mCG_1028337"
FT                   /note="gene_id=mCG1028337.0"
FT   mRNA            join(<21299089..21299206,21299245..21299583)
FT                   /locus_tag="mCG_1028337"
FT                   /product="mCG1028337"
FT                   /note="gene_id=mCG1028337.0 transcript_id=mCT146041.0
FT                   created on 30-OCT-2002"
FT   CDS             join(<21299125..21299206,21299245..21299303)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028337"
FT                   /product="mCG1028337"
FT                   /note="gene_id=mCG1028337.0 transcript_id=mCT146041.0
FT                   protein_id=mCP88634.0"
FT                   /protein_id="EDL06868.1"
FT                   /translation="LVNVMQGDRASLFAFWLAVLKLVLQGYSSPLIPFSLLCDICRLKE
FT                   P"
FT   gene            complement(21300304..21303603)
FT                   /gene="Mesdc1"
FT                   /locus_tag="mCG_21863"
FT                   /note="gene_id=mCG21863.2"
FT   mRNA            complement(21300304..21303603)
FT                   /gene="Mesdc1"
FT                   /locus_tag="mCG_21863"
FT                   /product="mesoderm development candidate 1"
FT                   /note="gene_id=mCG21863.2 transcript_id=mCT21684.2 created
FT                   on 16-JUN-2003"
FT   CDS             complement(21301394..21302482)
FT                   /codon_start=1
FT                   /gene="Mesdc1"
FT                   /locus_tag="mCG_21863"
FT                   /product="mesoderm development candidate 1"
FT                   /note="gene_id=mCG21863.2 transcript_id=mCT21684.2
FT                   protein_id=mCP7288.1"
FT                   /protein_id="EDL06867.1"
FT                   /translation="MASGSAGKPTGEAASPAPGSAVGGASSQPRKRLVSICDHCKGKMQ
FT                   LVADLLLLSSEARPVLFEGPASPGAGAESFEQCRDTIIARTKGLSILTHDVQSQLNMGR
FT                   FGEAGDSLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQG
FT                   CAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKCMS
FT                   TSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSTEG
FT                   KAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGSAKMSDHRERLRNSACAVSEGCTLL
FT                   SQALRERSSPRTLPPVNSNSVN"
FT   gene            21303727..21318457
FT                   /gene="Mesdc2"
FT                   /locus_tag="mCG_21861"
FT                   /note="gene_id=mCG21861.2"
FT   mRNA            join(21303727..21303916,21314807..21315039,
FT                   21317027..>21317217)
FT                   /gene="Mesdc2"
FT                   /locus_tag="mCG_21861"
FT                   /product="mesoderm development candiate 2, transcript
FT                   variant mCT172349"
FT                   /note="gene_id=mCG21861.2 transcript_id=mCT172349.0 created
FT                   on 22-AUG-2002"
FT   mRNA            join(<21311298..21311749,21314807..21315039,
FT                   21317027..21318457)
FT                   /gene="Mesdc2"
FT                   /locus_tag="mCG_21861"
FT                   /product="mesoderm development candiate 2, transcript
FT                   variant mCT21682"
FT                   /note="gene_id=mCG21861.2 transcript_id=mCT21682.1 created
FT                   on 22-AUG-2002"
FT   CDS             join(<21311555..21311749,21314807..21315039,
FT                   21317027..21317282)
FT                   /codon_start=1
FT                   /gene="Mesdc2"
FT                   /locus_tag="mCG_21861"
FT                   /product="mesoderm development candiate 2, isoform CRA_b"
FT                   /note="gene_id=mCG21861.2 transcript_id=mCT21682.1
FT                   protein_id=mCP7285.1 isoform=CRA_b"
FT                   /protein_id="EDL06866.1"
FT                   /translation="AANMAASRWLRAVLLFLCASDLLLLPPPNAYAADTPGEATPPPRK
FT                   KKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKK
FT                   GKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWE
FT                   IKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGS
FT                   RREDL"
FT   CDS             join(21314912..21315039,21317027..>21317217)
FT                   /codon_start=1
FT                   /gene="Mesdc2"
FT                   /locus_tag="mCG_21861"
FT                   /product="mesoderm development candiate 2, isoform CRA_a"
FT                   /note="gene_id=mCG21861.2 transcript_id=mCT172349.0
FT                   protein_id=mCP95268.0 isoform=CRA_a"
FT                   /protein_id="EDL06865.1"
FT                   /translation="MTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFI
FT                   VGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKK
FT                   KE"
FT   gap             21342852..21342871
FT                   /estimated_length=20
FT   gene            complement(21346586..21348339)
FT                   /locus_tag="mCG_147195"
FT                   /note="gene_id=mCG147195.0"
FT   mRNA            complement(21346586..21348339)
FT                   /locus_tag="mCG_147195"
FT                   /product="mCG147195"
FT                   /note="gene_id=mCG147195.0 transcript_id=mCT187458.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(21347579..21348097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147195"
FT                   /product="mCG147195"
FT                   /note="gene_id=mCG147195.0 transcript_id=mCT187458.0
FT                   protein_id=mCP109602.0"
FT                   /protein_id="EDL06864.1"
FT                   /translation="MVLNNTARSVSPKLSNPLPHHIASVASLGCPVFPSSFRKGAYHLK
FT                   WGEAVRDSWVRTKWELSGGFPTRFFQFQNIRSFAKGFSLLPLSTHCPLSSRQQPCHCLY
FT                   TASHMWAWAAHDCGILLVPPYSTVVLVCPMGSIRICQCASAGPIGSLWGSESGWLQTRI
FT                   FQLMFTLSK"
FT   gene            complement(21348511..21358069)
FT                   /locus_tag="mCG_21859"
FT                   /note="gene_id=mCG21859.1"
FT   mRNA            complement(join(21348511..21349477,21351116..21351216,
FT                   21355735..21355892,21357348..21357434,21357611..21358069))
FT                   /locus_tag="mCG_21859"
FT                   /product="mCG21859"
FT                   /note="gene_id=mCG21859.1 transcript_id=mCT21681.1 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(21349350..21349477,21351116..21351216,
FT                   21355735..21355892,21357348..21357434,21357611..21357757))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21859"
FT                   /product="mCG21859"
FT                   /note="gene_id=mCG21859.1 transcript_id=mCT21681.1
FT                   protein_id=mCP7266.1"
FT                   /protein_id="EDL06863.1"
FT                   /translation="MKGCERIKIKALLPRNAGISDCTATAYPRFTERAIVDVPMPRKLF
FT                   GAQLKTKDHFLEVKMESSRQHFFHLRNDFAYIEVDGRRYPCSEDGIQIVVIDGSRGHVV
FT                   SHGSFRNAILQGIPWQLFNYVAAIPDNSIVLMASKGRYITRGPWTRVLEKLGADKGLKL
FT                   KEKMAFVGFKGSFRPIWVTLETEDHKAKIFQVVPIPVVRKKKL"
FT   gene            complement(21360254..>21498685)
FT                   /locus_tag="mCG_144578"
FT                   /note="gene_id=mCG144578.0"
FT   mRNA            complement(join(21360254..21361058,21362306..21362517,
FT                   21365129..21365344,21366513..21366693,21368947..21369102,
FT                   21369184..21369219,21371288..21371419,21372209..21372294,
FT                   21375243..21375371,21376745..21376814,21377708..21377913,
FT                   21386844..21387054,21388712..21388887,21395888..21396079,
FT                   21396830..21396962,21401026..21401147,21401648..21401743,
FT                   21402829..21402899,21405714..21405893,21409516..21409752,
FT                   21410785..21410923,21411403..21411549,21415606..21415715,
FT                   21498438..>21498685))
FT                   /locus_tag="mCG_144578"
FT                   /product="mCG144578"
FT                   /note="gene_id=mCG144578.0 transcript_id=mCT184002.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(21377891..21377913,21386844..21387054,
FT                   21388712..21388887,21395888..21396079,21396830..21396962,
FT                   21401026..21401147,21401648..21401743,21402829..21402899,
FT                   21405714..21405893,21409516..21409752,21410785..21410923,
FT                   21411403..21411549,21415606..21415715,21498438..>21498685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144578"
FT                   /product="mCG144578"
FT                   /note="gene_id=mCG144578.0 transcript_id=mCT184002.0
FT                   protein_id=mCP106144.0"
FT                   /protein_id="EDL06862.1"
FT                   /translation="SELATKPVSARSRARSAFCAEWQWSGAAGALCRVRSESAPHFPPA
FT                   PVPLAYAQELNAWDQILDYGMLHSRSPRRGRVSVINLREEAVGMRASGRHDVSLKIVLA
FT                   TGCLLLANFSGASSAVATECPDQSPELQPWSPGHNRDYQVHIGHGRKLLLTSSATVHSI
FT                   TISGGGKLVIKDHHEHIVLRTRYILIDDGGELHAGSALCPFEGNFSIVLYGRADENILP
FT                   DPYYGLKYIGVDKGGTLELHGQKKLSWTFLNKTLHPGGMQEGGYFFERSWGHRGVIVHV
FT                   IDAKLGTVVHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDTARKAM
FT                   TKLGSKHFLHLGFRHPWSFITVKGNPSSSVEDHIEYHGHKGSAAARVFKLFQTEHGEHF
FT                   NVSSSSEWVQDVEWTEWFDHDKVPQSKGGEKISDLRAAYPGKICNRPIDIQATTMDGVA
FT                   LSTEVVYKNGQDYRFACYTRGRACRSYRVRFLCGKPVRPKLTVSIDTNVNSTILSLVDN
FT                   VRSWRPGDTLVVASTDYSMYQAEEFRVLPCKACTSTQVKVAGKPQYLHIGEEIDGVDMR
FT                   AEVGLLTRNIVVMGEMEDRCYPYTNHICDFFDFDTFGGHIKFALGFKAAHLEGVELKYM
FT                   GQQLVGQYPIHFHLAGDLDEQGGYDPPYLHQGPLHSSHILPLRHCPWLQRSVDQGCCGL
FT                   "
FT   gap             21385958..21386254
FT                   /estimated_length=297
FT   gap             21429697..21429775
FT                   /estimated_length=79
FT   gap             21442157..21442176
FT                   /estimated_length=20
FT   gap             21460389..21460408
FT                   /estimated_length=20
FT   gap             21469402..21469421
FT                   /estimated_length=20
FT   gap             21504298..21504597
FT                   /estimated_length=300
FT   gap             21514866..21514885
FT                   /estimated_length=20
FT   gene            complement(21521561..21564329)
FT                   /gene="2210412D01Rik"
FT                   /locus_tag="mCG_21868"
FT                   /note="gene_id=mCG21868.2"
FT   mRNA            complement(join(21521561..21523010,21526480..21526659,
FT                   21563718..21564329))
FT                   /gene="2210412D01Rik"
FT                   /locus_tag="mCG_21868"
FT                   /product="RIKEN cDNA 2210412D01"
FT                   /note="gene_id=mCG21868.2 transcript_id=mCT21689.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(21522791..21523010,21526480..21526659,
FT                   21563718..21564280))
FT                   /codon_start=1
FT                   /gene="2210412D01Rik"
FT                   /locus_tag="mCG_21868"
FT                   /product="RIKEN cDNA 2210412D01"
FT                   /note="gene_id=mCG21868.2 transcript_id=mCT21689.2
FT                   protein_id=mCP7331.2"
FT                   /protein_id="EDL06861.1"
FT                   /translation="MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVL
FT                   APEQRAPAPAATPAPAPAAQPAPAEEGAGPGACSLHLSERADWQYSQRELDAVEVFFSR
FT                   TARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYG
FT                   VSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVIL
FT                   HSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYER
FT                   CPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS"
FT   gap             21548533..21548552
FT                   /estimated_length=20
FT   gap             21564417..21564690
FT                   /estimated_length=274
FT   gap             21568669..21568788
FT                   /estimated_length=120
FT   gap             21619979..21620126
FT                   /estimated_length=148
FT   gap             21639964..21639983
FT                   /estimated_length=20
FT   gap             21642777..21642796
FT                   /estimated_length=20
FT   gap             21646991..21647010
FT                   /estimated_length=20
FT   gene            complement(21660866..21822814)
FT                   /gene="Arnt2"
FT                   /locus_tag="mCG_123277"
FT                   /note="gene_id=mCG123277.1"
FT   mRNA            complement(join(21660866..21664750,21665963..21666099,
FT                   21676961..21677111,21677747..21677885,21680143..21680242,
FT                   21682476..21682599,21683410..21683482,21689911..21690062,
FT                   21696671..21696745,21698569..21698703,21700350..21700426,
FT                   21719294..21719379,21719691..21719756,21725373..21725475,
FT                   21758301..21758514,21761901..21762114,21769174..21769221,
FT                   21776212..21776326,21822755..21822814))
FT                   /gene="Arnt2"
FT                   /locus_tag="mCG_123277"
FT                   /product="aryl hydrocarbon receptor nuclear translocator 2,
FT                   transcript variant mCT124509"
FT                   /note="gene_id=mCG123277.1 transcript_id=mCT124509.1
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(21664652..21664750,21665963..21666099,
FT                   21676961..21677111,21677747..21677885,21680143..21680242,
FT                   21682476..21682599,21683410..21683482,21689911..21690062,
FT                   21696671..21696745,21698569..21698703,21700350..21700426,
FT                   21719294..21719379,21719691..21719756,21725373..21725475,
FT                   21758301..21758514,21761901..21762114,21769174..21769221,
FT                   21776212..21776326,21822755..21822785))
FT                   /codon_start=1
FT                   /gene="Arnt2"
FT                   /locus_tag="mCG_123277"
FT                   /product="aryl hydrocarbon receptor nuclear translocator 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123277.1 transcript_id=mCT124509.1
FT                   protein_id=mCP88985.1 isoform=CRA_a"
FT                   /protein_id="EDL06859.1"
FT                   /translation="MATPAAVNPPEMASDIPGSVALPVAPMAATGQVRMAGAMPARGGK
FT                   RRSGMDFDDEDGEGPSKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLT
FT                   ILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYV
FT                   SDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEG
FT                   QQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVH
FT                   CTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSR
FT                   HNSDGIITFVDPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSV
FT                   MYRFRTKNREWLLIRTSSFTFQNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSS
FT                   YDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASASG
FT                   SQQIYSQGSPFPAGHSGKAFSSSVVHVPGVNDIQSSSSTGQNISQISRQLNQGQVAWTG
FT                   SRPPFPGQPSKTQSSAFGIGSSHPYPADPSSYSPLSSPAASSPSGNAYPSLANRTPGFA
FT                   ESGQSGGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTG
FT                   NYNIEDFADLGMFPPFSE"
FT   gap             21707089..21707108
FT                   /estimated_length=20
FT   gap             21737086..21737105
FT                   /estimated_length=20
FT   gap             21752871..21752928
FT                   /estimated_length=58
FT   gap             21756850..21756869
FT                   /estimated_length=20
FT   mRNA            complement(join(<21758411..21758514,21761901..21762114,
FT                   21769174..21769221,21776212..21776326,21785132..>21785293))
FT                   /gene="Arnt2"
FT                   /locus_tag="mCG_123277"
FT                   /product="aryl hydrocarbon receptor nuclear translocator 2,
FT                   transcript variant mCT172335"
FT                   /note="gene_id=mCG123277.1 transcript_id=mCT172335.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(<21758411..21758514,21761901..21762114,
FT                   21769174..21769221,21776212..21776326,21785132..>21785135))
FT                   /codon_start=1
FT                   /gene="Arnt2"
FT                   /locus_tag="mCG_123277"
FT                   /product="aryl hydrocarbon receptor nuclear translocator 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123277.1 transcript_id=mCT172335.0
FT                   protein_id=mCP95254.0 isoform=CRA_b"
FT                   /protein_id="EDL06860.1"
FT                   /translation="EEMASDIPGSVALPVAPMAATGQVRMAGAMPARGGKRRSGMDFDD
FT                   EDGEGPSKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHM
FT                   KSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVL"
FT   gap             21763955..21764049
FT                   /estimated_length=95
FT   gap             21800261..21800280
FT                   /estimated_length=20
FT   gap             21802486..21802713
FT                   /estimated_length=228
FT   gap             21822828..21823133
FT                   /estimated_length=306
FT   gap             21826842..21826861
FT                   /estimated_length=20
FT   gap             21857663..21857682
FT                   /estimated_length=20
FT   gap             21879540..21885973
FT                   /estimated_length=6434
FT   gap             21887092..21887111
FT                   /estimated_length=20
FT   gap             21890305..21891759
FT                   /estimated_length=1455
FT   gap             21901130..21901437
FT                   /estimated_length=308
FT   gap             21905657..21905917
FT                   /estimated_length=261
FT   gap             21952013..21952032
FT                   /estimated_length=20
FT   gap             21961729..21963874
FT                   /estimated_length=2146
FT   gap             21977381..21977400
FT                   /estimated_length=20
FT   gap             21979981..21984081
FT                   /estimated_length=4101
FT   gap             21988847..21988974
FT                   /estimated_length=128
FT   gene            complement(21995177..22015981)
FT                   /gene="Fah"
FT                   /locus_tag="mCG_123275"
FT                   /note="gene_id=mCG123275.1"
FT   mRNA            complement(join(21995177..21995355,21998842..21998959,
FT                   21999585..21999617,22004754..22004848,22005463..22005562,
FT                   22007008..22007060,22007152..22007249,22009026..>22009118))
FT                   /gene="Fah"
FT                   /locus_tag="mCG_123275"
FT                   /product="fumarylacetoacetate hydrolase, transcript variant
FT                   mCT172334"
FT                   /note="gene_id=mCG123275.1 transcript_id=mCT172334.0
FT                   created on 22-AUG-2002"
FT   mRNA            complement(join(21995184..21995355,21998842..21998959,
FT                   21999585..21999686,22002379..22002425,22003183..22003258,
FT                   22004718..22004848,22005463..22005562,22007008..22007060,
FT                   22007152..22007249,22009026..22009116,22010749..22010798,
FT                   22011005..22011126,22012074..22012184,22015721..22015981))
FT                   /gene="Fah"
FT                   /locus_tag="mCG_123275"
FT                   /product="fumarylacetoacetate hydrolase, transcript variant
FT                   mCT124507"
FT                   /note="gene_id=mCG123275.1 transcript_id=mCT124507.1
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(21995276..21995355,21998842..21998959,
FT                   21999585..21999686,22002379..22002425,22003183..22003258,
FT                   22004718..22004848,22005463..22005562,22007008..22007060,
FT                   22007152..22007249,22009026..22009116,22010749..22010798,
FT                   22011005..22011126,22012074..22012184,22015721..22015801))
FT                   /codon_start=1
FT                   /gene="Fah"
FT                   /locus_tag="mCG_123275"
FT                   /product="fumarylacetoacetate hydrolase, isoform CRA_a"
FT                   /note="gene_id=mCG123275.1 transcript_id=mCT124507.1
FT                   protein_id=mCP88971.1 isoform=CRA_a"
FT                   /protein_id="EDL06857.1"
FT                   /translation="MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSV
FT                   IKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKEARASLQNLLSASQARLRDDKELRQ
FT                   RAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYHGRA
FT                   SSIVVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAH
FT                   EHIFGMVLMNDWSARDIQQWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVPNPKQDP
FT                   KPLPYLCHSQPYTFDINLSVSLKGEGMSQAATICRSNFKHMYWTMLQQLTHHSVNGCNL
FT                   RPGDLLASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGD
FT                   GYRVGFGQCAGKVLPALSPA"
FT   CDS             complement(join(21995276..21995355,21998842..21998959,
FT                   21999585..21999617,22004754..22004848,22005463..22005562,
FT                   22007008..22007060,22007152..22007249,22009026..>22009117))
FT                   /codon_start=1
FT                   /gene="Fah"
FT                   /locus_tag="mCG_123275"
FT                   /product="fumarylacetoacetate hydrolase, isoform CRA_b"
FT                   /note="gene_id=mCG123275.1 transcript_id=mCT172334.0
FT                   protein_id=mCP95253.0 isoform=CRA_b"
FT                   /protein_id="EDL06858.1"
FT                   /translation="GDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYHGRASSI
FT                   VVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHI
FT                   FGMVLMNDWSARDIQQWEYVPLGPFLGKSFGTTISPWVVPMDDLLASGTISGSDPESFG
FT                   SMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDGYRVGFGQCAGKVLPALSPA
FT                   "
FT   gap             22011147..22011166
FT                   /estimated_length=20
FT   gap             22012306..22012818
FT                   /estimated_length=513
FT   gene            complement(22025225..22104877)
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /note="gene_id=mCG21866.2"
FT   mRNA            complement(join(22025225..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044577,22094309..22094389))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT172351"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT172351.0 created
FT                   on 16-DEC-2002"
FT   mRNA            complement(join(22025225..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044577,22063052..22063212,22094309..22094351))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT21687"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT21687.2 created
FT                   on 16-DEC-2002"
FT   mRNA            complement(join(22025972..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044577,22104784..22104877))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT172350"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT172350.0 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(22025991..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044560))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_a"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT172350.0
FT                   protein_id=mCP95269.0 isoform=CRA_a"
FT                   /protein_id="EDL06851.1"
FT                   /translation="MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSN
FT                   GRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQ
FT                   VDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNR
FT                   CFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK
FT                   I"
FT   CDS             complement(join(22025991..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044560))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_a"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT172351.0
FT                   protein_id=mCP95270.0 isoform=CRA_a"
FT                   /protein_id="EDL06852.1"
FT                   /translation="MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSN
FT                   GRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQ
FT                   VDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNR
FT                   CFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK
FT                   I"
FT   CDS             complement(join(22025991..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044560))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_a"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT21687.2
FT                   protein_id=mCP7310.2 isoform=CRA_a"
FT                   /protein_id="EDL06855.1"
FT                   /translation="MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSN
FT                   GRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQ
FT                   VDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNR
FT                   CFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK
FT                   I"
FT   mRNA            complement(join(<22026101..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044114,
FT                   22044425..22044577,22104784..22104816))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT177767"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT177767.0 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(<22026101..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044114,
FT                   22044425..22044560))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_d"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT177767.0
FT                   protein_id=mCP100689.0 isoform=CRA_d"
FT                   /protein_id="EDL06856.1"
FT                   /translation="MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSN
FT                   DGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSVDKAVSETEDLQGPRAE
FT                   GLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYC
FT                   GV"
FT   mRNA            complement(join(<22026109..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044577,22094343..>22094397))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT189939"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT189939.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<22026109..22026139,22028021..22028134,
FT                   22031039..22031083,22042829..22042929,22044054..22044162,
FT                   22044407..22044577,22094343..>22094343))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_c"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT189939.0
FT                   protein_id=mCP110923.0 isoform=CRA_c"
FT                   /protein_id="EDL06854.1"
FT                   /translation="GVQQKNMAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQ
FT                   RQNSSNGRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSE
FT                   SVAPSQVDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKP
FT                   KQKKNRCFMCRKKVGLTGFECRCGNVY"
FT   mRNA            complement(join(<22031042..22031083,22042829..22042929,
FT                   22044054..22044159,22044407..22044577,22104784..22104854))
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, transcript
FT                   variant mCT177766"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT177766.0 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(<22031042..22031083,22042829..22042929,
FT                   22044054..22044159,22044407..22044560))
FT                   /codon_start=1
FT                   /gene="Zfand6"
FT                   /locus_tag="mCG_21866"
FT                   /product="zinc finger, AN1-type domain 6, isoform CRA_b"
FT                   /note="gene_id=mCG21866.2 transcript_id=mCT177766.0
FT                   protein_id=mCP100688.0 isoform=CRA_b"
FT                   /protein_id="EDL06853.1"
FT                   /translation="MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSN
FT                   GRISPPASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQV
FT                   DSTSVDKAVSETEDLQGPRAEGLVPLECDP"
FT   gap             22052110..22052370
FT                   /estimated_length=261
FT   gap             22073446..22073465
FT                   /estimated_length=20
FT   gap             22074544..22074563
FT                   /estimated_length=20
FT   gap             22075822..22075841
FT                   /estimated_length=20
FT   gap             22082220..22082239
FT                   /estimated_length=20
FT   gene            22104636..22190610
FT                   /locus_tag="mCG_21338"
FT                   /note="gene_id=mCG21338.2"
FT   mRNA            join(22104636..22104730,22104774..22104852,
FT                   22151552..22151696,22178935..22178960,22179319..22179354,
FT                   22189279..22190610)
FT                   /locus_tag="mCG_21338"
FT                   /product="mCG21338"
FT                   /note="gene_id=mCG21338.2 transcript_id=mCT21780.2 created
FT                   on 21-AUG-2002"
FT   gap             22104737..22104756
FT                   /estimated_length=20
FT   gap             22109670..22109935
FT                   /estimated_length=266
FT   gap             22124932..22125131
FT                   /estimated_length=200
FT   gap             22128953..22134974
FT                   /estimated_length=6022
FT   gap             22166201..22166220
FT                   /estimated_length=20
FT   CDS             22189763..22190080
FT                   /codon_start=1
FT                   /locus_tag="mCG_21338"
FT                   /product="mCG21338"
FT                   /note="gene_id=mCG21338.2 transcript_id=mCT21780.2
FT                   protein_id=mCP7233.2"
FT                   /protein_id="EDL06850.1"
FT                   /translation="MHACCTLHQPFSLTWMLIDVGRGEILHQVSKQVLERILSYGWMIS
FT                   LGLRSWNCTIGPKMANSMFAQATAASRLREISVEGPLITFGLFGDMNSSAIYGDLWCMH
FT                   Y"
FT   gap             22198897..22200031
FT                   /estimated_length=1135
FT   gap             22205991..22206010
FT                   /estimated_length=20
FT   gene            22212882..22218273
FT                   /pseudo
FT                   /locus_tag="mCG_1028188"
FT                   /note="gene_id=mCG1028188.0"
FT   mRNA            join(22212882..22213030,22213086..22213120,
FT                   22213133..22213207,22217084..22217236,22217566..22218273)
FT                   /pseudo
FT                   /locus_tag="mCG_1028188"
FT                   /note="gene_id=mCG1028188.0 transcript_id=mCT145892.1
FT                   created on 08-NOV-2002"
FT   gap             22216935..22217047
FT                   /estimated_length=113
FT   gap             22235511..22236049
FT                   /estimated_length=539
FT   gap             22237983..22238107
FT                   /estimated_length=125
FT   gap             22241594..22241613
FT                   /estimated_length=20
FT   gap             22246807..22246854
FT                   /estimated_length=48
FT   gap             22247720..22249318
FT                   /estimated_length=1599
FT   gap             22250045..22252255
FT                   /estimated_length=2211
FT   gap             22257221..22257462
FT                   /estimated_length=242
FT   gene            <22267036..>22267989
FT                   /locus_tag="mCG_65919"
FT                   /note="gene_id=mCG65919.0"
FT   mRNA            <22267036..>22267989
FT                   /locus_tag="mCG_65919"
FT                   /product="mCG65919"
FT                   /note="gene_id=mCG65919.0 transcript_id=mCT66102.0 created
FT                   on 08-NOV-2002"
FT   CDS             22267036..22267989
FT                   /codon_start=1
FT                   /locus_tag="mCG_65919"
FT                   /product="mCG65919"
FT                   /note="gene_id=mCG65919.0 transcript_id=mCT66102.0
FT                   protein_id=mCP29907.0"
FT                   /db_xref="GOA:Q8VF60"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030125"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VF60"
FT                   /protein_id="EDL06849.1"
FT                   /translation="MEMDVYNLTTVTQFILIGLSDLPEVRYPLFVAFVIIYQITLLGNG
FT                   LILLAIVTEKKLQTPMYYLLANLSLLDIFCPSATVPKMLKNLLTEDHSISFVGCALQLY
FT                   FLVALAGTEVFLLAVMAYDRYVAICFPLRYSLIMTKVRCVQLLFGTWAAGFLNSFVHTM
FT                   STFSLSFCKSNRVNQYYCDIPPVVALSCSSTYMAEVLLLVIASIFGVGAFLITLISYIY
FT                   IVSTILKIRSAEGKRKAFSTCASHLLVVFLFYGTTIFTYMRPTSSQHSPGRDRLISMLY
FT                   GVITPMLNPIIYSLRNTEVKGALRKVLHLRICSQTA"
FT   gap             22282613..22282632
FT                   /estimated_length=20
FT   gap             22285913..22285932
FT                   /estimated_length=20
FT   gene            <22328312..>22329259
FT                   /locus_tag="mCG_59831"
FT                   /note="gene_id=mCG59831.0"
FT   mRNA            <22328312..>22329259
FT                   /locus_tag="mCG_59831"
FT                   /product="mCG59831"
FT                   /note="gene_id=mCG59831.0 transcript_id=mCT60014.1 created
FT                   on 22-OCT-2002"
FT   CDS             22328312..22329259
FT                   /codon_start=1
FT                   /locus_tag="mCG_59831"
FT                   /product="mCG59831"
FT                   /note="gene_id=mCG59831.0 transcript_id=mCT60014.1
FT                   protein_id=mCP29979.1"
FT                   /db_xref="GOA:Q7TS13"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030124"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS13"
FT                   /protein_id="EDL06848.1"
FT                   /translation="MDVYNLTTVTQFILIGLSDLPEVRYPLFVAFVIIYQITLLGNGLI
FT                   LLAIVTEKKLQTPMYYLLANLSLLDIFCPSATVPKMLKNLLTEDHSISFVGCALQLYFL
FT                   VALAGTEVFLLAVMAYDRYVAICFPLRYSLIMTKVRCVQLLFGTWAAGFLNSFVHTMST
FT                   FSLSFCNSNRVNQYYCDIPPVVALSCSSTYMAEMLVLVIGGICGVGAFLITLISYIYIV
FT                   STILKIRSAEGKRKAFSTCASHLLVVFLFYGTTIFTYIRPTSSQHSPGRDRLISMLYGV
FT                   ITPMLNPIIYSLRNTEVKGALRKVLHLRICSQRE"
FT   gene            complement(22331916..22333032)
FT                   /pseudo
FT                   /locus_tag="mCG_1028185"
FT                   /note="gene_id=mCG1028185.1"
FT   mRNA            complement(22331916..22333032)
FT                   /pseudo
FT                   /locus_tag="mCG_1028185"
FT                   /note="gene_id=mCG1028185.1 transcript_id=mCT145889.1
FT                   created on 24-DEC-2002"
FT   gap             22334622..22334641
FT                   /estimated_length=20
FT   gap             22342810..22342829
FT                   /estimated_length=20
FT   gene            complement(<22352693..>22376560)
FT                   /locus_tag="mCG_21341"
FT                   /note="gene_id=mCG21341.2"
FT   mRNA            complement(join(<22352693..22353612,22355665..22355788,
FT                   22356028..22356246,22358724..22359524,22359896..22360175,
FT                   22376367..>22376560))
FT                   /locus_tag="mCG_21341"
FT                   /product="mCG21341"
FT                   /note="gene_id=mCG21341.2 transcript_id=mCT21783.2 created
FT                   on 04-OCT-2002"
FT   CDS             complement(join(22352693..22353612,22355665..22355788,
FT                   22356028..22356246,22358724..22359524,22359896..22360175,
FT                   22376367..22376560))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21341"
FT                   /product="mCG21341"
FT                   /note="gene_id=mCG21341.2 transcript_id=mCT21783.2
FT                   protein_id=mCP7275.2"
FT                   /db_xref="GOA:G3X931"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR004073"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:3642776"
FT                   /db_xref="UniProtKB/TrEMBL:G3X931"
FT                   /protein_id="EDL06847.1"
FT                   /translation="MLSFMSFFLILEYFLLLSVAHPKCFWRIKQNENKVGDVEDNCFFY
FT                   IYTRQGPLLNDPFNGNPDILLTTRNIHLILALLFAIKQINRNIHILPNISLIVNVNCAK
FT                   KEDLQMTNMYSNRDATIPNYNCKHGRRILTVLTGPRWFSSAILGPFLHIFAIPQLYYGP
FT                   FHPLLSDREHYPYLYQMSPKNTFLTLAMTALVVYFSWNWVGLVISDDELGIEFLFKLRG
FT                   EMHKHKVCIAFVNMIIQNIQLYQKRAEKYYNQILTSSAKVIIIYGDSDILTVHFRLWQH
FT                   LGIKRLWITTSHWDENTSKGDLLLSSFNGIFIFSHPHSKIPGFKKFIQTVHPSNYSKDT
FT                   SLARLWWLYFNCSLPSHCKTLKNCSTKILLEWLSRHQFEVSMSEPSYNLYNAVYAVAYA
FT                   LHEMLIQHTEHWQKDIGKELEFYSWKVAPFLENNKFIIPSEYQYRRGKLDTEYDILYAM
FT                   DLLPALGLNVKIGKFSQHFLHFQQLYIAEDMIDWTIDIRQTLQSVCSVPCSVGFRKFIQ
FT                   KGKAVCCFDCTPCPENEISNMTDMDQCVKCPNDQYANIKQTHCLKKVVTFLAYEDPLGM
FT                   TLTCLALLFSALTTVILSILLKHQDNPIVKANNRLLSYILLISLIFCFLCSLLYIGHPH
FT                   MATCILQQTTFAVVFTVAVSTILAKTITVVMAFKITDPRKKIRQMLVTRAPNYIIPICT
FT                   MIQLILCGTWIGTSPPFVDSDPHFEHGHIIIVCNKGSVIAFYCVLGYLGLLALGSFTVA
FT                   FLARNLPDRFNEAKFLTFSMLVFCSVWITFLPVYHSTKGKAMVVVEIFSILTSSAGLLV
FT                   CIFFPKCFTILLKQKVNFTQKFSDTHSKIEYNH"
FT   gap             22390419..22391673
FT                   /estimated_length=1255
FT   gap             22392459..22393497
FT                   /estimated_length=1039
FT   gap             22396728..22396747
FT                   /estimated_length=20
FT   gene            complement(<22406631..>22424221)
FT                   /locus_tag="mCG_123282"
FT                   /note="gene_id=mCG123282.1"
FT   mRNA            complement(join(<22406631..22407550,22417096..22417260,
FT                   22417593..22417809,22418517..22419323,22419713..22419992,
FT                   22424025..>22424221))
FT                   /locus_tag="mCG_123282"
FT                   /product="mCG123282"
FT                   /note="gene_id=mCG123282.1 transcript_id=mCT124513.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(22406631..22407550,22417096..22417260,
FT                   22417593..22417809,22418517..22419323,22419713..22419992,
FT                   22424025..22424221))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123282"
FT                   /product="mCG123282"
FT                   /note="gene_id=mCG123282.1 transcript_id=mCT124513.1
FT                   protein_id=mCP88746.1"
FT                   /protein_id="EDL06846.1"
FT                   /translation="MFTLISVFWFLKISSIFCHLSDPRCFWRIKDTKNHLGDKENNCFF
FT                   SIYTKRGYVKNDYFSCNLDKQVTPKTIHLIFSVYLAIEEINKDYHILPNISLLVNIECD
FT                   QRIYDKKSGLGLKSKEIIPNYYCRNQRRYLIVLTTPEWTVSTSLGPFLYISRIPELYCG
FT                   NFHLLLNDNEQFPHLYQISPKDTSLPLAMVSLVVHFRWNWIGAIVTNDDHGIQFLSELR
FT                   GEMQKHIVCLSVAIIIQTEKIMALKEFHTHYNQIIMSSAKVVIVYGDKDSPIHFALIVW
FT                   KSKGIWRIWVSVSQFDMITIIGDFLLYSSMGTFIFSHQQPEIPGFEQFIQTVHPSNYSS
FT                   EHSLAKLWWTYFRCSLPPSNCKKLKNCPTTTVFKWLFMTPLGMAMSNTCYNLYNGVYAV
FT                   ALSLHEMILQQVDTWSMNAGKELEFDSWKLFYFLKTLQFVNPAGELVIMNQNLKQDTEY
FT                   DIFFIMDFKKYYGLKIKIGRFSGHLPSGQQLLMSTEMIKWATGYCPYFYNAYYFSQILP
FT                   SVCSMPCRPGLRKSPQEGKDICCFVCYPCPENEISNMTNMDQCVKCPEDQYANEDQTLC
FT                   LQKVVAVLDYRDPLGKALAGFALCFSVLTSVVICVFLKHRETPIVKANNQTLSYVLLIS
FT                   LIFCFMSSLLYIGHPTMVICILQQTTFAIVFTVAASTILAKTITVVLAFKATVPGRRMR
FT                   WLLVSGAPKYIILICTMVQLILCGIWLRISPPFVDADIHMLHGQIIIVCNKGSVVAFYC
FT                   VLGYMGSIALASFTVAFLARNLPHTFNEAKLLTFSMLVFCSVWITFIPVYHSTKGKTTV
FT                   AVEVFCILASSAGLLLCIFAPKCYLILLRPQTNSFYKFRRPHAKAENIS"
FT   gap             22421862..22421881
FT                   /estimated_length=20
FT   gap             22445848..22445867
FT                   /estimated_length=20
FT   gap             22452934..22452962
FT                   /estimated_length=29
FT   gap             22460202..22460221
FT                   /estimated_length=20
FT   gap             22463220..22463239
FT                   /estimated_length=20
FT   gap             22478632..22478651
FT                   /estimated_length=20
FT   gap             22500582..22500601
FT                   /estimated_length=20
FT   gap             22535272..22535291
FT                   /estimated_length=20
FT   gene            complement(<22541972..>22561485)
FT                   /locus_tag="mCG_125764"
FT                   /note="gene_id=mCG125764.1"
FT   mRNA            complement(join(<22541972..22542772,22555424..22555547,
FT                   22556079..22556306,22557005..22557811,22558177..22558456,
FT                   22561289..>22561485))
FT                   /locus_tag="mCG_125764"
FT                   /product="mCG125764"
FT                   /note="gene_id=mCG125764.1 transcript_id=mCT127027.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(<22541972..22542772,22555424..22555547,
FT                   22556079..22556306,22557005..22557811,22558177..22558456,
FT                   22561289..>22561410))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125764"
FT                   /product="mCG125764"
FT                   /note="gene_id=mCG125764.1 transcript_id=mCT127027.1
FT                   protein_id=mCP88916.1"
FT                   /protein_id="EDL06845.1"
FT                   /translation="FWRIKDTENNLGDTETYCSFSISTRHGYVKNDYFSWNLDKQVTPK
FT                   TNHLIFSVYLALEEINMNFHILPNISLVVNIECLRKKYDEKTGLALQTEEFIPNYYCTD
FT                   ERRYLIIFTAPIWAVTTRLGTFMFMYSIPELYCGHFHLSLSDNEQFPHLYQISPKDTSL
FT                   PLAMVSLMVHFRWNWIGAIVTTDDHGIQFLSELRGEMQKHIVCLSFEITILTEHSMARK
FT                   EFQRYFNRIVMSSAKVVIVYGDYTSPIDLVLHLCKSKGIFRIWVSVSQFDMITKLGDFM
FT                   LYSSSGTFIFSHQKPELSGFQQFIQTVHPSNYSSEFSFAKLWWTYFRCSLPPSNCKKLK
FT                   NCPTKIVFKWLFMTPLGMAMSDTCYNLYNAIYAVAHSLHEMLLQQIDTWSNNAGKELEF
FT                   DTWKMFSILKTLQFVNPAGDLVNMNQNLKQDTDYDIFYIMDFQKDYGFKMKIGRFSGHL
FT                   PSHQQLYMSKEMMEWATDVDQILPSICSMPCRPGLRKSPEEGKDICCFVCNPCHENEIS
FT                   NMTNMDQCVKCQEDQYANEDHTLCLQKVVSILDYRDPLGKALAGIALCFSVLTSGILCI
FT                   FLKHRETPIVKANNQTLSYVLLISLVFCFICSLLYIGHPTTVICILQPITFAIAFTVAT
FT                   STILAKTITVLLAFKITIPGRRMRWLLLSGVPKYIVLICTMIQLILCGIWLGTSPPFVD
FT                   ADVYMVHGHIIIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTFS
FT                   MLVFCSVWITFIPVYHSTKGKTMVAVEVFSILAS"
FT   gap             22544586..22544605
FT                   /estimated_length=20
FT   gap             22583824..22584196
FT                   /estimated_length=373
FT   gene            <22591530..22592439
FT                   /locus_tag="mCG_1028226"
FT                   /note="gene_id=mCG1028226.1"
FT   mRNA            <22591530..22592439
FT                   /locus_tag="mCG_1028226"
FT                   /product="mCG1028226"
FT                   /note="gene_id=mCG1028226.1 transcript_id=mCT145930.1
FT                   created on 01-OCT-2002"
FT   CDS             <22591626..22592069
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028226"
FT                   /product="mCG1028226"
FT                   /note="gene_id=mCG1028226.1 transcript_id=mCT145930.1
FT                   protein_id=mCP88629.1"
FT                   /protein_id="EDL06844.1"
FT                   /translation="IVVAILDYRDPLGKSLAGFAICFSVLISVVLCIFLKHQETPIVKA
FT                   NNQTLSYVLLISLMFCFLCSLLYIVHPSMVICILQPTTFAIAFTVATILAKIFTVVLAF
FT                   KVTVPGRKRFLLVAGAPKYIILIFTMIQLILCGIWLGTSPSIC"
FT   gene            complement(<22620884..>22637177)
FT                   /locus_tag="mCG_125765"
FT                   /note="gene_id=mCG125765.1"
FT   mRNA            complement(join(<22620884..22621803,22631224..22631347,
FT                   22631727..22631954,22632627..22633433,22633787..22634066,
FT                   22636888..>22637177))
FT                   /locus_tag="mCG_125765"
FT                   /product="mCG125765"
FT                   /note="gene_id=mCG125765.1 transcript_id=mCT127028.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(22620884..22621803,22631224..22631347,
FT                   22631727..22631954,22632627..22633433,22633787..22634066,
FT                   22636888..22637177))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125765"
FT                   /product="mCG125765"
FT                   /note="gene_id=mCG125765.1 transcript_id=mCT127028.1
FT                   protein_id=mCP89092.1"
FT                   /protein_id="EDL06843.1"
FT                   /translation="MGSQNINICDSFYLNAYASFCSGRYLAGRIKMFSLISVFWFLKIS
FT                   FTFCHLSDPKCFWRIKDTENNLGDTETYCSFSISTRHGYVKNDYFSWNLDKQVTPKTNH
FT                   LIFSVYLALDEINMNIHILPNISMVANIECFLQKDGEKTGLALQRKEFIPNYYCTDERR
FT                   YLIIFTAPIWAVTTRLGPLMFMYSIPELYCGHFHLSLNDNEQFPHLYQISPKDTSLPLA
FT                   MVSLMVHFRWNWIGAMITNDDHGIQFLSKLRGEMQKHIVCLSFVITILTEHSMAHKEFQ
FT                   RYFNRIVMSSAKVVIVYGDYTSPIDLVLHLCKSKGIFRIWVSVSQFDMITYLGDFMLYS
FT                   SSGTFIFSHQKPELSGFQQFIQTVHPSNYSSEFSFAKLWWTYFRCSLPPFNCKKLKNCP
FT                   TKIVFKWLFMTPLGMAMSDTCYNLYNAIHAVAHSLHEMLLQQVDTWSNNAGKELEFDTW
FT                   KMFSILKTLQFVNPAGDLVNMNQNLKQDTEYEIFYIMDFQKDYGLKMKIGRFSGHLPSR
FT                   QQLYMSKEMMEWAIDVDQILPSICSMPCRPGLRKSPQEEKDICCFVCNPCLENEISNMT
FT                   NMDQCVKCREDQYANEHHTLCLQKVVSILDYRDPLGKALAGIALCFSFLTSVVLCIFLK
FT                   HRETPIVKANNQTLSYVLLISLVFCFICSLLYIGHPTAVICILQQTTFVIAFTVATSTI
FT                   LAKTITVLLAFKITIPGRRMRWLLVSGAPKYIILICTMIQLILCGIWLGTSPPFVDADA
FT                   HMVHGHIIIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTFSMLV
FT                   FCSVWITFIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYIILLRPDINSFQKF
FT                   RKPHANAENIS"
FT   gap             22643578..22643597
FT                   /estimated_length=20
FT   gap             22694203..22694254
FT                   /estimated_length=52
FT   gene            <22706826..>22742241
FT                   /locus_tag="mCG_125773"
FT                   /note="gene_id=mCG125773.1"
FT   mRNA            join(<22706826..22707059,22707512..22708255,
FT                   22709015..22709242,22709769..22709892,22741322..>22742241)
FT                   /locus_tag="mCG_125773"
FT                   /product="mCG125773"
FT                   /note="gene_id=mCG125773.1 transcript_id=mCT127036.1
FT                   created on 01-OCT-2002"
FT   CDS             join(22706826..22707059,22707512..22708255,
FT                   22709015..22709242,22709769..22709892,22741322..22742241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125773"
FT                   /product="mCG125773"
FT                   /note="gene_id=mCG125773.1 transcript_id=mCT127036.1
FT                   protein_id=mCP88613.1"
FT                   /protein_id="EDL06842.1"
FT                   /translation="MEEINKNDHILPNISLLVNIECGLELYGERTDLALKSKEFIPNYY
FT                   CRNHRRYLIVLTTPKWGVSTSIGQLLYISRIPEISPKDTSLPLAMVSLVVHFRWNWIGA
FT                   IVTNDDHGIQFLSELRGEMQKHVVCLSVAIIIQTQKFMALKDYRMNYNKIAMSSAKVVI
FT                   VYGDKDSPIQFTLIMWKSEGIRRIWVSVSQFDMITIIGEFLLYSSMGSFIFSHQQPEIS
FT                   DFEQFIKTVHPSNYSSEFSLAKLWWMYFRCSLPPSNCKKLKNCPIITVFKWLFMTPFGM
FT                   AMSDTCYNLYNAMYAVAHSLHEMLLQQVDTWSNNAGKELEFDSWKMFSILKTLQFVNPA
FT                   GDLVNMNQNLKQDTVYDIFYILNFQKYFGLKIKIGIFSGYLPSGQQLYMSKEMMEWATD
FT                   MDQILHSICSRPCTPGLRKSPQEGNDICCFICKPCPENEISNMTNMDQCVKCPEDQYAN
FT                   EDQTLCLQKVVDVLDYRDPLGKALAGFALCFSLLTSVVLFVFLKHRDTPIVKANNETLS
FT                   YVLPISLIFCFMCSLLYIGHPTIVICILQQTTFAIAFTAAASTVLAKTITVILAFKITA
FT                   PGRRMRWLLVSGAPKYIIFVCTMIQLIICGIWLGTSSPFVDTDVHIAHGHIIIVCNKGS
FT                   VIAFYCVLGYLGSVALASFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWITFIPVYHST
FT                   KGKTMIAVEVFSILVSSAGLLLCIFAPKCYIILLRPQKNSFYKFRKTHSKSENIS"
FT   gap             22765141..22765160
FT                   /estimated_length=20
FT   gap             22786545..22786565
FT                   /estimated_length=21
FT   gene            complement(<22789071..>22798359)
FT                   /locus_tag="mCG_59833"
FT                   /note="gene_id=mCG59833.2"
FT   mRNA            complement(join(<22789071..22789987,22792411..22792534,
FT                   22792883..22793110,22793786..22794592,22794983..22795262,
FT                   22798163..>22798359))
FT                   /locus_tag="mCG_59833"
FT                   /product="mCG59833"
FT                   /note="gene_id=mCG59833.2 transcript_id=mCT60016.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(22789071..22789987,22792411..22792534,
FT                   22792883..22793110,22793786..22794592,22794983..22795262,
FT                   22798163..22798359))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59833"
FT                   /product="mCG59833"
FT                   /note="gene_id=mCG59833.2 transcript_id=mCT60016.2
FT                   protein_id=mCP29821.2"
FT                   /db_xref="GOA:G3XA45"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR004073"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:3761311"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA45"
FT                   /protein_id="EDL06841.1"
FT                   /translation="MFSLISVIWFLKIKLMFCHLSDPSCFWRIKETENDLGDTETYCLF
FT                   SISTKQGYVKNDYFSWNIDKKVTPKTNHLIFSVYLALEEVNKNCHILPNISLLVNIECN
FT                   GRKYDEKTGLALKIENIIPNYSCTNERTYLIVLTAPIWAVSTKLGPFLFMSRIPELYCG
FT                   HFHPLLSDNEEFPHLYQISPKDTSLPLAMVSLVVHFRWNWIGVIVTSDDQGIQFLSELK
FT                   GEMQKNIVCLSVAIIIQTEMSMALKELSMNYKHISISSAKVVIVYGDKFSPINYALTLW
FT                   ISQGILRIWVSVSQFDMITILGDFLLYSSTGTFIFSHQQPEIPGFEKFIQTVYPSNYSS
FT                   EFSFAKLWWTYFRCSLPPSNCKKLKNCPTKTIFTWLFRTPFGMAMSDTCYNSYNAIYAV
FT                   AHSLHEMLMQEVDTWSNNAGKELEFDSWKMFSILKTLKFVNPAGDLVNMNQNLKQATQY
FT                   NIFYVMDFQKDYGLKMKIGRFSEHLPSGQQLYMSKEMIEWATDIDQILPSICSMPCTPG
FT                   LRKSPQEGKDICCFVCIPCPENEISNMTNMDQCVKCLEDQYANEDHTLCLQKVVAILDY
FT                   RDPLGKALAGFALCFSLLTSVVLFVFLKHRDTPIVKANNQTLSIVLLISLIFCFICSLL
FT                   YIGHPTMVICILQQTTFAIAFTVATSTILAKTITVVLAFKITVPGRRMRWLLVSGAPKY
FT                   IILICTMIQLILCGIWLGTSPPFVDADVQMVHGHIIIVCNKGSVIAFYCVLGYMGSVAL
FT                   AGFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWMTFIPVYHSTKGKTMVAVEVFCILAS
FT                   SAGLLLCIFAPKCYFILRPQTNSFHKFRKPHAKTENKS"
FT   gap             22801873..22801892
FT                   /estimated_length=20
FT   gap             22805739..22805758
FT                   /estimated_length=20
FT   gap             22814915..22814934
FT                   /estimated_length=20
FT   gap             22819526..22819545
FT                   /estimated_length=20
FT   gap             22820609..22823880
FT                   /estimated_length=3272
FT   gap             22826045..22826064
FT                   /estimated_length=20
FT   gap             22827108..22827127
FT                   /estimated_length=20
FT   gap             22830365..22830384
FT                   /estimated_length=20
FT   gap             22836206..22836225
FT                   /estimated_length=20
FT   gap             22838247..22838659
FT                   /estimated_length=413
FT   gap             22839954..22839973
FT                   /estimated_length=20
FT   gap             22841770..22843561
FT                   /estimated_length=1792
FT   gap             22850160..22850179
FT                   /estimated_length=20
FT   gap             22864927..22864946
FT                   /estimated_length=20
FT   gap             22883368..22883520
FT                   /estimated_length=153
FT   gap             22884361..22884380
FT                   /estimated_length=20
FT   gap             22885457..22885476
FT                   /estimated_length=20
FT   gap             22890719..22890738
FT                   /estimated_length=20
FT   gap             22891969..22891988
FT                   /estimated_length=20
FT   gap             22906809..22906828
FT                   /estimated_length=20
FT   gap             22908352..22908371
FT                   /estimated_length=20
FT   gap             22909522..22909541
FT                   /estimated_length=20
FT   gap             22911159..22911178
FT                   /estimated_length=20
FT   gap             22912426..22912445
FT                   /estimated_length=20
FT   gap             22919385..22919404
FT                   /estimated_length=20
FT   gap             22922786..22922805
FT                   /estimated_length=20
FT   gap             22924342..22924361
FT                   /estimated_length=20
FT   gap             22935229..22935248
FT                   /estimated_length=20
FT   gene            complement(<22942319..>22952669)
FT                   /locus_tag="mCG_21340"
FT                   /note="gene_id=mCG21340.2"
FT   mRNA            complement(join(<22942319..22943238,22945451..22945574,
FT                   22947271..22947498,22948249..22949055,22949447..22949726,
FT                   22952473..>22952669))
FT                   /locus_tag="mCG_21340"
FT                   /product="mCG21340"
FT                   /note="gene_id=mCG21340.2 transcript_id=mCT21782.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(22942319..22943238,22945451..22945574,
FT                   22947271..22947498,22948249..22949055,22949447..22949726,
FT                   22952473..22952669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21340"
FT                   /product="mCG21340"
FT                   /note="gene_id=mCG21340.2 transcript_id=mCT21782.2
FT                   protein_id=mCP7261.2"
FT                   /protein_id="EDL06840.1"
FT                   /translation="MFSLNSVFWFLKISFIFCHLSDPRCFWRIKDTENNIGDTETYCFF
FT                   SISTKHGYVKNDYFSWNLDKQVTPKTRHLIFSVYLALEEINDSFHILPNISLVVNIECV
FT                   LQKYGEKTGLLLRSEKLIPNYYCINERRYLIVLTAPTWAISTKLGPFLFMSRIPELYCG
FT                   HFHLPLSNNEQFPHLYQISKKDTSLPLAMVSLVVHFRWNWIGVIITNDDHGIQFLSELR
FT                   GEMQNNIVCLSVVITIKTQKLVALKELHMNYKQILMSSAKVVIVYGYKDSPIIYALISW
FT                   KSHGIFRIWVSVSQFDMITIRGDFLLYSSTGTFIFSHQKPEISGFEQFIQTVHPSNYSS
FT                   EFSFAKLWWTYFRCSLPPSDCKKLKNCPTKTVFKWLFMTPLGMAMSDTCYNLYNAVYGV
FT                   AHSLHEMLLQQVDAWSKNAGKELEFDPWKMFSVLKTIQFINPAGDLVNMNQNLRQDVEY
FT                   DVFYIMDFQKVYGLKMKIGRFSGQLSSGQQLYMSKEIIEWATDIDQILPSICSMPCRPG
FT                   LRKSPQEEKDICCFGCNPCPENEISNMTNMDQCVKCPENQYANEDHTLCLEKVVAVLDY
FT                   RDPLGKALAGFALCFSVLTSVVLGIFLKNRDTPIVKANNQSLSFVLLISLIFCFICSLL
FT                   YIGHPTMVICILQQTTFAIVFTVATSTILAKTVIVVLAFKITVPGRRMRWLLEIGAPKY
FT                   IILICTIIQLILCGIWLGTSPPFVDADVHMVHGHIIIVCNKGSVIAFYCVLGYMGSVAL
FT                   ASFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWITFIPVYHSTKGKTMVAVEVFSILAS
FT                   SAGLLLCIFAPKCYIILLKPQKNSFQKFRKPHAIADNIS"
FT   gap             22945072..22945091
FT                   /estimated_length=20
FT   gap             22953065..22953169
FT                   /estimated_length=105
FT   gap             22956013..22956032
FT                   /estimated_length=20
FT   gene            complement(22973333..22974243)
FT                   /pseudo
FT                   /locus_tag="mCG_59830"
FT                   /note="gene_id=mCG59830.1"
FT   mRNA            complement(22973333..22974243)
FT                   /pseudo
FT                   /locus_tag="mCG_59830"
FT                   /note="gene_id=mCG59830.1 transcript_id=mCT60013.2 created
FT                   on 01-OCT-2002"
FT   gap             22976875..22976894
FT                   /estimated_length=20
FT   gap             22982552..22982731
FT                   /estimated_length=180
FT   gap             22984341..22984360
FT                   /estimated_length=20
FT   gap             22985547..22985566
FT                   /estimated_length=20
FT   gene            <23000620..>23009723
FT                   /locus_tag="mCG_66602"
FT                   /note="gene_id=mCG66602.2"
FT   mRNA            join(<23000620..23000816,23003695..23003974,
FT                   23004238..23005044,23005737..23005964,23006367..23006433,
FT                   23008804..>23009723)
FT                   /locus_tag="mCG_66602"
FT                   /product="mCG66602"
FT                   /note="gene_id=mCG66602.2 transcript_id=mCT66785.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(23000620..23000816,23003695..23003974,
FT                   23004238..23005044,23005737..23005964,23006367..23006433,
FT                   23008804..23009723)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66602"
FT                   /product="mCG66602"
FT                   /note="gene_id=mCG66602.2 transcript_id=mCT66785.2
FT                   protein_id=mCP29974.2"
FT                   /protein_id="EDL06839.1"
FT                   /translation="MFSLISVFWFLKVNFIFCHLSDPRCFWRIKETENKLGDKETFCLF
FT                   SISTKQGYVKNDYFSWNLDKQVTPKINHLIFSVYLALEEINKNCHILPNISLLVNTECN
FT                   GRKYDEKTGLALKSEKIVPNYSCTNERRYLIVLTAPIWAVSTKLGPFLYISRIPELYCG
FT                   HFHLLLSDKGQFPHLYQISPKDTSLPLAMVSLFVHFRWNWIGVIITNDDHGIQFLSELK
FT                   GDMQKSIVCLSVAIIIQTEVYMALKELHMNYKKILMSSAKVVIVYGDKDSPIKYVLTAW
FT                   KSQGIFRIWVSASQFDMITILGDFLLYSYTGTFIFSHQQPEIPGFEKFIQTVHPSNYSS
FT                   EFSFAKLWWTYFRCSLPPSNCKKLKNCPTKSVFAWLFRTPLGMAMSDTCYNSYNAIYAV
FT                   AHSLHEMLLQEVDTWSKNAGKELEFDSWKMFSILKTLKFVNPSGDLVNMNQNLKQDTEY
FT                   DIFYIMDFQKDYGLKMKIGRFSGHLLSGQQLYMAKEMMEWATDIDQEGKDICCFVCNPC
FT                   PENEISNMTNMDQCVKCLEDQYANEDHTLCLQKVVVIFDYRDPLGKALAGFALCFSVLT
FT                   SVVLFVFFKHRDTPIVKANNQTLSFVLLISLIFCFICSLLYIGHPTMVTCIVQQITFAI
FT                   GFTVATSTILAKTVIVVLAFKITVPGRRMRWMPESGAPKYIILICTMIQLILCGIWLGT
FT                   SPPFVDADVQMVHGHIIIICNKGSVIAFYCVLGYMGSLALASFTVAFLARNLPDTFNEA
FT                   KLLTFSMLVFCSVWITFIPVYHSTKGKIMAVVEVFCILASSAGLLLCIFAPKCYIILLR
FT                   PQTNYFHKFWKSHANSENKS"
FT   gap             23010505..23010805
FT                   /estimated_length=301
FT   gap             23034145..23034164
FT                   /estimated_length=20
FT   gap             23035338..23035357
FT                   /estimated_length=20
FT   gap             23044631..23047594
FT                   /estimated_length=2964
FT   gap             23055027..23055487
FT                   /estimated_length=461
FT   gene            23078269..23095108
FT                   /pseudo
FT                   /locus_tag="mCG_1028223"
FT                   /note="gene_id=mCG1028223.1"
FT   mRNA            join(23078269..23079060,23079764..23079985,
FT                   23080322..23080445,23094198..23095108)
FT                   /pseudo
FT                   /locus_tag="mCG_1028223"
FT                   /note="gene_id=mCG1028223.1 transcript_id=mCT145927.1
FT                   created on 27-SEP-2002"
FT   gap             23098854..23099243
FT                   /estimated_length=390
FT   gene            complement(<23113354..>23130576)
FT                   /locus_tag="mCG_21339"
FT                   /note="gene_id=mCG21339.2"
FT   mRNA            complement(join(<23113354..23114273,23124715..23124838,
FT                   23125212..23125439,23126136..23126942,23127313..23127592,
FT                   23130380..>23130576))
FT                   /locus_tag="mCG_21339"
FT                   /product="mCG21339"
FT                   /note="gene_id=mCG21339.2 transcript_id=mCT21781.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(23113354..23114273,23124715..23124838,
FT                   23125212..23125439,23126136..23126942,23127313..23127592,
FT                   23130380..23130576))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21339"
FT                   /product="mCG21339"
FT                   /note="gene_id=mCG21339.2 transcript_id=mCT21781.2
FT                   protein_id=mCP7257.2"
FT                   /protein_id="EDL06838.1"
FT                   /translation="MFSLISVFWFLKISFIFCHLSDPKCFWRIKDTENKIGDIETYCSF
FT                   SISTKPGYVKNDYFSWNLDKKVTPKTNHLIFSVYLALEEINMNFHILPNISLVVNVECL
FT                   RQKYDEKTGLALQSKEFIPNYSCTNERRYLIIFTAPIWAVTTRLGPLMFMYSIPELYCG
FT                   HFHLSLSDNEQFPHLYQISPKDTSLPLAMVSLMVHFKWNWIGAMITNDDHGIQFLSKLR
FT                   GEMQKHMVCLSFVFAILTEHSMVRKEFHKNFNLIVRSSAKVVIVYGDYASPIDLVLHWF
FT                   KSKGLFRIWVSVSQFDIITNLGDFMLYSSSGTFIFSHQKPEISGFQKFIKTVYPSNYSS
FT                   EFSFAKLWWTYFRCSLPPSNCKTLKNCPTKTVFKWLFRTPLGMAMSDTCYNSYNAIHAV
FT                   AHSLHEMLLQQVDTWSNNDGKDLEFDTWKMFSILKTLQFVNPAGDLVNMNQNLKQDTEY
FT                   DIFYIMDFQKHYGFKMKIGRFSGHLPSRQQLYMSKEMMEWATDVDQILPSACNIPCKPG
FT                   FRKSPEEEMDICCFVCNPCPENEISNMTNMDQCVKCREDQYANEDHTLCLQKVVSILDY
FT                   REPLGKALAGFALCFSVLTSGIFCVFLKHRETPIVKANNQTLSYVLLISLIFCFICSLL
FT                   YIGHPTTVICILQQTTFAIAFTVATSTILAKTITVLLAFKITIPGRRMRWLLVSGAPKY
FT                   IILICTMIQLILCGIWLGTSPPYVDADVHMVHGHIIIVCNKGSVIAFYCVLGYMGSFAL
FT                   TSFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWITFIPVYQSTKGKTMVAVEVFCILAS
FT                   SAGLLLCIFAPKCYIILLRPHINSFRNFRKPHAKTENIS"
FT   gap             23132807..23132826
FT                   /estimated_length=20
FT   gap             23175412..23175431
FT                   /estimated_length=20
FT   gene            complement(23186252..>23186971)
FT                   /locus_tag="mCG_1028321"
FT                   /note="gene_id=mCG1028321.0"
FT   mRNA            complement(23186252..>23186971)
FT                   /locus_tag="mCG_1028321"
FT                   /product="mCG1028321"
FT                   /note="gene_id=mCG1028321.0 transcript_id=mCT146025.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(23186561..>23186971)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028321"
FT                   /product="mCG1028321"
FT                   /note="gene_id=mCG1028321.0 transcript_id=mCT146025.1
FT                   protein_id=mCP88652.0"
FT                   /protein_id="EDL06837.1"
FT                   /translation="EIPIVKASNQTLSYALLTSLIFYFICSLLYIGHPIMVIFILQQTM
FT                   FAIMFTVAASTVFAKTITVVLAFKITVPARIWKWHLVSGAPKCIILIYTMMQPILCGIW
FT                   MGTSPTIVDAVLHMVHGHIITVCNKDSIIPFY"
FT   gap             23202804..23202823
FT                   /estimated_length=20
FT   gap             23207378..23207436
FT                   /estimated_length=59
FT   gap             23217250..23217385
FT                   /estimated_length=136
FT   gap             23219346..23219552
FT                   /estimated_length=207
FT   gene            complement(<23227954..>23246327)
FT                   /locus_tag="mCG_3424"
FT                   /note="gene_id=mCG3424.2"
FT   mRNA            complement(join(<23227954..23228870,23240146..23240269,
FT                   23240606..23240833,23241863..23242672,23243044..23243323,
FT                   23246131..>23246327))
FT                   /locus_tag="mCG_3424"
FT                   /product="mCG3424"
FT                   /note="gene_id=mCG3424.2 transcript_id=mCT1366.2 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(23227954..23228870,23240146..23240269,
FT                   23240606..23240833,23241863..23242672,23243044..23243323,
FT                   23246131..23246327))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3424"
FT                   /product="mCG3424"
FT                   /note="gene_id=mCG3424.2 transcript_id=mCT1366.2
FT                   protein_id=mCP7277.1"
FT                   /db_xref="GOA:D3Z7M3"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR004073"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:3646433"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7M3"
FT                   /protein_id="EDL06836.1"
FT                   /translation="MFSLIFIFWFLKISYIFCHLSNPRCFWRIKDTKDKLGDKETYCFF
FT                   SISAKHGYIRNDYFSWNLDKHVTPKTNHLIFSVYLALEEINKNSHILPNISLVVNIECV
FT                   LLKYGEKTGLGLKHEEFIPNYYCANERRYLIVLTAPIWAVSTKLGPFLFMSRIPELYCG
FT                   HFHLPLSDNEQFPHLYQISPKDTSLPLAMVSLVVHFRWNWIGVIITNDNHGIQFLSELR
FT                   GETQKQIVCLSVVIIIQTDDITAYKEYHMNYNKIVMSSAKVVIVYGDHNSPIKFVLFLW
FT                   KSQGIFRIWVSVSQFDMITPLGDFMLYSASGTLIFSHQQSELSGFEKFIKTVKPSNYSS
FT                   EFSFAKLWWTYFRCSSLPPSNCKKLKNCPTKTVFRWLFMTPLGMAMSDTCYNLYNAIYA
FT                   VAHSLHEMLLQQVDTWSENAGKELEFDSWKMFSILKTMQFVNPAGDLVNMNQNLKQERE
FT                   YDIFYIMDFQKDYGLKMKIGKFSGHLPSHQQLYMSKEMIEWATDMDQILPSICSMPCRP
FT                   GLRKSPQEGKDICCFVCNPCPENEISNMTNMDQCVKCPEDQYANEDHTLCLQKIVAILD
FT                   YRDPLGKALAGFALCFCVITSGVLCIFLKHRETPIVKANNQTLSYVLLISLIFCFICSL
FT                   LYIGHPTIVICVLQQSTFAISFTVAASTILAKTITVVLAFKVTVPGRMRWLLVAGAPKY
FT                   IILICTMIQLILCGVWLGTSPPFVDADLHMVHGHIIIVCNKGSVIAFYFVLGYMGSIAL
FT                   ASFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWVTFIPVYYSTKGKTMVAVEVFCILAS
FT                   SAGLLLCIFAPKCYNILLRPGKNSSHMFKKLHAKTENII"
FT   gap             23241473..23241492
FT                   /estimated_length=20
FT   gap             23282705..23282724
FT                   /estimated_length=20
FT   gap             23286021..23286116
FT                   /estimated_length=96
FT   gap             23293771..23293881
FT                   /estimated_length=111
FT   gap             23337290..23337459
FT                   /estimated_length=170
FT   gap             23339463..23339613
FT                   /estimated_length=151
FT   gene            complement(<23344892..>23354549)
FT                   /locus_tag="mCG_3426"
FT                   /note="gene_id=mCG3426.2"
FT   mRNA            complement(join(<23344892..23345808,23348553..23348676,
FT                   23348920..23349147,23349847..23350653,23351040..23351319,
FT                   23354281..>23354549))
FT                   /locus_tag="mCG_3426"
FT                   /product="mCG3426"
FT                   /note="gene_id=mCG3426.2 transcript_id=mCT1368.2 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(23344892..23345808,23348553..23348676,
FT                   23348920..23349147,23349847..23350653,23351040..23351319,
FT                   23354281..23354549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3426"
FT                   /product="mCG3426"
FT                   /note="gene_id=mCG3426.2 transcript_id=mCT1368.2
FT                   protein_id=mCP7296.2"
FT                   /protein_id="EDL06835.1"
FT                   /translation="MLMHVYLNVCAAFYSGRYLADRKKMFFLNSVFWLLKISFNFGHLS
FT                   DPRCFWRIKDTENKLGDKETYCFFTISTKHGYVKNDYFRWNLDKKVTPKTRHLIFSVYL
FT                   ALEEINKNCHILPNISLVVNIECVLDKHDEKTDFLFKSEDLIPNYYCKNERRYLIVLTA
FT                   PLWAVSSSIGPYLFMSRIPELYCGHFHLPLSDNEQYPHLHQISRKDTFLPLAMVSLVVH
FT                   FRWNWIGVIVTNDDHGIQFLSELRGEMQNKIVCLSFAIIIKTGKFLAVTELHMNYKQIL
FT                   MSSAKVVIVYGYRDSPIIYAFIVWKSQDLFRIWVSVSQLDMITFLGDFLLYASTGTFIF
FT                   SHQKPEISGFEQFIQRIHPSNYSSEFSLAKQWWTYFRCSLPPSNCKKLKNCSTKTVFKW
FT                   LFMTPLGLAMSDTCYNIYNAMYAVAHSLHGMLLQQVDTWSKNAGKELEFDSWKMFSILK
FT                   TLKFVNPAGDLVNMNQNLKQDVEFDVFYIMDFQKDYGLKMKIGRFSEHLPSGQQIYMSK
FT                   EMIEWATDIDQILPSICTMPCRPGLRKSPQEGKDICCFDCKPCSENEVSNMTNMDQCVK
FT                   CPEDQYANEDHTVCLQKVVAILDYRDPLGKALAGFALCFSVLTSLVLVVFLKHRDTPIV
FT                   KANNQTLSFVLLISLIFCFICSLLYIGHPTMAICILQQTTFAIVFTVATSTILSKTVIV
FT                   ILAFKITVPGRRMRWLLESGTPKYIIPICTIIQLILCGIWLGTSPPFVDADLHMVHGHI
FT                   LIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWIT
FT                   FIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYIILLRPQKNYFYKFRKRRELN
FT                   LTT"
FT   gap             23372239..23372390
FT                   /estimated_length=152
FT   gene            complement(23379988..>23385917)
FT                   /locus_tag="mCG_1028317"
FT                   /note="gene_id=mCG1028317.0"
FT   mRNA            complement(join(23379988..23380623,23385629..>23385917))
FT                   /locus_tag="mCG_1028317"
FT                   /product="mCG1028317"
FT                   /note="gene_id=mCG1028317.0 transcript_id=mCT146021.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(23380141..>23380623)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028317"
FT                   /product="mCG1028317"
FT                   /note="gene_id=mCG1028317.0 transcript_id=mCT146021.0
FT                   protein_id=mCP88616.0"
FT                   /protein_id="EDL06834.1"
FT                   /translation="LYIGHHIMNRLSCSRQHFPILLTMASSTVFTKTVTLVLAFKIIFV
FT                   RKKDWGLLLSGKPNYIILICSLIQMTLCGISLGFSPPFVHVDVYMVHDHIIFFCSNGLL
FT                   LAFYYVLGYMGSVAAFNFTVAFLAMNLSDTYSESKRLTLSMLTFCSVWINILPNHH"
FT   gap             23380624..23383527
FT                   /estimated_length=2904
FT   gap             23386411..23386430
FT                   /estimated_length=20
FT   gap             23387454..23387473
FT                   /estimated_length=20
FT   gap             23419922..23420093
FT                   /estimated_length=172
FT   gene            23421810..23422686
FT                   /pseudo
FT                   /locus_tag="mCG_1028184"
FT                   /note="gene_id=mCG1028184.1"
FT   mRNA            23421810..23422686
FT                   /pseudo
FT                   /locus_tag="mCG_1028184"
FT                   /note="gene_id=mCG1028184.1 transcript_id=mCT145888.1
FT                   created on 27-SEP-2002"
FT   gap             23425956..23426089
FT                   /estimated_length=134
FT   gap             23427630..23432623
FT                   /estimated_length=4994
FT   gap             23434508..23434820
FT                   /estimated_length=313
FT   gene            complement(23448529..>23458616)
FT                   /locus_tag="mCG_54398"
FT                   /note="gene_id=mCG54398.2"
FT   mRNA            complement(join(23448529..23448871,23452672..23452795,
FT                   23453142..23453351,23454066..23454872,23455259..23455538,
FT                   23458420..>23458616))
FT                   /locus_tag="mCG_54398"
FT                   /product="mCG54398"
FT                   /note="gene_id=mCG54398.2 transcript_id=mCT54581.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(23448783..23448871,23452672..23452795,
FT                   23453142..23453351,23454066..23454872,23455259..23455538,
FT                   23458420..23458616))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54398"
FT                   /product="mCG54398"
FT                   /note="gene_id=mCG54398.2 transcript_id=mCT54581.2
FT                   protein_id=mCP29972.2"
FT                   /protein_id="EDL06833.1"
FT                   /translation="MFCLISVFWFLKINFIFCHFSDPRCFWRIKDTKNDLGDKETYCLF
FT                   FISTKQGYVKNDYFSWNLDKQVTPKMNHLIFSVYLALEEINKNCHILPNISLLVNIECN
FT                   GEKYDEKTDLALKSEDIIPNYSCTNERRYLIILTAPIWAVSTKLGPFLYISRIPELYCG
FT                   HFHLLLSDNEQFPHLHQISPKDTSLPLAMVSLVVHFRWNCIGAIISNDDQGIQFLFELK
FT                   GEMQKNIVCLSVAIIIQTEMSMALKELSMNYKHISMSSAKVVIVYGDKFSPIKNALNVW
FT                   ISQGILRIWVSVSQFDMITILGDFLLYSSTGTFIFSHQQPEIPGFEKFIQTVHPSNYSS
FT                   EFSFAKLWWTFFRCSLPPSNCKKLKNCPTKTIFTWLFRTPLGMAMSDTCYNSYNFIYAV
FT                   AHSLHEMRLQEEDTWSKNAAKELEFDSWKTLKFVNPAGELVNMNQNLKQDTEYDIFYIM
FT                   DFQKDYGLKMKIGRFSGHLPSGQQLYMSKEMMEWATDIDQILPSICSMPCTPGLRKSPQ
FT                   EGKDICCFVCIPCPENEISNMTNKDQCVKYPEDQNANENQTACLPAKNCLF"
FT   gap             23460358..23460653
FT                   /estimated_length=296
FT   gap             23462150..23462169
FT                   /estimated_length=20
FT   gap             23467492..23478261
FT                   /estimated_length=10770
FT   gap             23480822..23481391
FT                   /estimated_length=570
FT   gap             23505207..23505226
FT                   /estimated_length=20
FT   gap             23513418..23513437
FT                   /estimated_length=20
FT   gene            23514308..23515149
FT                   /pseudo
FT                   /locus_tag="mCG_1028312"
FT                   /note="gene_id=mCG1028312.1"
FT   mRNA            23514308..23515149
FT                   /pseudo
FT                   /locus_tag="mCG_1028312"
FT                   /note="gene_id=mCG1028312.1 transcript_id=mCT146016.1
FT                   created on 27-SEP-2002"
FT   gap             23528624..23528778
FT                   /estimated_length=155
FT   gene            complement(<23535967..>23559663)
FT                   /locus_tag="mCG_3425"
FT                   /note="gene_id=mCG3425.2"
FT   mRNA            complement(join(<23535967..23536883,23551095..23551218,
FT                   23552003..23552230,23552922..23553728,23554100..23554379,
FT                   23559458..>23559663))
FT                   /locus_tag="mCG_3425"
FT                   /product="mCG3425"
FT                   /note="gene_id=mCG3425.2 transcript_id=mCT1367.2 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(23535967..23536883,23551095..23551218,
FT                   23552003..23552230,23552922..23553728,23554100..23554379,
FT                   23559458..23559663))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3425"
FT                   /product="mCG3425"
FT                   /note="gene_id=mCG3425.2 transcript_id=mCT1367.2
FT                   protein_id=mCP7298.2"
FT                   /db_xref="GOA:G5E8Z7"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR004073"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:3648311"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8Z7"
FT                   /protein_id="EDL06832.1"
FT                   /translation="MKNTFSLISVFWFLKISIIFCHLSDPRCFWRIKDAKNDLGDKETY
FT                   CFFSIYTKQGYVKNDYFSWNLDKKVTPKTNHLIFSVYLAMEEINKNGHILPNISLLVNI
FT                   ECGLELYGERTGLAFKSEEFIPNYYCRNHRKYLIVLTTPKWGVSTSLGPLLYISRVPEL
FT                   YCGHFHLLLNDNEQFPHLYQISPKDTSLPLAMVSLVVHFRWNWIGAIVTNDDHGIQFLS
FT                   ELRGEMQKHIVCLSVAIIIQTEKFMALKEFRMNYNKIAMSSATVVIVYGDKDSPIQFTL
FT                   IMWKSEGIWRIWVSVSQFDMITVIGDFLLYSSTGSFIFSHQQSEISGFEKFIQTVHPSN
FT                   YSSEFSLAKLWWTYFTCSLPPSNCKKLKNCPIKTVFKWLFMTPIGMSMSDISYNLYNAM
FT                   YAVAHSVHEMLLQQVDIWSTNAGTELEFDSWKMFSILKTLKFVNPAGDLVNMNQNLKQD
FT                   TEYDIFYIPNFQKYYGLKMKIGRFSGYLPSGQQLYMSKEMMEWATDMDQILPSICSMPC
FT                   RPGLRKSPQEEKDICCFVCNPCPENEISNMTNMDQCVKCPEDQYANEDQTLCLQKVVDV
FT                   LDYRDPLGKSLAGFALCFSVLTSIVLCVFLKHRESPIVKANNQTLSYVLLISLIFCFIC
FT                   SLLYIGHPTMFICILQQTAFAIAFTVAASTVLAKTITVILAFKITVPGRMRWLLVSGAP
FT                   KYIIFVCTMIQLIFCGIWLGTSPPFVETDVHMTHGHIIIVCNKGSVIAFYCVLGYMGSV
FT                   ALASFTVAFLSRKLPDTFNEAKLLTFSMLVFCSVWITFIPVYHSTKGKTMVAVEVFCIL
FT                   ASSAGLLLCIYAPKCYIILLRPQKNSFYKFRKPHSKSENIS"
FT   gene            23569161..23570067
FT                   /pseudo
FT                   /locus_tag="mCG_1028310"
FT                   /note="gene_id=mCG1028310.0"
FT   mRNA            23569161..23570067
FT                   /pseudo
FT                   /locus_tag="mCG_1028310"
FT                   /note="gene_id=mCG1028310.0 transcript_id=mCT146014.1
FT                   created on 30-OCT-2002"
FT   gene            complement(23573659..23574532)
FT                   /pseudo
FT                   /locus_tag="mCG_141202"
FT                   /note="gene_id=mCG141202.0"
FT   mRNA            complement(23573659..23574532)
FT                   /pseudo
FT                   /locus_tag="mCG_141202"
FT                   /note="gene_id=mCG141202.0 transcript_id=mCT173752.0
FT                   created on 27-SEP-2002"
FT   gap             23575139..23575556
FT                   /estimated_length=418
FT   gap             23605687..23605706
FT                   /estimated_length=20
FT   gap             23607218..23607237
FT                   /estimated_length=20
FT   gene            complement(<23615152..>23621240)
FT                   /locus_tag="mCG_61529"
FT                   /note="gene_id=mCG61529.2"
FT   mRNA            complement(join(<23615152..23616059,23618127..23618250,
FT                   23618605..23618832,23619736..23619821,23620086..23620542,
FT                   23620938..>23621240))
FT                   /locus_tag="mCG_61529"
FT                   /product="mCG61529"
FT                   /note="gene_id=mCG61529.2 transcript_id=mCT61712.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(23615152..23616059,23618127..23618250,
FT                   23618605..23618832,23619736..23619821,23620086..23620542,
FT                   23620938..23621240))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61529"
FT                   /product="mCG61529"
FT                   /note="gene_id=mCG61529.2 transcript_id=mCT61712.2
FT                   protein_id=mCP29956.2"
FT                   /protein_id="EDL06831.1"
FT                   /translation="MNIVICFRLTTKNIHLILSLYFAIEEINMSPHLLPNISLLVKVEC
FT                   KLLADGSKVSLSSRRGDYFPNYNCGNHRRYLIVLTGPMWLPTAMLGPLLYISRTPELYY
FT                   GPFHPLLSSFEHFPYLYQIAIKDTSVAIGMVSLVIYFGWNWVGLMISDDGLGLQFASEL
FT                   REEMQRYDICLAFVTIITYNTKLFLTMTDTYYNQIMMSLAKAVIIFGDKDSLLQVIFRL
FT                   WQFLDIRRIWVTTSQWDIITSNGEFLFNSFHAHSLNELLLQQANTLSNNVGKGLEFDSL
FT                   QVLSSLKNIHFVNPAGDLVNLNQKENMNINYDIFYTGNFLQSFGIKVKIGKFFKYFTHP
FT                   QELLMYEELVDWATDVRQTLPSICSIPCHPGFRKSPQEGKAVCCFDCIPCPENEISNMT
FT                   DMDYCFKCPDNQYANPEGTHCLSKIVTFLSYEDPMGVVLACLALGFSALTAAVFGIFLR
FT                   NQDTPIVKANNRALSYCLLISLIYCFLCSLLFIGQPHILTCIMQQTIFAVVFTVAISTV
FT                   LTKTITVVLAFRFTLPSKRMRWLMTSGASILIIPICTMIQLIICGIWLGTSPPFVDSDG
FT                   HIEHGHILVVCNKGSVIAFYCVLGYLGSIALTSFTVAFLARNLPDTFNEAKFLTFSMLV
FT                   FCSVWLTFLPVYHSTNGKALVAVEVFCILTSTAGIFLCIFAPKCYIILLKPENKSFHKF
FT                   RHKNANV"
FT   gap             23655172..23655191
FT                   /estimated_length=20
FT   gene            complement(<23658730..>23659728)
FT                   /locus_tag="mCG_1028309"
FT                   /note="gene_id=mCG1028309.1"
FT   mRNA            complement(<23658730..>23659728)
FT                   /locus_tag="mCG_1028309"
FT                   /product="mCG1028309"
FT                   /note="gene_id=mCG1028309.1 transcript_id=mCT146013.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(23658730..23659728)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028309"
FT                   /product="mCG1028309"
FT                   /note="gene_id=mCG1028309.1 transcript_id=mCT146013.1
FT                   protein_id=mCP88907.1"
FT                   /db_xref="GOA:Q7TS00"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS00"
FT                   /protein_id="EDL06830.1"
FT                   /translation="MANSTLVTEFFLEVFAEIWELRILITVLFLLVYLCSLLGNLTIII
FT                   VTTVDQTLNTPMYFFLRNLSILDMGYISITVPSTCINSLTNHRNMSVAGCAAQIFSFLF
FT                   CACVEILFLSIMAQDRYVAICKPLLYPVIMNHQFCVQMTLASLLSSLVIASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDLPALLRLSCSDTFSNKLLILLTVIGVSGSCFVFIAISYIHILST
FT                   VLKIPVKGERGKAFSTCVPHIIVVSVFVSSAAFVYLRPPVITFEVVQEMVISVFYTMVP
FT                   PFLNPIVYSLRNKQIKEAVRKVILRVFPIFEYKRNIYLSWYFRGKKTDKVR"
FT   gene            complement(<23696161..>23697087)
FT                   /gene="Olfr309"
FT                   /locus_tag="mCG_1028183"
FT                   /note="gene_id=mCG1028183.1"
FT   mRNA            complement(<23696161..>23697087)
FT                   /gene="Olfr309"
FT                   /locus_tag="mCG_1028183"
FT                   /product="olfactory receptor 309"
FT                   /note="gene_id=mCG1028183.1 transcript_id=mCT145887.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(23696161..23697087)
FT                   /codon_start=1
FT                   /gene="Olfr309"
FT                   /locus_tag="mCG_1028183"
FT                   /product="olfactory receptor 309"
FT                   /note="gene_id=mCG1028183.1 transcript_id=mCT145887.1
FT                   protein_id=mCP88776.1"
FT                   /db_xref="GOA:Q7TS01"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030143"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS01"
FT                   /protein_id="EDL06829.1"
FT                   /translation="MMNFSIVSEFMILGLTQKSELQGILFIVFLFIYLVALLGNMLIVV
FT                   AIIYNTTLHTPMYILLLALAVVDIICTTSIIPKMLGTMLTSKNSISYGGCMSQLFFFTW
FT                   SLGAEMVLFTTMAYDRYVAICFPLRYSTIMNHYTCVGLLSIVMAIAVTNSWVHTGLILR
FT                   LTFCGPNIIDHFFCEIPPLLALSCSPVRVNEVMVYVADITLAVGDFTLTCISYGFIIAA
FT                   ILRIRTTEGKKKAFSTCSSHLMVVSLYYSPVIYTYIRPASSYTFDKDKVVAALYTLVTP
FT                   TLNPIVYSFRNKEMQSGIKKVFAFLKG"
FT   gap             23705376..23705503
FT                   /estimated_length=128
FT   gene            complement(<23711066..>23711992)
FT                   /gene="Olfr308"
FT                   /locus_tag="mCG_141200"
FT                   /note="gene_id=mCG141200.0"
FT   mRNA            complement(<23711066..>23711992)
FT                   /gene="Olfr308"
FT                   /locus_tag="mCG_141200"
FT                   /product="olfactory receptor 308"
FT                   /note="gene_id=mCG141200.0 transcript_id=mCT173746.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(23711066..23711992)
FT                   /codon_start=1
FT                   /gene="Olfr308"
FT                   /locus_tag="mCG_141200"
FT                   /product="olfactory receptor 308"
FT                   /note="gene_id=mCG141200.0 transcript_id=mCT173746.0
FT                   protein_id=mCP96664.0"
FT                   /db_xref="GOA:Q8VFP2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030142"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFP2"
FT                   /protein_id="EDL06828.1"
FT                   /translation="MITENWTLAQDFLLLGFPGSQVLQFSLFLFFLVMYLLTIGGNMAI
FT                   LLLVSTSHQLQTPMYFFLSNLSFLEIWYTTAAVPKALAILVGKSQSISFLGCLFQMYLV
FT                   FSLGCTEYFLLAAMAYDRYLAICFPLHYQTIMNSLLSAQLALSSWICGFLAISVPAALI
FT                   STLSFCGTHAINHFFCDIAPWIALACTSTQGVETVAFVIAFVVILSSCLITLISYAYII
FT                   RTILRIPSTSGRRKAFSTCSSHLTVVLIWYGSTIFLHVRTSIKDDLQLTKAVHVLNTVV
FT                   TPALNPFIYTLRNKEVREILGKKWKRK"
FT   gene            complement(<23725474..>23726415)
FT                   /gene="Olfr307"
FT                   /locus_tag="mCG_141199"
FT                   /note="gene_id=mCG141199.0"
FT   mRNA            complement(<23725474..>23726415)
FT                   /gene="Olfr307"
FT                   /locus_tag="mCG_141199"
FT                   /product="olfactory receptor 307"
FT                   /note="gene_id=mCG141199.0 transcript_id=mCT173745.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(23725474..23726415)
FT                   /codon_start=1
FT                   /gene="Olfr307"
FT                   /locus_tag="mCG_141199"
FT                   /product="olfactory receptor 307"
FT                   /note="gene_id=mCG141199.0 transcript_id=mCT173745.0
FT                   protein_id=mCP96665.0"
FT                   /db_xref="GOA:Q8VFN8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFN8"
FT                   /protein_id="EDL06827.1"
FT                   /translation="MPNITAFTGFLLTAFFDSQELQTLWGVFFLGIYLEALMSNLIIIT
FT                   LITLDLQLQTPMYFFLKNLSLLDVFFVSVPIPKFVVNSLIHNNSISVLACAFQVFLMTS
FT                   FSSGEVFVLTAMSYDRYVAICFPLNYGAIMNNHTCVLMMGVSWATGMLFGAIYTAGTFS
FT                   MPFCGSNVIPQFFCDVPSLLRISCSETLVAIYSCLGIGVCLGMSCFICVVISYFYIFST
FT                   VLKIPTTKGQSKAFATCIPHLTVFTVFLVTACFVYLKPFTNTLSISERLFSVLYTVLPP
FT                   ALNPLIYSLRNTDVKSALRRLQQNLCLRRLLI"
FT   gap             23732599..23732757
FT                   /estimated_length=159
FT   gap             23751280..23751299
FT                   /estimated_length=20
FT   gene            complement(<23753413..>23754372)
FT                   /gene="Olfr305"
FT                   /locus_tag="mCG_141196"
FT                   /note="gene_id=mCG141196.0"
FT   mRNA            complement(<23753413..>23754372)
FT                   /gene="Olfr305"
FT                   /locus_tag="mCG_141196"
FT                   /product="olfactory receptor 305"
FT                   /note="gene_id=mCG141196.0 transcript_id=mCT173738.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(23753413..23754372)
FT                   /codon_start=1
FT                   /gene="Olfr305"
FT                   /locus_tag="mCG_141196"
FT                   /product="olfactory receptor 305"
FT                   /note="gene_id=mCG141196.0 transcript_id=mCT173738.0
FT                   protein_id=mCP96657.0"
FT                   /db_xref="GOA:Q7TS02"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030139"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS02"
FT                   /protein_id="EDL06826.1"
FT                   /translation="MPNVTAVTGFILMGFSDIHELQILCGVLFLVLYLGILMSNLLIII
FT                   LITVDLKLQTPMYFFLKNLSLLDVFLVSVTIPNFFVNSLMHKNSISILGCAFQVFFMAL
FT                   LGSGEVFVLTTMSYDRYVAICSPLHYEVIMNSVTCVVMMSVSWGTGLFFGVMYTAGTFS
FT                   MTFCGSNVIPQIFCDVPSLLRISCSGSLMIIYISLGIGVCLGMSCFICVVISYIYIFST
FT                   VLKIPTTKGQSKAFGTCIPHLTVFSVFIATACFVYLKPPSNSASLTDRLFSVLYTVLPP
FT                   ALNPVIYSLRNNDVDSALKRLLQNLYSRDFLHVIHQNV"
FT   gene            complement(<23775670..>23776560)
FT                   /gene="Olfr304"
FT                   /locus_tag="mCG_141195"
FT                   /note="gene_id=mCG141195.0"
FT   mRNA            complement(<23775670..>23776560)
FT                   /gene="Olfr304"
FT                   /locus_tag="mCG_141195"
FT                   /product="olfactory receptor 304"
FT                   /note="gene_id=mCG141195.0 transcript_id=mCT173739.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(23775670..23776560)
FT                   /codon_start=1
FT                   /gene="Olfr304"
FT                   /locus_tag="mCG_141195"
FT                   /product="olfactory receptor 304"
FT                   /note="gene_id=mCG141195.0 transcript_id=mCT173739.0
FT                   protein_id=mCP96658.0"
FT                   /protein_id="EDL06825.1"
FT                   /translation="MSNLLIITVITLDLKLQTPMYFFLKNLSLLDVFLVSIPIPKFIIN
FT                   NLTHNNYISILGCAFQILLMTSFSAGEIFVLTAMSYDRYVAICSPLCYEAIMSSGNCVL
FT                   MVGVSWATGILFGALYTAGTFSMPFCGSMVIPQFFCDVPSLLRISCSGSLMIIYISLGI
FT                   GMCLCMSCFYCVMISYFYIISTVLKIPTTRGQSKAFATCIPHLTVFSVFIATACFVYLK
FT                   PPSDIPSITDRLFSVLYTVLPPALNPVIYSLRNSDVKCSLRRLQQNLCPRDSYYLTVQR
FT                   FCQCYSASQVTSKCF"
FT   gap             23777521..23777540
FT                   /estimated_length=20
FT   gene            complement(<23784649..>23785452)
FT                   /gene="Olfr303"
FT                   /locus_tag="mCG_58475"
FT                   /note="gene_id=mCG58475.1"
FT   mRNA            complement(<23784649..>23785452)
FT                   /gene="Olfr303"
FT                   /locus_tag="mCG_58475"
FT                   /product="olfactory receptor 303"
FT                   /note="gene_id=mCG58475.1 transcript_id=mCT58658.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(23784649..>23785452)
FT                   /codon_start=1
FT                   /gene="Olfr303"
FT                   /locus_tag="mCG_58475"
FT                   /product="olfactory receptor 303"
FT                   /note="gene_id=mCG58475.1 transcript_id=mCT58658.2
FT                   protein_id=mCP29978.2"
FT                   /protein_id="EDL06824.1"
FT                   /translation="STLQTPMYIFLGNLSFLEIWYTTATVPKLLATCVTKVVTIPVAGC
FT                   ITQYYFFFSLGATECILLAVMAYDRHVAVCRPLHYSLLMSVHICLRFSAASWVGGFLAP
FT                   LLPTILISQLNFCGPQKINHFFCDSDPIFKLSCSDTFLVEALGYTCSSVVILSSFLLTM
FT                   SSYGNIVVTIIRLSSREARKKTFSTCASHLTVVTIYYGTIIFAYVRPPAKYNFTIGKVV
FT                   SVFYCVITPLVNPLIYTLRNKDVMKAFQKFLSQKKFLMGKNMHGL"
FT   gap             23802663..23804984
FT                   /estimated_length=2322
FT   gene            <23805114..>23806049
FT                   /gene="Olfr301"
FT                   /locus_tag="mCG_64685"
FT                   /note="gene_id=mCG64685.2"
FT   mRNA            <23805114..>23806049
FT                   /gene="Olfr301"
FT                   /locus_tag="mCG_64685"
FT                   /product="olfactory receptor 301"
FT                   /note="gene_id=mCG64685.2 transcript_id=mCT64868.2 created
FT                   on 27-SEP-2002"
FT   CDS             23805114..23806049
FT                   /codon_start=1
FT                   /gene="Olfr301"
FT                   /locus_tag="mCG_64685"
FT                   /product="olfactory receptor 301"
FT                   /note="gene_id=mCG64685.2 transcript_id=mCT64868.2
FT                   protein_id=mCP29895.2"
FT                   /db_xref="GOA:Q7TS04"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030135"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS04"
FT                   /protein_id="EDL06823.1"
FT                   /translation="MSNSTLVTEFMLEDFAENWELRILLSVLFLLVYLYSLIGNLIIII
FT                   ATTVDQTLNTPMYFFLRNLSILDICYVSVTVPNACINSLTDHRNISVGGCAAQIFFVYI
FT                   CACVEILFLTIMAQDRYVAICKPLLYPVIMNHWFCVQMTLASLLSSLVLASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDIPSLLRLSCSDTFNNKLLILLSAILVSGSCFVFIVISYVRILST
FT                   VLKVPVKGERGKAFSTCVPHIIVVSVFLSSAAYIYLKPPVVTLEVAKEMTLSVFYTIVP
FT                   PFLNPIIYSLRNRQIKKAVSKLISRIFFLI"
FT   gap             23807542..23807561
FT                   /estimated_length=20
FT   gap             23813156..23814923
FT                   /estimated_length=1768
FT   gene            <23832069..>23833040
FT                   /locus_tag="mCG_61527"
FT                   /note="gene_id=mCG61527.2"
FT   mRNA            <23832069..>23833040
FT                   /locus_tag="mCG_61527"
FT                   /product="mCG61527"
FT                   /note="gene_id=mCG61527.2 transcript_id=mCT61710.2 created
FT                   on 27-SEP-2002"
FT   CDS             <23832408..23833040
FT                   /codon_start=1
FT                   /locus_tag="mCG_61527"
FT                   /product="mCG61527"
FT                   /note="gene_id=mCG61527.2 transcript_id=mCT61710.2
FT                   protein_id=mCP29927.2"
FT                   /protein_id="EDL06822.1"
FT                   /translation="RLFLFHGPGSLCGHFKPLLYPVIMNHQFCVQMTLASLLSSLVIAS
FT                   VHTFKTFQLSFCHSNVIPQFFCDLPALLRLSCSDTFNNNLLILPTDIGVSGSCFVFIAI
FT                   SYIRILSTVLKIPIKRERGKAFSTCVPHIIVVSVFVSSAAYVYLRPPVITFEVVQEMIV
FT                   SVFYTMVPPFLNPIIYSLRNKQIKEAVRKVMSQVFPIFEYKRNNYFS"
FT   gene            <23854478..>23855470
FT                   /gene="Olfr299"
FT                   /locus_tag="mCG_58071"
FT                   /note="gene_id=mCG58071.1"
FT   mRNA            <23854478..>23855470
FT                   /gene="Olfr299"
FT                   /locus_tag="mCG_58071"
FT                   /product="olfactory receptor 299"
FT                   /note="gene_id=mCG58071.1 transcript_id=mCT58254.2 created
FT                   on 27-SEP-2002"
FT   CDS             23854478..23855470
FT                   /codon_start=1
FT                   /gene="Olfr299"
FT                   /locus_tag="mCG_58071"
FT                   /product="olfactory receptor 299"
FT                   /note="gene_id=mCG58071.1 transcript_id=mCT58254.2
FT                   protein_id=mCP29915.2"
FT                   /db_xref="GOA:Q7TS05"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030133"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS05"
FT                   /protein_id="EDL06821.1"
FT                   /translation="MNNSTLVTEFLLEVFAESCELRILLSVLFLLVYLGSLFGNLIIII
FT                   VTTVDQTLNTPMYFFLRNLSIVDMCYVSVTVPNACFNSLTGQRNISVTGCAAQIFFVFF
FT                   CACVEMFFLTIMAQDRYVAICKPLLYPVIMNHQFCVQMTLASLHSSLIIASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDIPSLLKLSCSDTFNNKLLMLISAIIIGCSCFTFIAVSYFRILST
FT                   VLKVPVKGERGKAFSTCVPHIVVVSVFLSSSTYVYLRPPVPTLEVVKEMALSVSYTIVP
FT                   PFLNPIIYSLRNRQIKEAVKKVILRISLVFEYKRNEYLLEFSRVRKLKK"
FT   gene            complement(<23877633..>23878631)
FT                   /locus_tag="mCG_1028220"
FT                   /note="gene_id=mCG1028220.1"
FT   mRNA            complement(<23877633..>23878631)
FT                   /locus_tag="mCG_1028220"
FT                   /product="mCG1028220"
FT                   /note="gene_id=mCG1028220.1 transcript_id=mCT145924.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(23877633..23878631)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028220"
FT                   /product="mCG1028220"
FT                   /note="gene_id=mCG1028220.1 transcript_id=mCT145924.1
FT                   protein_id=mCP89106.1"
FT                   /db_xref="GOA:Q7TS06"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030132"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS06"
FT                   /protein_id="EDL06820.1"
FT                   /translation="MSNDTRITGFILMGFSAAPELQTVCGLFFLVMYVAVIMSNLLLIT
FT                   LITLDLKLQTPMYFFLKNLSLLDIFFISVPIPNFFINSITHNNSISILGCALQVFLMTS
FT                   FASGDVFVLTAMSYDHYVAICCPLHYETIMSSGNCVLMVGVSWAIGVLFGALYTAGTFS
FT                   MPFCGSIVIPQFFCDVPSLLRISCSDILVVIYTSLGMGVCLGMSCFICVVISYFYIFST
FT                   VLKIPTTKGQSKAFATCLPHLTVFSVFIVTACFVYLKPPSVVPSISDRLFSVLHTVLPP
FT                   ALNPVIYSLRNSDVKRALKRLQQNLCPSGSLHVTIQSNCPWFCGSHIKQIL"
FT   gap             23884734..23884869
FT                   /estimated_length=136
FT   gap             23886689..23886708
FT                   /estimated_length=20
FT   gene            <23910695..>23911612
FT                   /locus_tag="mCG_1028178"
FT                   /note="gene_id=mCG1028178.0"
FT   mRNA            <23910695..>23911612
FT                   /locus_tag="mCG_1028178"
FT                   /product="mCG1028178"
FT                   /note="gene_id=mCG1028178.0 transcript_id=mCT145882.0
FT                   created on 08-NOV-2002"
FT   CDS             23910695..23911612
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028178"
FT                   /product="mCG1028178"
FT                   /note="gene_id=mCG1028178.0 transcript_id=mCT145882.0
FT                   protein_id=mCP89039.0"
FT                   /protein_id="EDL06819.1"
FT                   /translation="MVTEFLLEVFAETWELRVLLSVLFLLVYLGSLFGNLTIIIVTTVD
FT                   QTLNTPMYFFLRNLSILDMCYVSITVPNACINSLTDHRNISVTGCAAQIFLFFFCACVE
FT                   VQFLTIMAQDRYVAICKPLLYPMIMNHQFCVQMTLASLLTSLILSGMNTFKTFQLSFCH
FT                   SNVVPQFFCELPALLRLTCSDTFNNKIILLLTAIGLSGTCFTFIAISYVHILSTVLKVP
FT                   VKGERGKAFSTCVPHIIVAYLFLCSGAYAYLRPPAISEVVEDMTLSVFYTTVPPFLNPI
FT                   IYSLRNKQIKKAVKKVIFRFFIVE"
FT   gap             23918006..23918025
FT                   /estimated_length=20
FT   gene            23945406..23946335
FT                   /locus_tag="mCG_142107"
FT                   /note="gene_id=mCG142107.0"
FT   mRNA            23945406..23946335
FT                   /locus_tag="mCG_142107"
FT                   /product="mCG142107"
FT                   /note="gene_id=mCG142107.0 transcript_id=mCT179037.0
FT                   created on 07-JAN-2003"
FT   CDS             23945485..23946204
FT                   /codon_start=1
FT                   /locus_tag="mCG_142107"
FT                   /product="mCG142107"
FT                   /note="gene_id=mCG142107.0 transcript_id=mCT179037.0
FT                   protein_id=mCP101959.0"
FT                   /protein_id="EDL06818.1"
FT                   /translation="MLFLLVYLGSLLGNFIIIIATTVDHTLNTPMYFFLRNLSILDMGY
FT                   VSVTAPNACINSLTDNRNISVAGCAAQIFLVFFAACVEIQFLTIMAQDRYVAICKPLLY
FT                   AMIMNHQFCIQMTLASLLTSLILATVHTFKTFQLSFCHSNVVSQFFCDIPSLLRLSCTD
FT                   TFINKLLLLLTTIVFSGSCFTFISISYVRILSTVLKVPLKGERGKAFSTCVPHILWCLS
FT                   LLVLLPMYISNLQQSQK"
FT   gap             23948445..23951955
FT                   /estimated_length=3511
FT   gap             23953445..23953464
FT                   /estimated_length=20
FT   gap             23955575..23956838
FT                   /estimated_length=1264
FT   gene            <23959184..>23960113
FT                   /locus_tag="mCG_141938"
FT                   /note="gene_id=mCG141938.0"
FT   mRNA            <23959184..>23960113
FT                   /locus_tag="mCG_141938"
FT                   /product="mCG141938"
FT                   /note="gene_id=mCG141938.0 transcript_id=mCT177811.0
FT                   created on 24-DEC-2002"
FT   CDS             23959184..23960113
FT                   /codon_start=1
FT                   /locus_tag="mCG_141938"
FT                   /product="mCG141938"
FT                   /note="gene_id=mCG141938.0 transcript_id=mCT177811.0
FT                   protein_id=mCP100733.0"
FT                   /db_xref="GOA:Q7TS08"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030129"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS08"
FT                   /protein_id="EDL06817.1"
FT                   /translation="MANSTLVPEFFLEVFAETWELRILLTVLFLLMYLGSLLGNLIIII
FT                   ATTVDQTLNTPMYFFLRNLSILDMGYVSVTVPNACINSLTDHRSISLAGCAGQIFLVFF
FT                   SACVEIQFLTIMAQDRYVAICKPLLYAMIMNHQFCVQMTLASLLTSLILASVHTSKTFQ
FT                   LSFCHSNVVSQFFCDIPSLLRLSCTDTFINKLLLLLTAIVFSGSCFTFIAISYVRILST
FT                   VLKVPVKGERGKAFSTCVPHIIVVSVFLSSGAYVYLKPSAISEIVEDMTLSVFYTIVPP
FT                   FLNPIIYSLRNKQIKKAVKKVIFRFFIV"
FT   gap             23979433..23979839
FT                   /estimated_length=407
FT   gene            <23979860..23982257
FT                   /locus_tag="mCG_141197"
FT                   /note="gene_id=mCG141197.0"
FT   mRNA            join(<23979860..23980164,23982095..23982257)
FT                   /locus_tag="mCG_141197"
FT                   /product="mCG141197, transcript variant mCT173741"
FT                   /note="gene_id=mCG141197.0 transcript_id=mCT173741.0
FT                   created on 27-SEP-2002"
FT   mRNA            join(<23979891..23980182,23982018..23982036,
FT                   23982095..23982257)
FT                   /locus_tag="mCG_141197"
FT                   /product="mCG141197, transcript variant mCT173740"
FT                   /note="gene_id=mCG141197.0 transcript_id=mCT173740.0
FT                   created on 27-SEP-2002"
FT   gene            complement(23979987..>23982257)
FT                   /locus_tag="mCG_1028219"
FT                   /note="gene_id=mCG1028219.1"
FT   mRNA            complement(join(23979987..23980172,23982099..>23982257))
FT                   /locus_tag="mCG_1028219"
FT                   /product="mCG1028219"
FT                   /note="gene_id=mCG1028219.1 transcript_id=mCT145923.1
FT                   created on 27-SEP-2002"
FT   CDS             join(<23980127..23980164,23982095..23982224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141197"
FT                   /product="mCG141197, isoform CRA_a"
FT                   /note="gene_id=mCG141197.0 transcript_id=mCT173741.0
FT                   protein_id=mCP96660.0 isoform=CRA_a"
FT                   /protein_id="EDL06815.1"
FT                   /translation="GVMSYQGIYVTKEYPVHFEVVPGGLYLKNVLGTVFSWEGSNFRVR
FT                   SFGVKSLGVF"
FT   CDS             join(<23980158..23980182,23982018..23982036,
FT                   23982095..23982224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141197"
FT                   /product="mCG141197, isoform CRA_b"
FT                   /note="gene_id=mCG141197.0 transcript_id=mCT173740.0
FT                   protein_id=mCP96659.0 isoform=CRA_b"
FT                   /protein_id="EDL06816.1"
FT                   /translation="LRSHVLSFGIYVTKEYPVHFEVVPGGLYLKNVLGTVFSWEGSNFR
FT                   VRSFGVKSLGVF"
FT   CDS             complement(join(23980158..23980172,23982099..>23982209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028219"
FT                   /product="mCG1028219"
FT                   /note="gene_id=mCG1028219.1 transcript_id=mCT145923.1
FT                   protein_id=mCP89095.1"
FT                   /protein_id="EDL06814.1"
FT                   /translation="TFHPKTPHPKVRTLPTKNCSKNIFEIKASWNNLKMNRDMTP"
FT   gap             23980992..23981011
FT                   /estimated_length=20
FT   gap             23982258..23982277
FT                   /estimated_length=20
FT   gap             23986249..23986268
FT                   /estimated_length=20
FT   gene            complement(<23992895..>23993902)
FT                   /locus_tag="mCG_1028177"
FT                   /note="gene_id=mCG1028177.1"
FT   mRNA            complement(<23992895..>23993902)
FT                   /locus_tag="mCG_1028177"
FT                   /product="mCG1028177"
FT                   /note="gene_id=mCG1028177.1 transcript_id=mCT145881.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(23992895..23993902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028177"
FT                   /product="mCG1028177"
FT                   /note="gene_id=mCG1028177.1 transcript_id=mCT145881.1
FT                   protein_id=mCP89036.1"
FT                   /db_xref="GOA:Q7TS09"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS09"
FT                   /protein_id="EDL06813.1"
FT                   /translation="MLNATRITGFILMGFSVAPELQTVCGLFLLVMYLAVIMSNLLLIT
FT                   LITLDLKLQTPMYFFLKNLSLLDVFFISVPIPNFFINSITHNNSISILGCALQLFLMTS
FT                   FGAGDVFVLTAMSYDRYVAICCPLHYETIMSSGNCVLMVGVSWATGILFGALYTAGTFS
FT                   MPFCGSMVIPQFFCDVPSLLRISCSDTLVVIYISLGIGFCLGMVCIICVVLSYFYIFST
FT                   VLKIPTTKGQYKAFGTCIPHLTVFSVFIATACFVNLKPPSRSASIADSLFSVLYTVLPP
FT                   ALNPVIYSLRNTDVKCALRSLQKILCPRDSLHLRVLSICPWYSASHFTTKLCNY"
FT   gap             23995405..24001151
FT                   /estimated_length=5747
FT   gene            <24040683..>24041693
FT                   /gene="Olfr293"
FT                   /locus_tag="mCG_64684"
FT                   /note="gene_id=mCG64684.0"
FT   mRNA            <24040683..>24041693
FT                   /gene="Olfr293"
FT                   /locus_tag="mCG_64684"
FT                   /product="olfactory receptor 293"
FT                   /note="gene_id=mCG64684.0 transcript_id=mCT64867.1 created
FT                   on 08-NOV-2002"
FT   CDS             24040683..24041693
FT                   /codon_start=1
FT                   /gene="Olfr293"
FT                   /locus_tag="mCG_64684"
FT                   /product="olfactory receptor 293"
FT                   /note="gene_id=mCG64684.0 transcript_id=mCT64867.1
FT                   protein_id=mCP29892.0"
FT                   /db_xref="GOA:Q7TS10"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030127"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS10"
FT                   /protein_id="EDL06812.1"
FT                   /translation="MANSTLVTNSTLVTEFMLEDFAETWELRILLSVLFLLVYMGSLLG
FT                   NLTIIIATTVDQTLNTPMYFFLRNLSILDMCYISVTVPNACINSLTDHRNISVAGCVAQ
FT                   VFLVLFCAAVEIQFLTIMAQDRYVAICKPLLYPMIMNHQYCIQMTLASLLTSLILASVH
FT                   TSKTFQLSFCHSKVIPHFFCDIPSLLRLSCSDTFNNKLLLLLTAIGLSGSCFTFIAISY
FT                   ARILSAVLKVPVKGERGKAFSTCVPHIIVVSVFLSSAAYVYLRPPVVTLEVVQEMTLSV
FT                   FYTIVPPFLNPIIYSLRNRQIKEAVKKVVLRITFIFQYKKNEYLSEFSRGRETTK"
FT   gap             24048213..24048232
FT                   /estimated_length=20
FT   gap             24050523..24050542
FT                   /estimated_length=20
FT   gap             24052927..24053126
FT                   /estimated_length=200
FT   gap             24055089..24055108
FT                   /estimated_length=20
FT   gap             24059046..24059065
FT                   /estimated_length=20
FT   gap             24060428..24060447
FT                   /estimated_length=20
FT   gap             24062789..24062808
FT                   /estimated_length=20
FT   gap             24064251..24064270
FT                   /estimated_length=20
FT   gap             24070334..24071309
FT                   /estimated_length=976
FT   gene            <24073306..>24074232
FT                   /locus_tag="mCG_1028175"
FT                   /note="gene_id=mCG1028175.0"
FT   mRNA            <24073306..>24074232
FT                   /locus_tag="mCG_1028175"
FT                   /product="mCG1028175"
FT                   /note="gene_id=mCG1028175.0 transcript_id=mCT145879.0
FT                   created on 08-NOV-2002"
FT   CDS             24073306..24074232
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028175"
FT                   /product="mCG1028175"
FT                   /note="gene_id=mCG1028175.0 transcript_id=mCT145879.0
FT                   protein_id=mCP89026.0"
FT                   /db_xref="GOA:Q7TS11"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS11"
FT                   /protein_id="EDL06811.1"
FT                   /translation="MMNSTMVTEFLLEVFAETWELRILLSVLFLLVYLGSLFGNLIIII
FT                   VTTVDQTLNTPMYFFLRNLSILDMGFVSVTVPNACINSLTDHRNISVAGCAAQIFLVFF
FT                   CSCVEIQFLTTMAQDRYVAICKPLMYPVIMTHQFCVQMTLASLLTSLILASVHTSKTFQ
FT                   LSFCHSNIVPQFFCDIPSLLRLSCSDTFNNKLLLLLSAIGLSGSCFTFIAVSYVRILST
FT                   VLKVPVKGERGKAFSTCVPHIIVVSVFLSSGAYVYLKPPAIPEIIEDMTLSVFYTIVPP
FT                   FLNPIIYSLRNKQIKEAVKKVIFRFLS"
FT   gap             24086701..24091485
FT                   /estimated_length=4785
FT   gap             24092906..24093415
FT                   /estimated_length=510
FT   gene            complement(24098161..24158783)
FT                   /gene="Folh1"
FT                   /locus_tag="mCG_114789"
FT                   /note="gene_id=mCG114789.1"
FT   mRNA            complement(join(24098161..24099022,24102450..24102543,
FT                   24104587..24104668,24105061..24105325,24108252..24108342,
FT                   24110902..24110993,24113268..24113335,24115627..24115690,
FT                   24121333..24121415,24123541..24123660,24125282..24125367,
FT                   24125955..24126053,24135942..24136035,24144656..24144842,
FT                   24145872..24145997,24151098..24151199,24154666..24154852,
FT                   24156146..24156254,24158587..24158783))
FT                   /gene="Folh1"
FT                   /locus_tag="mCG_114789"
FT                   /product="folate hydrolase"
FT                   /note="gene_id=mCG114789.1 transcript_id=mCT115886.1
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(24102483..24102543,24104587..24104668,
FT                   24105061..24105325,24108252..24108342,24110902..24110993,
FT                   24113268..24113335,24115627..24115690,24121333..24121415,
FT                   24123541..24123660,24125282..24125367,24125955..24126053,
FT                   24135942..24136035,24144656..24144842,24145872..24145997,
FT                   24151098..24151199,24154666..24154852,24156146..24156254,
FT                   24158587..24158707))
FT                   /codon_start=1
FT                   /gene="Folh1"
FT                   /locus_tag="mCG_114789"
FT                   /product="folate hydrolase"
FT                   /note="gene_id=mCG114789.1 transcript_id=mCT115886.1
FT                   protein_id=mCP88953.1"
FT                   /protein_id="EDL06810.1"
FT                   /translation="MWNALQDRDSAEVLGHRQRWLRVGTLVLALTGTFLIGFLFGWFIK
FT                   PSNEATGNVSHSGMKKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKE
FT                   FGLDLVELSHYDVLLSYPNKTHPNYISIINEDGNEIFKTSLSEQPPPGYENISDVVPPY
FT                   SAFSPQGTPEGDLVYVNYARTEDFFKLEREMKISCSGKIVIARYGKVFRGNMVKNAQLA
FT                   GAKGMILYSDPADYFVPAVKSYPDGWNLPGGGVQRGNVLNLNGAGDPLTPGYPANEHAY
FT                   RHELTEAVGLPSIPVHPIGYDDAQKLLEHMGGPAPPDSSWKGGLKVPYNVGPGFAGNFS
FT                   TQKVKMHIHSYTKVTRIYNVIGTLKGALEPDRYVILGGHRDAWVFGGIDPQSGAAVVHE
FT                   IVRSFGTLKKKGRRPRRTILFASWDAEEFGLLGSTEWAEEHSRLLQERGVAYINADSSI
FT                   EGNYTLRVDCTPLMYSLVYNLTKELQSPDEGFEGKSLYDSWKEKSPSPEFIGMPRISKL
FT                   GSGNDFEVFFQRLGIASGRARYTKNWKTNKVSSYPLYHSVYETYELVVKFYDPTFKYHL
FT                   TVAQVRGAMVFELANSIVLPFDCQSYAVALKKYADTIYNISMKHPQEMKAYMISFDSLF
FT                   SAVNNFTDVASKFNQRLQELDKSNPILLRIMNDQLMYLGTCIH"
FT   gap             24137022..24137041
FT                   /estimated_length=20
FT   gap             24140098..24140117
FT                   /estimated_length=20
FT   gap             24141393..24141412
FT                   /estimated_length=20
FT   gene            <24178096..>24194957
FT                   /locus_tag="mCG_114795"
FT                   /note="gene_id=mCG114795.1"
FT   mRNA            join(<24178096..24178292,24183692..24183971,
FT                   24184332..24185138,24185845..24186072,24186523..24186646,
FT                   24194038..>24194957)
FT                   /locus_tag="mCG_114795"
FT                   /product="mCG114795"
FT                   /note="gene_id=mCG114795.1 transcript_id=mCT115892.1
FT                   created on 26-SEP-2002"
FT   CDS             join(24178096..24178292,24183692..24183971,
FT                   24184332..24185138,24185845..24186072,24186523..24186646,
FT                   24194038..24194957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114795"
FT                   /product="mCG114795"
FT                   /note="gene_id=mCG114795.1 transcript_id=mCT115892.1
FT                   protein_id=mCP88691.1"
FT                   /protein_id="EDL06809.1"
FT                   /translation="MFSLIVFFLVLKLSFLFCYLSDPRCFWRIKDRENYLGDKEADCFF
FT                   SIYTKRGYVKNDYFSENLDKKVTLKTIYLISSVYFAIEEINRNIHILPNISLLVKIDCN
FT                   LIEDNVERVWSLKKKEIIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSRTPELYCG
FT                   YFHLLLSDQEQFPHLYQMTPKDTSLPLAMVSLAVHFRWNWVGVIITDDDHGIQFLSELR
FT                   TGMERNTVCLAFVTSITYDKMLYLKMTHKYYHQIIMSSAKVVVVYGDKESPLQLNFMLW
FT                   KSINIQRLWVSVSQFDMITMMGDFMLNSIHGTLIFSHQQSEMSGFKHFIQRVNPSNYSN
FT                   DISLAKLWWTYFKCSLPPPDCKTLKNCPTKTLFQWFFEPPLGMSMSETCYNLYNSVYAA
FT                   AHSIHEMLLQHVDTSSENDENVLEFNSWKMFSFVKNIQFVNPAGDLVNMNQNRKLDTEY
FT                   DIFYITDFLKHEGLKMKIGRFSGHFPNGQQLFISDEMIEWATDIKQTLASICSVPCRPG
FT                   LRKYFQEGNSVCCFDCYPCPENEISNMTDMDQCVKCPEDEYANTNQTKCFKKVVTFLAY
FT                   EDPSGMALAVLAVCFSVLTSVVLCVFLKHRNTPIVKANNETLSYVLLTSLIFCFICSLL
FT                   YIGYPTMVSCILQQTTFAIVFTVAASCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNY
FT                   IIPICTMIQMILCGIWLGTSPPFVDADLHMVHGHIIIVCNKGSVIAFYCVLGYMGSLAL
FT                   SSFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWITFLPVYHSTKGKAMVAVEVFCILAS
FT                   SAGMLVCIFLPKCYIILLRPQINSFHDFRKIHVKVININ"
FT   gap             24206392..24206411
FT                   /estimated_length=20
FT   gap             24223544..24223563
FT                   /estimated_length=20
FT   gap             24229402..24229827
FT                   /estimated_length=426
FT   gene            <24239014..>24265329
FT                   /locus_tag="mCG_18423"
FT                   /note="gene_id=mCG18423.1"
FT   mRNA            join(<24239014..24239210,24243273..24243552,
FT                   24243920..24244723,24245446..24245673,24246093..24246216,
FT                   24264440..>24265329)
FT                   /locus_tag="mCG_18423"
FT                   /product="mCG18423"
FT                   /note="gene_id=mCG18423.1 transcript_id=mCT9476.1 created
FT                   on 26-SEP-2002"
FT   CDS             join(24239014..24239210,24243273..24243552,
FT                   24243920..24244723,24245446..24245673,24246093..24246216,
FT                   24264440..>24265329)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18423"
FT                   /product="mCG18423"
FT                   /note="gene_id=mCG18423.1 transcript_id=mCT9476.1
FT                   protein_id=mCP7250.1"
FT                   /protein_id="EDL06808.1"
FT                   /translation="MFSLIVFFLLLKLSFLFCSLSDPRCFWRIKDRENYLGDKEADCFF
FT                   SIYTKRGYVKNDYFSENLDKKVTRKTIHLISSLYFAIEEINRNIHILPNISLLVKIECN
FT                   LIVDNEERVWSMKRKEIIPNFYCKNQRRYLIVLTGPLWITSYRLGPLLYFSRTPELYSG
FT                   YFHLISDQEQFPHLYQMTPKDTSLPLAMVSIAVHFRWNWVGVIITDDDHGIQFLAELRE
FT                   VMKRNTVCIAFVTTITYNRILYLKMIHKYYHQIIMSSAKAVIVYGDKESPVQFNFILWK
FT                   SKDIQRLWVSVSQFDMITMTGDFMLNSLHGTLIFSHQQSEMSGFKQFIQTVHPSNYSND
FT                   ISFAKLWWTYFKCSLTPPDCKTLKNCPTKTLFQWFFVPSLGMSMSETCYNLYNSVYAVA
FT                   HSLHEMLLQYVDTRSENDGKVLEFNSWKMFSFLKTIQFVNPAGDLVNMNEKKKLDTEYD
FT                   IFYIMDLLKNYGIKMKIGRFSGHFPNGQQLFMSDDIIEWATDINQNSASICSVPCRPGL
FT                   RKYFQEGKAVCCFDCYRCPENEISNMTDMEQCMKCPVDEYANTDQTNCFKKVVSFLDYE
FT                   EPLGMTLAVLAVFFSSLTVIILCIFLKHRDTPIVKANNETLSYVLLTSLIFCFICSLLY
FT                   IGYPTMVSCILQQTTFAIVFTVAASCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYI
FT                   IPICTTIQMILCGIWLGISPPFVDVDLHMIHGHIIIVCNKGSVIAFYCVLGYMGSLALS
FT                   SFTVAFLARNLPDTFNEAKLLTFSMLVFCSVWITFLPVYHSTKGKTMVAVEVFCILASS
FT                   AGMLICIFLPKCYIILLRPQINSFHEFRK"
FT   gap             24287985..24292148
FT                   /estimated_length=4164
FT   gap             24293298..24293317
FT                   /estimated_length=20
FT   gap             24294691..24294710
FT                   /estimated_length=20
FT   gap             24296546..24296565
FT                   /estimated_length=20
FT   gap             24297840..24297859
FT                   /estimated_length=20
FT   gap             24298961..24301094
FT                   /estimated_length=2134
FT   gene            <24301627..>24336703
FT                   /locus_tag="mCG_18426"
FT                   /note="gene_id=mCG18426.2"
FT   mRNA            join(<24301627..24301906,24302282..24303088,
FT                   24303797..24304024,24304470..24304593,24335778..>24336703)
FT                   /locus_tag="mCG_18426"
FT                   /product="mCG18426"
FT                   /note="gene_id=mCG18426.2 transcript_id=mCT9478.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(<24301628..24301906,24302282..24303088,
FT                   24303797..24304024,24304470..24304593,24335778..24336703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18426"
FT                   /product="mCG18426"
FT                   /note="gene_id=mCG18426.2 transcript_id=mCT9478.2
FT                   protein_id=mCP7349.2"
FT                   /protein_id="EDL06807.1"
FT                   /translation="VTLKTIHLISSVYFAAEEINKNIYILPNISLIVKIECNLIADNVK
FT                   RIWSLKKKEIIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSQTPELYCGHFHFLLN
FT                   DQEQFPHLYQMTPKDTSLPQGMVSLAVHFRWNWVGVIITDDDHGIQFLSELRTGMESNT
FT                   VCLAFVTIITYNRMLYLKMYHKYYHQITMSSAKVVIVYGDKESPLQFNFILWKSENIQR
FT                   LWVSVSQFDMITVIRDFMLNSLHGTLIFSHQQSEMSGFKQFMQTVHPSNYSNDISLAKM
FT                   WWTYFKCSLKPPDCKTLKNCPTKTLFKWFFVPPLGMSMSETCYNLYNSVYAVAHSLHEM
FT                   LLQQVDTCSENDGTVMEFNSWKMFYFLKTIQFVNPAGDLINMNQNRERDTEYDIFYIMD
FT                   FLKHEGLKMKIGRFSGHFPNGQQLFMSDEMIEWATDIKQTLASACSVPCRPGLRKYFQE
FT                   GKAVCCFDCYPCPENEISNMTDMDQCVKCPEDEYANTDQTNCLKKVVTFLDYKEPLGMA
FT                   LAVLAVFFSSLTFIILCVFLKHRDTPIVKANNETLSYVLLTSLIFCFICSLLYIGYPTM
FT                   VSCILQQTTFALVFTVAASCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYIIPICTT
FT                   IQMILCGIWLGTSPPFVDADLHMIHEHIIIVCNKGSVTAFYCVLGYMGSLALASFTVAF
FT                   LARNLPDTFNEAKLLTFSMLVFCSVWVTFLPVYHSTKGKAMVAVEVFCILASSAGMLLC
FT                   IFVPKCYLILLRPQINSFHEFRKIHAKSININRM"
FT   gene            <24371332..>24412679
FT                   /locus_tag="mCG_114794"
FT                   /note="gene_id=mCG114794.1"
FT   mRNA            join(<24371332..24371528,24376047..24376326,
FT                   24376714..24377496,24378246..24378455,24378873..24378996,
FT                   24411760..>24412679)
FT                   /locus_tag="mCG_114794"
FT                   /product="mCG114794"
FT                   /note="gene_id=mCG114794.1 transcript_id=mCT115891.1
FT                   created on 26-SEP-2002"
FT   CDS             join(24371332..24371528,24376047..24376326,
FT                   24376714..24377496,24378246..24378455,24378873..24378996,
FT                   24411760..24412679)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114794"
FT                   /product="mCG114794"
FT                   /note="gene_id=mCG114794.1 transcript_id=mCT115891.1
FT                   protein_id=mCP88983.1"
FT                   /protein_id="EDL06806.1"
FT                   /translation="MFSLTFVFLVLKLSFLFCYLSDPRCFWRIKDRENYLGDKEADCFF
FT                   SMYTKHGYVKNDYFSENLDKKVTLKTIHLISSVYFAAEEINRNSYILPNTSLIVKIECN
FT                   LIADNVKRIWSLKKKEIIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSQTPELYCG
FT                   HFHLLLNDQEQFPHLYQMTPKDTSLPQGMVSLAVHFRWNWVGVIITDDDHGIQFLSELR
FT                   TGMESNTVCLAFVTIITYNRMLYLKMYHKYYHQITMSSAKVVVVYGDKESPLQFNFILW
FT                   KSENIQRLWVSVSQFDIITMIGEFMLNSVHGTLIFSHQQSEMSGFKQFMQTVHPSNYSN
FT                   DISLAKLWWTYFKCSLPPPDCKTLKNCPTKTLLKRFFVPPLGMSMSETCYNLYNSVYAV
FT                   AHSLHEMLLQQVDTCSENDGKTIQFVNPVGDLINMNQNRERDTEYDIFYIMDFLKHEGL
FT                   KMKIGRFSGHFPNGQQLFISDEMIEWATDIKQTIASACSVPCRPGLRKYFQEGKAVCCF
FT                   DCYPCPENEISNMTDMDQCLKCPEDEYANTDQTNCLKKVVTFLDYKEPLGMALTGLAVL
FT                   FSSLTVVVLCVFLKHRDTPIVKANNETLSYVLLISLIFCFICSLLYIGYPSMVSCILQQ
FT                   TTFAMVFTVSASCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYIIPICTTIQMMLCG
FT                   IWLGISPPFVDADLHMVHGHIIIVCNKGSVIAFYCVLGYMGSLALASFTVAFLARNLPD
FT                   TFNEAKLLTFSMLVFCSVWITFLPVYHSTKGKAMVAVEVFCILASSAGMLLCIFVPKCY
FT                   LILWRPQINSFHEFRKMHVKNKNIN"
FT   gap             24387870..24387889
FT                   /estimated_length=20
FT   gap             24419118..24420469
FT                   /estimated_length=1352
FT   gap             24436569..24436653
FT                   /estimated_length=85
FT   gap             24440127..24440146
FT                   /estimated_length=20
FT   gap             24461189..24461208
FT                   /estimated_length=20
FT   gap             24462496..24462515
FT                   /estimated_length=20
FT   gap             24499850..24499869
FT                   /estimated_length=20
FT   gap             24518830..24518849
FT                   /estimated_length=20
FT   gap             24530188..24530219
FT                   /estimated_length=32
FT   gap             24534826..24534845
FT                   /estimated_length=20
FT   gap             24546346..24546365
FT                   /estimated_length=20
FT   gap             24562883..24562902
FT                   /estimated_length=20
FT   gap             24583206..24583225
FT                   /estimated_length=20
FT   gene            complement(24616783..24617500)
FT                   /pseudo
FT                   /locus_tag="mCG_52311"
FT                   /note="gene_id=mCG52311.2"
FT   mRNA            complement(24616783..24617500)
FT                   /pseudo
FT                   /locus_tag="mCG_52311"
FT                   /note="gene_id=mCG52311.2 transcript_id=mCT52494.2 created
FT                   on 26-SEP-2002"
FT   gene            24621143..24765551
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /note="gene_id=mCG18424.3"
FT   mRNA            join(24621143..24621398,24621984..24622079,
FT                   24670255..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24763616..24765551)
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, transcript variant mCT9477"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT9477.2 created
FT                   on 13-JUN-2003"
FT   mRNA            join(24621143..24621398,24621984..24622079,
FT                   24670259..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24702003..24702072,24706565..24706611,24713826..24713886,
FT                   24735572..24735653,24744862..24744981,24746763..24746871,
FT                   24749204..24749272,24751032..24751132,24763616..24765551)
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, transcript variant mCT172053"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT172053.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(24621143..24621398,24621984..24622079,
FT                   24670255..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24762515..24762708)
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, transcript variant mCT172054"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT172054.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(24621143..24621398,24621984..24622079,
FT                   24670259..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24758986..24759210)
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, transcript variant mCT185187"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT185187.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(24621342..24621398,24621984..24622079,
FT                   24670255..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24763616..24763736)
FT                   /codon_start=1
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, isoform CRA_b"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT9477.2
FT                   protein_id=mCP7323.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RSM1"
FT                   /db_xref="InterPro:IPR000778"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="MGI:MGI:1354184"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSM1"
FT                   /protein_id="EDL06803.1"
FT                   /translation="MAVSWRSWLANEGVKHLCLLIWLSLNVLLFWKTFLLYNQGPEYYY
FT                   IHQMLGLGLCLSRASASVLNLNCSLILLPMCRTVLAYLRGSQKVPSRRTRRLLDKSKTL
FT                   HITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFLELNAARYQNEDPRKLLFTTIPGLT
FT                   GVCMVVVLFLMVTASTYAIRVSNYDIFWYTHNLFFVFYMLLLLHVSGGLLKYQTNVDTH
FT                   PPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKICLEEPKFQAHFP
FT                   QTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYII
FT                   LHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFI
FT                   HSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLY
FT                   FIWVCRDIQSFQWFADLLCVLHNKFWQENRPDFVNIQLYLSQTDGIQKIIGEKYHTLNS
FT                   RLFIGRPRWKLLFDEIAKCNRGKTVGVFCCGPSSISKTLHSLSNRNNSYGTKFEYNKES
FT                   FS"
FT   CDS             join(24621342..24621398,24621984..24622079,
FT                   24670255..24670365,24671925..24672009,24679325..24679422,
FT                   24681215..24681242,24688895..24688967,24692087..24692167,
FT                   24696419..24696635,24698505..24698669,24698805..24698867,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24762515..24762677)
FT                   /codon_start=1
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, isoform CRA_a"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT172054.1
FT                   protein_id=mCP94973.1 isoform=CRA_a"
FT                   /protein_id="EDL06802.1"
FT                   /translation="MAVSWRSWLANEGVKHLCLLIWLSLNVLLFWKTFLLYNQGPEYYY
FT                   IHQMLGLGLCLSRASASVLNLNCSLILLPMCRTVLAYLRGSQKVPSRRTRRLLDKSKTL
FT                   HITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFLELNAARYQNEDPRKLLFTTIPGLT
FT                   GVCMVVVLFLMVTASTYAIRVSNYDIFWYTHNLFFVFYMLLLLHVSGGLLKYQTNVDTH
FT                   PPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKICLEEPKFQAHFP
FT                   QTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYII
FT                   LHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFI
FT                   HSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLY
FT                   FIWVCRDIQSFQWFADLLCVLHNKFWQENRPDFVNIQLYLSQTDGIQKIIGEKYHTLNS
FT                   RLFIGRPRWKLLFDEIAKCNRGFEDQGQDFVPARKQHLHRGAPKALSFFSNGKGYLHFT
FT                   IMTLKKCCFHGSPLIF"
FT   CDS             join(24670324..24670365,24671925..24672009,
FT                   24679325..24679422,24681215..24681242,24688895..24688967,
FT                   24692087..24692167,24696419..24696635,24698505..24698669,
FT                   24698805..24698867,24702003..24702072,24706565..24706611,
FT                   24713826..24713886,24735572..24735653,24744862..24744981,
FT                   24746763..24746871,24749204..24749272,24751032..24751132,
FT                   24763616..24763736)
FT                   /codon_start=1
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, isoform CRA_c"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT172053.1
FT                   protein_id=mCP94972.1 isoform=CRA_c"
FT                   /protein_id="EDL06804.1"
FT                   /translation="MCRTVLAYLRGSQKVPSRRTRRLLDKSKTLHITCGVTICIFSGVH
FT                   VAAHLVNALNFSVNYSEDFLELNAARYQNEDPRKLLFTTIPGLTGVCMVVVLFLMVTAS
FT                   TYAIRVSNYDIFWYTHNLFFVFYMLLLLHVSGGLLKYQTNVDTHPPGCISLNQTSSQNM
FT                   SIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCA
FT                   ERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFT
FT                   LTMLCQKRWQPWHSRVWIYSFFVCSDAACHEDTSKMNHAFLLCPTETKATFGVHFKVVG
FT                   DWTERFRDLLLPPSSQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIG
FT                   VTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFQWFADLLCVLHNKFWQENRPDFVN
FT                   IQLYLSQTDGIQKIIGEKYHTLNSRLFIGRPRWKLLFDEIAKCNRGKTVGVFCCGPSSI
FT                   SKTLHSLSNRNNSYGTKFEYNKESFS"
FT   CDS             join(24670324..24670365,24671925..24672009,
FT                   24679325..24679422,24681215..24681242,24688895..24688967,
FT                   24692087..24692167,24696419..24696635,24698505..24698669,
FT                   24698805..24698867,24713826..24713886,24735572..24735653,
FT                   24744862..24744981,24746763..24746871,24749204..24749272,
FT                   24751032..24751132,24758986..24759070)
FT                   /codon_start=1
FT                   /gene="Nox4"
FT                   /locus_tag="mCG_18424"
FT                   /product="NADPH oxidase 4, isoform CRA_d"
FT                   /note="gene_id=mCG18424.3 transcript_id=mCT185187.0
FT                   protein_id=mCP106445.0 isoform=CRA_d"
FT                   /protein_id="EDL06805.1"
FT                   /translation="MCRTVLAYLRGSQKVPSRRTRRLLDKSKTLHITCGVTICIFSGVH
FT                   VAAHLVNALNFSVNYSEDFLELNAARYQNEDPRKLLFTTIPGLTGVCMVVVLFLMVTAS
FT                   TYAIRVSNYDIFWYTHNLFFVFYMLLLLHVSGGLLKYQTNVDTHPPGCISLNQTSSQNM
FT                   SIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCA
FT                   ERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFT
FT                   LTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIHSRNYPKLYIDGPFG
FT                   SPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFQWFA
FT                   DLLCVLHNKFWQENRPDFVNIQLYLSQTDGIQKIIGEKYHTLNSRLFIGRPRWKLLFDE
FT                   IAKCNRGFPSPAHCWARWLRSPPLSTASLSYILL"
FT   gap             24672680..24672699
FT                   /estimated_length=20
FT   gap             24684386..24684405
FT                   /estimated_length=20
FT   gap             24687296..24688357
FT                   /estimated_length=1062
FT   gap             24689960..24689979
FT                   /estimated_length=20
FT   gap             24782339..24784284
FT                   /estimated_length=1946
FT   gap             24785014..24785474
FT                   /estimated_length=461
FT   gap             24787881..24788516
FT                   /estimated_length=636
FT   gene            complement(24794418..24862361)
FT                   /gene="Tyr"
FT                   /locus_tag="mCG_18425"
FT                   /note="gene_id=mCG18425.2"
FT   mRNA            complement(join(24794418..24796295,24804954..24805135,
FT                   24839837..24839984,24852768..24852984,24861479..24862359))
FT                   /gene="Tyr"
FT                   /locus_tag="mCG_18425"
FT                   /product="tyrosinase, transcript variant mCT9480"
FT                   /note="gene_id=mCG18425.2 transcript_id=mCT9480.1 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(24795746..24796295,24804954..24805135,
FT                   24852768..24852984,24861479..24862361))
FT                   /gene="Tyr"
FT                   /locus_tag="mCG_18425"
FT                   /product="tyrosinase, transcript variant mCT172055"
FT                   /note="gene_id=mCG18425.2 transcript_id=mCT172055.0 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(24796060..24796295,24804954..24805135,
FT                   24839837..24839984,24852768..24852984,24861479..24862297))
FT                   /codon_start=1
FT                   /gene="Tyr"
FT                   /locus_tag="mCG_18425"
FT                   /product="tyrosinase, isoform CRA_b"
FT                   /note="gene_id=mCG18425.2 transcript_id=mCT9480.1
FT                   protein_id=mCP7306.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q91XK0"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="MGI:MGI:98880"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XK0"
FT                   /protein_id="EDL06801.1"
FT                   /translation="MFLAVLYCLLWSFQISDGHFPRACASSKNLLAKECCPPWMGDGSP
FT                   CGQLSGRGSCQDILLSSAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCK
FT                   FGFGGPNCTEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGS
FT                   TPMFNDINIYDLFVWMHYYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEI
FT                   RELTGDENFTVPYWDWRDAENCDICTDEYLGGRHPENPNLLSPASFFSSWQIICSRSEE
FT                   YNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEFCLSLTQYESGSMDRTANFSF
FT                   RNTLEGFASPLTGIADPSQSSMHNALHIFMNGTMSQVQGSANDPIFLLHHAFVDSIFEQ
FT                   WLRRHRPLLEVYPEANAPIGHNRDSYMVPFIPLYRNGDFFITSKDLGYDYSYLQESDPG
FT                   FYRNYIEPYLEQASRIWPWLLGAALVGAVIAAALSGLSSRLCLQKKKKKKQPQEERQPL
FT                   LMDKDDYHSLLYQSHL"
FT   CDS             complement(join(24804999..24805135,24852768..24852984,
FT                   24861479..24862297))
FT                   /codon_start=1
FT                   /gene="Tyr"
FT                   /locus_tag="mCG_18425"
FT                   /product="tyrosinase, isoform CRA_a"
FT                   /note="gene_id=mCG18425.2 transcript_id=mCT172055.0
FT                   protein_id=mCP94974.0 isoform=CRA_a"
FT                   /protein_id="EDL06800.1"
FT                   /translation="MFLAVLYCLLWSFQISDGHFPRACASSKNLLAKECCPPWMGDGSP
FT                   CGQLSGRGSCQDILLSSAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCK
FT                   FGFGGPNCTEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGS
FT                   TPMFNDINIYDLFVWMHYYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEI
FT                   RELTGDENFTVPYWDWRDAENCDICTDEYLGGRHPENPNLLSPASFFSSWQIICSRSEE
FT                   YNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEFCLSLTQYESGSMDRTANFSF
FT                   RNTLEVFLNNGCEGTALFWKFTQKPMHLSAITETLTWFLSYRSIEMVISS"
FT   gap             24830531..24830550
FT                   /estimated_length=20
FT   gap             24845635..24845654
FT                   /estimated_length=20
FT   gap             24885026..24885045
FT                   /estimated_length=20
FT   gap             24914455..24914587
FT                   /estimated_length=133
FT   gap             24918637..24918891
FT                   /estimated_length=255
FT   gap             24926955..24927793
FT                   /estimated_length=839
FT   gene            24952985..25494542
FT                   /locus_tag="mCG_141201"
FT                   /note="gene_id=mCG141201.1"
FT   mRNA            join(24952985..24953132,24955107..24955310,
FT                   24964673..24964819,24970914..24971769,25167808..25168057,
FT                   25339173..25339408,25387181..25387427,25396825..25396993,
FT                   25400740..25400866,25434950..25435889,25476583..25476678,
FT                   25490392..25494542)
FT                   /locus_tag="mCG_141201"
FT                   /product="mCG141201, transcript variant mCT173750"
FT                   /note="gene_id=mCG141201.1 transcript_id=mCT173750.1
FT                   created on 18-APR-2003"
FT   mRNA            join(24952985..24953132,24955107..24955310,
FT                   24964673..24964819,24970914..24971769,25167808..25168057,
FT                   25339173..25339408,25387181..25387427,25396825..25396993,
FT                   25400740..25400866,25434950..25435889,25490392..25494542)
FT                   /locus_tag="mCG_141201"
FT                   /product="mCG141201, transcript variant mCT173751"
FT                   /note="gene_id=mCG141201.1 transcript_id=mCT173751.1
FT                   created on 18-APR-2003"
FT   gap             24959114..24959133
FT                   /estimated_length=20
FT   gap             24968987..24969006
FT                   /estimated_length=20
FT   CDS             join(24971112..24971769,25167808..25168057,
FT                   25339173..25339408,25387181..25387427,25396825..25396993,
FT                   25400740..25400866,25434950..25435889,25476583..25476678,
FT                   25490392..25490731)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141201"
FT                   /product="mCG141201, isoform CRA_a"
FT                   /note="gene_id=mCG141201.1 transcript_id=mCT173750.1
FT                   protein_id=mCP96669.0 isoform=CRA_a"
FT                   /protein_id="EDL06798.1"
FT                   /translation="MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHH
FT                   QPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAV
FT                   ALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQL
FT                   FNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNY
FT                   GESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMT
FT                   VRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYY
FT                   LKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFV
FT                   INAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDEN
FT                   GDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKG
FT                   QIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGD
FT                   PEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLI
FT                   AKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLV
FT                   IAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSC
FT                   TFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVA
FT                   LGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSS
FT                   GETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSSNGKSVTWAQNEKSTRGQHLWQ
FT                   RLSVHINKKENPNQTAVIKPFPKSTESRGQGAGQVVALAPVQLVLVAQDAQRQAAQSHQ
FT                   TPAPRRFMMSQRQRSASQRLPGRARHRPSVR"
FT   CDS             join(24971112..24971769,25167808..25168057,
FT                   25339173..25339408,25387181..25387427,25396825..25396993,
FT                   25400740..25400866,25434950..25435889,25490392..25490731)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141201"
FT                   /product="mCG141201, isoform CRA_b"
FT                   /note="gene_id=mCG141201.1 transcript_id=mCT173751.1
FT                   protein_id=mCP96670.0 isoform=CRA_b"
FT                   /protein_id="EDL06799.1"
FT                   /translation="MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHH
FT                   QPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAV
FT                   ALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQL
FT                   FNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNY
FT                   GESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMT
FT                   VRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYY
FT                   LKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFV
FT                   INAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDEN
FT                   GDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKG
FT                   QIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGD
FT                   PEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLI
FT                   AKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLV
FT                   IAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSC
FT                   TFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVA
FT                   LGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSS
FT                   GETLSSNGKSVTWAQNEKSTRGQHLWQRLSVHINKKENPNQTAVIKPFPKSTESRGQGA
FT                   GQVVALAPVQLVLVAQDAQRQAAQSHQTPAPRRFMMSQRQRSASQRLPGRARHRPSVR"
FT   gap             24992959..24993048
FT                   /estimated_length=90
FT   gap             24996549..24996665
FT                   /estimated_length=117
FT   gap             25001133..25001152
FT                   /estimated_length=20
FT   gap             25011294..25011313
FT                   /estimated_length=20
FT   gap             25016578..25016597
FT                   /estimated_length=20
FT   gap             25017644..25017663
FT                   /estimated_length=20
FT   gap             25023655..25023674
FT                   /estimated_length=20
FT   gap             25033495..25033754
FT                   /estimated_length=260
FT   gap             25053016..25053035
FT                   /estimated_length=20
FT   gene            complement(25061737..25063198)
FT                   /pseudo
FT                   /locus_tag="mCG_18427"
FT                   /note="gene_id=mCG18427.1"
FT   mRNA            complement(25061737..25063198)
FT                   /pseudo
FT                   /locus_tag="mCG_18427"
FT                   /note="gene_id=mCG18427.1 transcript_id=mCT9479.1 created
FT                   on 26-SEP-2002"
FT   gap             25125210..25125312
FT                   /estimated_length=103
FT   gap             25159185..25159204
FT                   /estimated_length=20
FT   gap             25164143..25164410
FT                   /estimated_length=268
FT   gap             25225722..25226137
FT                   /estimated_length=416
FT   gap             25228874..25229513
FT                   /estimated_length=640
FT   gap             25271134..25273941
FT                   /estimated_length=2808
FT   gap             25281387..25281531
FT                   /estimated_length=145
FT   gap             25283182..25283201
FT                   /estimated_length=20
FT   gap             25300090..25300159
FT                   /estimated_length=70
FT   gap             25355968..25361554
FT                   /estimated_length=5587
FT   gap             25378964..25379166
FT                   /estimated_length=203
FT   gap             25458764..25458783
FT                   /estimated_length=20
FT   gap             25478182..25478201
FT                   /estimated_length=20
FT   gap             25498530..25498549
FT                   /estimated_length=20
FT   gap             25509917..25509936
FT                   /estimated_length=20
FT   gap             25543064..25543083
FT                   /estimated_length=20
FT   gap             25549115..25549134
FT                   /estimated_length=20
FT   gap             25556115..25556160
FT                   /estimated_length=46
FT   gap             25560691..25560720
FT                   /estimated_length=30
FT   gap             25634921..25634940
FT                   /estimated_length=20
FT   gene            25635055..25668008
FT                   /gene="Ctsc"
FT                   /locus_tag="mCG_113517"
FT                   /note="gene_id=mCG113517.1"
FT   mRNA            join(25635055..25635295,25638414..25638559,
FT                   25643929..25644013,25645685..25645870)
FT                   /gene="Ctsc"
FT                   /locus_tag="mCG_113517"
FT                   /product="cathepsin C, transcript variant mCT172052"
FT                   /note="gene_id=mCG113517.1 transcript_id=mCT172052.0
FT                   created on 15-AUG-2002"
FT   mRNA            join(25635056..25635295,25638414..25638559,
FT                   25654122..25654288,25657162..25657314,25659903..25660018,
FT                   25665725..25665856,25667112..25668008)
FT                   /gene="Ctsc"
FT                   /locus_tag="mCG_113517"
FT                   /product="cathepsin C, transcript variant mCT114601"
FT                   /note="gene_id=mCG113517.1 transcript_id=mCT114601.0
FT                   created on 15-AUG-2002"
FT   CDS             join(25635124..25635295,25638414..25638559,
FT                   25654122..25654288,25657162..25657314,25659903..25660018,
FT                   25665725..25665856,25667112..25667614)
FT                   /codon_start=1
FT                   /gene="Ctsc"
FT                   /locus_tag="mCG_113517"
FT                   /product="cathepsin C, isoform CRA_b"
FT                   /note="gene_id=mCG113517.1 transcript_id=mCT114601.0
FT                   protein_id=mCP89060.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UBY5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:109553"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UBY5"
FT                   /protein_id="EDL06796.1"
FT                   /translation="MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGP
FT                   RSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAF
FT                   FKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERY
FT                   SERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDE
FT                   IQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPI
FT                   LSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYY
FT                   SSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPF
FT                   ELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIP
FT                   IPKL"
FT   CDS             join(25635124..25635295,25638414..25638559,
FT                   25643929..25644013,25645685..25645695)
FT                   /codon_start=1
FT                   /gene="Ctsc"
FT                   /locus_tag="mCG_113517"
FT                   /product="cathepsin C, isoform CRA_a"
FT                   /note="gene_id=mCG113517.1 transcript_id=mCT172052.0
FT                   protein_id=mCP94971.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U7T5"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="MGI:MGI:109553"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U7T5"
FT                   /protein_id="EDL06795.1"
FT                   /translation="MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGP
FT                   RSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAF
FT                   FKDVTDFISQLFMQLGTVGMYDLPHLRNKLVIK"
FT   gene            25635708..25640560
FT                   /locus_tag="mCG_147189"
FT                   /note="gene_id=mCG147189.0"
FT   mRNA            join(25635708..25636503,25639801..25640560)
FT                   /locus_tag="mCG_147189"
FT                   /product="mCG147189"
FT                   /note="gene_id=mCG147189.0 transcript_id=mCT187452.0
FT                   created on 13-JAN-2004"
FT   CDS             25636006..25636287
FT                   /codon_start=1
FT                   /locus_tag="mCG_147189"
FT                   /product="mCG147189"
FT                   /note="gene_id=mCG147189.0 transcript_id=mCT187452.0
FT                   protein_id=mCP109596.0"
FT                   /protein_id="EDL06797.1"
FT                   /translation="MVSPVRVAQRNSTLNCSFLVSRINAVIYPTSPASNKESFTKFQVT
FT                   GFSLILGGVYNCFFSKFEHGDEAEGREKVCIALSYEVSDKLFLHGKMS"
FT   gap             25637208..25637343
FT                   /estimated_length=136
FT   gap             25656277..25656296
FT                   /estimated_length=20
FT   gap             25673105..25673124
FT                   /estimated_length=20
FT   gap             25682177..25682196
FT                   /estimated_length=20
FT   gap             25683940..25684604
FT                   /estimated_length=665
FT   gap             25686302..25686321
FT                   /estimated_length=20
FT   gap             25687358..25687377
FT                   /estimated_length=20
FT   gap             25691669..25691688
FT                   /estimated_length=20
FT   gene            complement(<25710025..25710936)
FT                   /locus_tag="mCG_52895"
FT                   /note="gene_id=mCG52895.2"
FT   mRNA            complement(<25710025..25710936)
FT                   /locus_tag="mCG_52895"
FT                   /product="mCG52895"
FT                   /note="gene_id=mCG52895.2 transcript_id=mCT53078.2 created
FT                   on 11-FEB-2003"
FT   CDS             complement(<25710025..25710151)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52895"
FT                   /product="mCG52895"
FT                   /note="gene_id=mCG52895.2 transcript_id=mCT53078.2
FT                   protein_id=mCP29902.3"
FT                   /protein_id="EDL06794.1"
FT                   /translation="MASYIMILKSVKRKTEAIKKITHTWFHVPEYSRAIIFVRSTY"
FT   gap             25715931..25715998
FT                   /estimated_length=68
FT   gap             25726841..25727120
FT                   /estimated_length=280
FT   gap             25737390..25739147
FT                   /estimated_length=1758
FT   gap             25739676..25740787
FT                   /estimated_length=1112
FT   gap             25767037..25767056
FT                   /estimated_length=20
FT   gap             25783615..25783634
FT                   /estimated_length=20
FT   gap             25791531..25791550
FT                   /estimated_length=20
FT   gene            25792477..25853769
FT                   /gene="Rab38"
FT                   /locus_tag="mCG_10204"
FT                   /note="gene_id=mCG10204.2"
FT   mRNA            join(25792477..25792808,25812685..25812965,
FT                   25852802..25853769)
FT                   /gene="Rab38"
FT                   /locus_tag="mCG_10204"
FT                   /product="Rab38, member of RAS oncogene family"
FT                   /note="gene_id=mCG10204.2 transcript_id=mCT10203.3 created
FT                   on 10-JUN-2003"
FT   CDS             join(25792607..25792808,25812685..25812965,
FT                   25852802..25852954)
FT                   /codon_start=1
FT                   /gene="Rab38"
FT                   /locus_tag="mCG_10204"
FT                   /product="Rab38, member of RAS oncogene family"
FT                   /note="gene_id=mCG10204.2 transcript_id=mCT10203.3
FT                   protein_id=mCP7332.2"
FT                   /db_xref="GOA:Q5FW76"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1919683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW76"
FT                   /protein_id="EDL06793.1"
FT                   /translation="MQTPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVD
FT                   FALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKW
FT                   KNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKEN
FT                   INIDEASRCLVKHILANECDLLESIEPDIVKPHLTSPKVVSCSGCAKS"
FT   gap             25883482..25883501
FT                   /estimated_length=20
FT   gene            complement(25892565..25893086)
FT                   /locus_tag="mCG_10205"
FT                   /note="gene_id=mCG10205.0"
FT   mRNA            complement(25892565..25893086)
FT                   /locus_tag="mCG_10205"
FT                   /product="mCG10205"
FT                   /note="gene_id=mCG10205.0 transcript_id=mCT10202.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(25892603..25893058)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10205"
FT                   /product="mCG10205"
FT                   /note="gene_id=mCG10205.0 transcript_id=mCT10202.0
FT                   protein_id=mCP7330.1"
FT                   /db_xref="GOA:Q5BLJ7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="MGI:MGI:1915302"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ7"
FT                   /protein_id="EDL06792.1"
FT                   /translation="MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGL
FT                   TPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLER
FT                   NRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA"
FT   gap             25964783..25965133
FT                   /estimated_length=351
FT   gap             25986767..25987138
FT                   /estimated_length=372
FT   gap             26018505..26018580
FT                   /estimated_length=76
FT   gap             26020860..26020993
FT                   /estimated_length=134
FT   gap             26029226..26029245
FT                   /estimated_length=20
FT   gap             26035265..26035960
FT                   /estimated_length=696
FT   gap             26036772..26040658
FT                   /estimated_length=3887
FT   gap             26046384..26046506
FT                   /estimated_length=123
FT   gap             26051369..26051388
FT                   /estimated_length=20
FT   gap             26078104..26078643
FT                   /estimated_length=540
FT   gap             26080182..26080965
FT                   /estimated_length=784
FT   gap             26140842..26140914
FT                   /estimated_length=73
FT   gene            complement(26143754..26144189)
FT                   /pseudo
FT                   /locus_tag="mCG_50097"
FT                   /note="gene_id=mCG50097.1"
FT   mRNA            complement(26143754..26144189)
FT                   /pseudo
FT                   /locus_tag="mCG_50097"
FT                   /note="gene_id=mCG50097.1 transcript_id=mCT50280.1 created
FT                   on 25-SEP-2002"
FT   gap             26145542..26145561
FT                   /estimated_length=20
FT   gap             26152666..26152685
FT                   /estimated_length=20
FT   gap             26184180..26184243
FT                   /estimated_length=64
FT   gap             26189956..26189975
FT                   /estimated_length=20
FT   gap             26192120..26192180
FT                   /estimated_length=61
FT   gap             26195850..26199990
FT                   /estimated_length=4141
FT   gap             26201311..26201330
FT                   /estimated_length=20
FT   gap             26204022..26204149
FT                   /estimated_length=128
FT   gap             26207352..26207371
FT                   /estimated_length=20
FT   gap             26224064..26224353
FT                   /estimated_length=290
FT   gap             26226397..26226506
FT                   /estimated_length=110
FT   gap             26232147..26232166
FT                   /estimated_length=20
FT   gap             26263052..26263071
FT                   /estimated_length=20
FT   gap             26264575..26264668
FT                   /estimated_length=94
FT   gap             26310059..26310078
FT                   /estimated_length=20
FT   gap             26339401..26343474
FT                   /estimated_length=4074
FT   gap             26350345..26356019
FT                   /estimated_length=5675
FT   gap             26365493..26365614
FT                   /estimated_length=122
FT   gap             26409696..26410055
FT                   /estimated_length=360
FT   gap             26422791..26422893
FT                   /estimated_length=103
FT   gap             26437880..26438039
FT                   /estimated_length=160
FT   gap             26481836..26481855
FT                   /estimated_length=20
FT   gene            complement(26501356..26701927)
FT                   /gene="Tmem135"
FT                   /locus_tag="mCG_15145"
FT                   /note="gene_id=mCG15145.1"
FT   mRNA            complement(join(26501356..26503604,26505415..26505482,
FT                   26506291..26506389,26509603..26509679,26513046..26513109,
FT                   26515661..26515828,26518063..26518132,26520505..26520651,
FT                   26527174..26527215,26558143..26558189,26606170..26606235,
FT                   26642220..26642253,26667509..26667601,26669981..26670108,
FT                   26701613..26701927))
FT                   /gene="Tmem135"
FT                   /locus_tag="mCG_15145"
FT                   /product="transmembrane protein 135, transcript variant
FT                   mCT14105"
FT                   /note="gene_id=mCG15145.1 transcript_id=mCT14105.2 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(26503472..26503604,26505415..26505482,
FT                   26506291..26506389,26509603..26509679,26513046..26513109,
FT                   26515661..26515828,26518063..26518132,26520505..26520651,
FT                   26527174..26527215,26558143..26558189,26606170..26606235,
FT                   26642220..26642253,26667509..26667601,26669981..26670108,
FT                   26701613..26701753))
FT                   /codon_start=1
FT                   /gene="Tmem135"
FT                   /locus_tag="mCG_15145"
FT                   /product="transmembrane protein 135, isoform CRA_a"
FT                   /note="gene_id=mCG15145.1 transcript_id=mCT14105.2
FT                   protein_id=mCP7273.1 isoform=CRA_a"
FT                   /protein_id="EDL06790.1"
FT                   /translation="MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPL
FT                   YLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFG
FT                   AALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAA
FT                   MYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSI
FT                   IALVRTLVDSVCKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHL
FT                   FTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVS
FT                   MMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFPQADTIIYSISTAICFHAAVMEVQN
FT                   LRPSYWKFLLRLTKGRFALMNRKALDVFGTGASREFHNFIPRLDPRYTVVTPELPIDFS
FT                   "
FT   mRNA            complement(join(26507705..26509442,26509603..26509679,
FT                   26513046..26513109,26515661..26515828,26518063..26518132,
FT                   26520505..26520651,26527174..26527215,26558143..26558189,
FT                   26606170..26606235,26642220..26642253,26667509..26667601,
FT                   26669981..26670108,26701613..26701926))
FT                   /gene="Tmem135"
FT                   /locus_tag="mCG_15145"
FT                   /product="transmembrane protein 135, transcript variant
FT                   mCT185133"
FT                   /note="gene_id=mCG15145.1 transcript_id=mCT185133.0 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(26509404..26509442,26509603..26509679,
FT                   26513046..26513109,26515661..26515828,26518063..26518132,
FT                   26520505..26520651,26527174..26527215,26558143..26558189,
FT                   26606170..26606235,26642220..26642253,26667509..26667601,
FT                   26669981..26670108,26701613..26701753))
FT                   /codon_start=1
FT                   /gene="Tmem135"
FT                   /locus_tag="mCG_15145"
FT                   /product="transmembrane protein 135, isoform CRA_b"
FT                   /note="gene_id=mCG15145.1 transcript_id=mCT185133.0
FT                   protein_id=mCP106391.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C8G3"
FT                   /db_xref="MGI:MGI:1920009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8G3"
FT                   /protein_id="EDL06791.1"
FT                   /translation="MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPL
FT                   YLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFG
FT                   AALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAA
FT                   MYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSI
FT                   IALVRTLVDSVCKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHL
FT                   FTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVS
FT                   MMFYKSTTISMYLASKLVEKNTESTMPMSTR"
FT   gap             26562053..26562072
FT                   /estimated_length=20
FT   gap             26571377..26571396
FT                   /estimated_length=20
FT   gap             26574721..26574740
FT                   /estimated_length=20
FT   gap             26653700..26653719
FT                   /estimated_length=20
FT   gap             26688567..26688586
FT                   /estimated_length=20
FT   gap             26698074..26698093
FT                   /estimated_length=20
FT   gap             26718070..26718089
FT                   /estimated_length=20
FT   gap             26733865..26733884
FT                   /estimated_length=20
FT   gap             26738476..26738495
FT                   /estimated_length=20
FT   gap             26742976..26743041
FT                   /estimated_length=66
FT   gap             26751187..26751206
FT                   /estimated_length=20
FT   gene            26767558..26772425
FT                   /gene="Fzd4"
FT                   /locus_tag="mCG_15148"
FT                   /note="gene_id=mCG15148.1"
FT   mRNA            join(26767558..26768145,26770206..26772425)
FT                   /gene="Fzd4"
FT                   /locus_tag="mCG_15148"
FT                   /product="frizzled homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG15148.1 transcript_id=mCT14108.1 created
FT                   on 20-SEP-2002"
FT   CDS             join(26767861..26768145,26770206..26771534)
FT                   /codon_start=1
FT                   /gene="Fzd4"
FT                   /locus_tag="mCG_15148"
FT                   /product="frizzled homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG15148.1 transcript_id=mCT14108.1
FT                   protein_id=mCP7249.2"
FT                   /protein_id="EDL06789.1"
FT                   /translation="MAWPGTGPSSRGAPGGVGLRLGLLLQLLLLLRPTLGFGDEEERRC
FT                   DPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVP
FT                   MCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPG
FT                   DEEVPLPHKTPIQPGEECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIW
FT                   MAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERIS
FT                   CDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAI
FT                   EMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYL
FT                   VIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYE
FT                   ISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKV
FT                   KREKRGNGWVKPGKGNETVV"
FT   gene            complement(26773708..>26776255)
FT                   /locus_tag="mCG_1028215"
FT                   /note="gene_id=mCG1028215.1"
FT   mRNA            complement(join(26773708..26773816,26773907..26774161,
FT                   26776079..>26776255))
FT                   /locus_tag="mCG_1028215"
FT                   /product="mCG1028215"
FT                   /note="gene_id=mCG1028215.1 transcript_id=mCT145919.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(26774127..26774161,26776079..>26776241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028215"
FT                   /product="mCG1028215"
FT                   /note="gene_id=mCG1028215.1 transcript_id=mCT145919.1
FT                   protein_id=mCP88902.1"
FT                   /protein_id="EDL06788.1"
FT                   /translation="IRNLQYRHQCRHTFVHPLKGDLFPWKFSDLFRECIAGVCLVPLHC
FT                   HLNIPRLPSVSWKLESLSPI"
FT   gap             26788214..26788238
FT                   /estimated_length=25
FT   gene            <26789522..26805240
FT                   /locus_tag="mCG_1028300"
FT                   /note="gene_id=mCG1028300.1"
FT   mRNA            join(<26789522..26789631,26804819..26805240)
FT                   /locus_tag="mCG_1028300"
FT                   /product="mCG1028300, transcript variant mCT173742"
FT                   /note="gene_id=mCG1028300.1 transcript_id=mCT173742.0
FT                   created on 25-SEP-2002"
FT   mRNA            join(<26789522..26789631,26793030..26793652)
FT                   /locus_tag="mCG_1028300"
FT                   /product="mCG1028300, transcript variant mCT146004"
FT                   /note="gene_id=mCG1028300.1 transcript_id=mCT146004.0
FT                   created on 25-SEP-2002"
FT   CDS             join(<26789627..26789631,26793030..26793264)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028300"
FT                   /product="mCG1028300, isoform CRA_a"
FT                   /note="gene_id=mCG1028300.1 transcript_id=mCT146004.0
FT                   protein_id=mCP89083.0 isoform=CRA_a"
FT                   /protein_id="EDL06786.1"
FT                   /translation="NRCKWHLKIQGGWLSRTKLLQINHQCLSFSWKMSQLPGPEGNVYI
FT                   AKLTNHQTHQKSLLQGNNAKCPGRVTYIFWSKEE"
FT   gap             26799144..26799163
FT                   /estimated_length=20
FT   gap             26803344..26803492
FT                   /estimated_length=149
FT   CDS             <26804918..26805097
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028300"
FT                   /product="mCG1028300, isoform CRA_b"
FT                   /note="gene_id=mCG1028300.1 transcript_id=mCT173742.0
FT                   protein_id=mCP96661.0 isoform=CRA_b"
FT                   /protein_id="EDL06787.1"
FT                   /translation="VKASHTKTSMMACLQPHIRVSRKQCTLTAENLERYLWVLVYVGKN
FT                   QIHLWSSNTNNNHC"
FT   gap             26821111..26821130
FT                   /estimated_length=20
FT   gap             26844127..26844146
FT                   /estimated_length=20
FT   gene            complement(26872284..26890470)
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /note="gene_id=mCG15149.2"
FT   mRNA            complement(join(26872284..26874153,26880729..26880845))
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, transcript variant
FT                   mCT14109"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT14109.1 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(26872392..26874153,26890312..26890470))
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, transcript variant
FT                   mCT173748"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT173748.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(26872994..26874153,26890312..26890426))
FT                   /codon_start=1
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, isoform CRA_b"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT173748.0
FT                   protein_id=mCP96668.0 isoform=CRA_b"
FT                   /protein_id="EDL06784.1"
FT                   /translation="MTLPYEKILRTDTLPEPRDRAAGEACLPACLPACLPSYVALSMAG
FT                   IPGLFILLVLLCVFMQVSPYTVPWKPTWPAYRLPVVLPQSTLNLAKADFDAKAKLEVSS
FT                   SCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETRVGIYILSNGEGRARGRDSEATG
FT                   RSRRKRQIYGYDGRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGK
FT                   TYVKGTQKLRVGFLKPKYKDGAGGDNSSSSAMPDKMKFQWIRVKRTHVPKGWIKGNAND
FT                   IGMDYDYALLELKKPHKRQFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKD
FT                   ETYDLLYQQCDAQPGASGSGVYVRMWKRPQQKWERKIIGIFSGHQWVDMNGSPQDFNVA
FT                   VRITPLKYAQICYWIKGNYLDCREG"
FT   CDS             complement(26872994..26874142)
FT                   /codon_start=1
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, isoform CRA_a"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT14109.1
FT                   protein_id=mCP7251.2 isoform=CRA_a"
FT                   /protein_id="EDL06783.1"
FT                   /translation="MAGIPGLFILLVLLCVFMQVSPYTVPWKPTWPAYRLPVVLPQSTL
FT                   NLAKADFDAKAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETRVGIYI
FT                   LSNGEGRARGRDSEATGRSRRKRQIYGYDGRFSIFGKDFLLNYPFSTSVKLSTGCTGTL
FT                   VAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKYKDGAGGDNSSSSAMPDKMKFQWIR
FT                   VKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRQFMKIGVSPPAKQLPGGRIHFSGY
FT                   DNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRPQQKWERKIIGIFS
FT                   GHQWVDMNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG"
FT   mRNA            complement(join(<26873903..26874153,26881308..>26881483))
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, transcript variant
FT                   mCT173749"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT173749.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(<26873903..26874153,26881308..>26881446))
FT                   /codon_start=1
FT                   /gene="Prss23"
FT                   /locus_tag="mCG_15149"
FT                   /product="protease, serine, 23, isoform CRA_c"
FT                   /note="gene_id=mCG15149.2 transcript_id=mCT173749.0
FT                   protein_id=mCP96667.0 isoform=CRA_c"
FT                   /protein_id="EDL06785.1"
FT                   /translation="QLNCRACNLGSLPLDYKLRYTLEALEEELRWKGARSSLFKAHRMR
FT                   TVALSMAGIPGLFILLVLLCVFMQVSPYTVPWKPTWPAYRLPVVLPQSTLNLAKADFDA
FT                   KAKLEVSSSCGPQCHKGTPLPTYEEA"
FT   gap             26881883..26881902
FT                   /estimated_length=20
FT   gap             26895799..26895939
FT                   /estimated_length=141
FT   gap             26913672..26913808
FT                   /estimated_length=137
FT   gap             26931927..26932228
FT                   /estimated_length=302
FT   gap             26943875..26943894
FT                   /estimated_length=20
FT   gap             26949874..26950079
FT                   /estimated_length=206
FT   gene            complement(26988822..26989850)
FT                   /locus_tag="mCG_147194"
FT                   /note="gene_id=mCG147194.0"
FT   mRNA            complement(26988822..26989850)
FT                   /locus_tag="mCG_147194"
FT                   /product="mCG147194"
FT                   /note="gene_id=mCG147194.0 transcript_id=mCT187457.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26989501..26989809)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147194"
FT                   /product="mCG147194"
FT                   /note="gene_id=mCG147194.0 transcript_id=mCT187457.0
FT                   protein_id=mCP109601.0"
FT                   /db_xref="GOA:Q8CAG4"
FT                   /db_xref="MGI:MGI:3642744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAG4"
FT                   /protein_id="EDL06782.1"
FT                   /translation="MGVPGDIVSALLQGYGSRRARLGVAALGGRGRCLAPKTAAGYARH
FT                   GGQPRASAQRGAHSPGTDLEPGRDQGQGCPLGKPGPARQQGAGPELSERLGVPDGRR"
FT   gene            26989543..27183870
FT                   /gene="Me3"
FT                   /locus_tag="mCG_15146"
FT                   /note="gene_id=mCG15146.2"
FT   mRNA            join(26989543..26989818,27083940..27084073,
FT                   27087083..27087232,27125692..27125767,27135893..27136054,
FT                   27146017..27146120,27165812..27165921,27179553..27179732,
FT                   27180311..27180854)
FT                   /gene="Me3"
FT                   /locus_tag="mCG_15146"
FT                   /product="malic enzyme 3, NADP(+)-dependent, mitochondrial,
FT                   transcript variant mCT14107"
FT                   /note="gene_id=mCG15146.2 transcript_id=mCT14107.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(26989636..26989818,27083940..27084073,
FT                   27087083..27087232,27125692..27125767,27135893..27136054,
FT                   27146017..27146120,27165812..27165921,27179553..27179732,
FT                   27180311..27180495)
FT                   /codon_start=1
FT                   /gene="Me3"
FT                   /locus_tag="mCG_15146"
FT                   /product="malic enzyme 3, NADP(+)-dependent, mitochondrial,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15146.2 transcript_id=mCT14107.2
FT                   protein_id=mCP7303.2 isoform=CRA_a"
FT                   /protein_id="EDL06780.1"
FT                   /translation="MGAALGTGARLTSVPRIACSSLRRQAPSAPAQGCHSKSGPPRPVP
FT                   LKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQSDL
FT                   DKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIH
FT                   DKGHIATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQ
FT                   CLPVLLDVGTNNEELLRDPLYIGLKHQRVRGEEYDDLLDEFMQAVTDKFGINCLIQFED
FT                   FANANAFRLLNKYRNKYCMFNDDIQESYCIKDLLSRPPTLYLPNTLRSLQGRSHLNHEK
FT                   EMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIVFALSNPT
FT                   SKAECTAEKCYRVTEVSGEFFLPPAERK"
FT   gap             27019063..27020320
FT                   /estimated_length=1258
FT   gap             27022047..27022066
FT                   /estimated_length=20
FT   gap             27023186..27023205
FT                   /estimated_length=20
FT   gap             27025545..27025949
FT                   /estimated_length=405
FT   gap             27027371..27027427
FT                   /estimated_length=57
FT   gap             27044422..27044441
FT                   /estimated_length=20
FT   gap             27051618..27051699
FT                   /estimated_length=82
FT   gap             27066082..27066101
FT                   /estimated_length=20
FT   gap             27069770..27069794
FT                   /estimated_length=25
FT   gap             27078220..27078347
FT                   /estimated_length=128
FT   gap             27084633..27084680
FT                   /estimated_length=48
FT   gap             27096844..27097027
FT                   /estimated_length=184
FT   gene            complement(27100417..27101038)
FT                   /pseudo
FT                   /locus_tag="mCG_15147"
FT                   /note="gene_id=mCG15147.2"
FT   mRNA            complement(27100417..27101038)
FT                   /pseudo
FT                   /locus_tag="mCG_15147"
FT                   /note="gene_id=mCG15147.2 transcript_id=mCT14106.2 created
FT                   on 25-SEP-2002"
FT   gap             27111432..27111591
FT                   /estimated_length=160
FT   gap             27123026..27123122
FT                   /estimated_length=97
FT   gap             27144176..27144335
FT                   /estimated_length=160
FT   gap             27152770..27152827
FT                   /estimated_length=58
FT   mRNA            join(<27161391..27161450,27165812..27165913,
FT                   27179625..27179732,27180311..27180453,27181501..27181674,
FT                   27182241..27182339,27183644..27183870)
FT                   /gene="Me3"
FT                   /locus_tag="mCG_15146"
FT                   /product="malic enzyme 3, NADP(+)-dependent, mitochondrial,
FT                   transcript variant mCT173747"
FT                   /note="gene_id=mCG15146.2 transcript_id=mCT173747.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<27165823..27165913,27179625..27179732,
FT                   27180311..27180453,27181501..27181674,27182241..27182339,
FT                   27183644..27183805)
FT                   /codon_start=1
FT                   /gene="Me3"
FT                   /locus_tag="mCG_15146"
FT                   /product="malic enzyme 3, NADP(+)-dependent, mitochondrial,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15146.2 transcript_id=mCT173747.0
FT                   protein_id=mCP96666.0 isoform=CRA_b"
FT                   /protein_id="EDL06781.1"
FT                   /translation="IASSSSKTLPMPMPSVYSTNTATSTVCSMMKGRSHLNHEKEMFAQ
FT                   DHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIVFALSNPTSKAEC
FT                   TAEKCYRVTEGRGIFASGSPFKSVTLEDGRTFTPGQGNNAYVFPGVALGVIAGGIRHIP
FT                   DEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAVKVLDYAYKHNLASYYPEP
FT                   KDKEAFVKSLIYTPDYDSFSLDTYSWPKEAMSVQKV"
FT   gap             27177821..27178282
FT                   /estimated_length=462
FT   gap             27190576..27190595
FT                   /estimated_length=20
FT   gene            complement(27191480..27228968)
FT                   /locus_tag="mCG_114763"
FT                   /note="gene_id=mCG114763.1"
FT   mRNA            complement(join(27191480..27191978,27192056..27192154,
FT                   27194946..27195071,27201003..27201223,27201417..>27201469))
FT                   /locus_tag="mCG_114763"
FT                   /product="mCG114763, transcript variant mCT173465"
FT                   /note="gene_id=mCG114763.1 transcript_id=mCT173465.0
FT                   created on 17-SEP-2002"
FT   mRNA            complement(join(27191481..27191978,27194946..27195071,
FT                   27201003..27201223,27201417..27201495,27202732..27202904,
FT                   27205461..27205565,27206946..27207092,27207621..27207711,
FT                   27211479..27211602,27213015..27213136,27215756..27215835,
FT                   27218470..27218726,27222055..27222211,27223395..27223456,
FT                   27228537..27228968))
FT                   /locus_tag="mCG_114763"
FT