Dbfetch

ID   CH466542; SV 1; linear; genomic DNA; CON; MUS; 34874695 BP.
XX
AC   CH466542;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009753004 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-34874695
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-34874695
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 605651218202441b8bf1377f8c93a68e.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000210.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000889; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007476; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014873; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015085; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015094; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023206; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024026; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026655; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026735; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026737; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026739; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026743; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026774; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026779; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026788; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026796; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026809; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026810; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026814; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026816; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026820; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026821; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026840; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026848; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026851; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026857; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026860; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026870; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026879; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026882; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026919; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026922; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026925; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026938; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026942; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026976; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026983; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026984; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026985; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035437; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036160; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037254; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039157; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039648; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039686; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045684; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047250; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049630; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063275; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068947; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075383; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075419; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000076441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000083361; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094266; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000099041; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000111021; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000111869; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020742; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023476; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025303; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025309; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025312; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025322; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025329; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025334; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025336; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025339; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025346; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025347; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025352; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025354; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025356; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025357; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025358; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025359; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025360; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025366; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025370; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025371; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025378; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025383; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025387; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025391; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025394; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025396; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025398; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025399; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025400; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025403; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025404; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025406; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025408; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025410; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025427; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025430; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025439; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025443; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025445; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025446; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025449; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025451; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025452; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025453; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025461; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025464; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025467; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025469; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025482; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025487; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025495; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025496; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025499; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025501; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025502; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025510; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025514; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025525; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025526; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025527; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025529; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025532; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025538; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025542; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025543; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025546; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025550; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025554; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025555; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025556; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025558; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025559; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025563; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025567; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025573; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025577; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025578; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025579; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025580; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025582; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025585; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025586; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025588; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025592; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025600; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025601; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025603; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025606; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025610; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025613; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025616; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025617; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025626; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025628; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025632; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025634; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025643; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025646; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025650; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025651; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025653; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025654; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025655; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025663; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025666; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025667; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025668; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025669; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025670; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025671; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025674; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025677; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025678; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025679; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025680; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025685; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025686; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025687; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025688; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025690; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025695; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025696; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020698; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025279; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025285; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025294; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025295; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025299; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025306; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025310; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025311; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025313; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025316; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025323; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025329; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025330; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025331; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025333; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025334; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025335; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025336; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025337; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025344; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025348; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025349; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025351; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025354; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025356; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025360; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025365; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025372; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025374; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025376; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025377; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025378; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025379; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025383; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025384; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025385; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025387; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025404; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025407; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025420; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025422; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025423; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025426; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025429; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025430; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025438; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025441; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025444; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025459; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025464; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025465; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025467; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025472; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025473; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025476; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025478; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025479; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025487; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025488; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025491; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025502; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025503; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025504; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025506; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025507; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025509; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025515; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025519; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025521; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025524; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025528; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025532; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025533; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025534; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025536; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025537; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025541; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025545; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025551; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025555; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025556; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025557; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025560; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025563; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025564; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025566; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025570; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025578; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025580; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025582; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025583; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025587; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025590; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025593; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025594; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025603; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025605; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025609; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025611; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025620; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025623; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025627; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025628; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025630; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025631; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025632; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025640; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025643; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025644; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025645; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025646; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025647; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025648; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025651; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025653; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025654; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025655; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025656; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025657; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025662; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025663; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025664; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025667; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025672; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025673; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023399; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025247; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025248; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025249; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025254; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025257; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025262; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025263; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025274; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025280; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025282; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025292; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025298; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025299; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025300; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025302; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025304; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025305; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025306; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025312; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025317; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025319; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025324; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025328; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025329; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025333; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025338; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025341; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025345; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025346; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025348; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025350; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025353; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025354; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025355; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025357; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025374; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025377; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025386; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025390; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025392; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025393; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025396; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025398; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025399; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025400; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025408; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025411; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025414; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025416; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025429; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025434; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025435; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025437; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025442; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025443; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025446; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025448; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025449; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025457; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025458; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025461; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025472; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025473; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025474; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025476; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025477; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025479; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025485; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025489; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025490; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025493; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025497; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025501; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025502; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025503; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025505; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025510; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025514; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025518; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025520; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025524; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025526; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025527; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025529; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025533; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025535; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025539; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025547; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025548; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025550; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025553; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025557; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025560; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025563; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025564; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025573; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025575; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025579; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025581; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025590; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025593; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025597; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025598; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025600; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025601; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025602; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025610; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025613; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025614; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025615; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025616; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025617; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025618; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025621; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025623; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025624; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025625; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025626; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025627; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025632; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025633; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025634; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025637; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025642; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025643; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020695; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023439; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025274; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025275; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025276; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025281; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025291; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025302; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025306; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025307; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025309; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025312; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025319; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025320; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025325; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025326; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025327; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025329; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025330; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025331; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025332; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025333; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025339; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025343; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025344; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025346; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025351; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025355; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025360; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025364; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025369; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025371; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025372; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025373; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025374; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025379; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025380; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025381; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025383; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025400; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025403; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025416; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025418; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025419; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025422; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025424; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025425; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025434; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025437; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025440; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025442; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025455; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025460; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025461; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025463; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025468; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025469; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025472; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025474; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025475; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025483; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025484; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025487; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025498; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025500; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025502; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025503; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025505; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025511; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025516; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025519; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025523; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025527; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025528; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025530; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025532; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025533; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025537; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025539; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025541; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025545; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025547; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025551; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025552; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025553; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025554; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025556; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025560; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025562; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025566; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025574; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025575; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025577; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025580; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025584; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025587; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025590; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025591; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025600; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025602; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025606; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025608; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025617; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025620; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025624; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025625; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025627; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025628; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025637; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025640; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025641; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025642; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025643; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025644; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025645; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025648; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025650; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025651; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025652; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025653; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025659; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025660; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025661; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025662; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025667; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025668; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025034; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025035; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025036; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025045; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025051; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025055; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025062; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025067; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025069; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025072; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025079; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025087; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025089; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025090; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025091; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025092; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025093; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025103; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025106; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025111; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025115; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025120; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025128; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025130; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025132; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025135; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025137; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025138; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025140; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025141; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025142; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025144; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025161; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025164; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025173; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025180; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025183; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025185; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025186; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025187; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025195; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025198; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025201; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025203; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025216; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025221; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025224; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025229; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025233; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025235; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025236; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025244; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025248; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025259; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025260; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025261; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025263; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025264; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025266; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025272; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025278; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025281; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025285; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025289; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025291; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025294; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025298; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025300; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025302; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025306; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025312; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025313; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025314; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025315; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025317; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025320; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025321; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025323; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025327; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025335; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025337; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025340; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025347; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025350; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025351; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025360; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025362; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025366; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025368; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025384; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025385; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025387; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025388; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025389; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025397; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025400; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025401; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025402; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025403; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025404; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025405; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025408; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025410; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025411; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025412; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025413; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025414; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025419; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025420; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025421; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025423; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025428; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025429; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021132; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023881; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025717; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025718; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025719; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025724; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025732; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025744; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025748; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025751; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025761; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025767; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025768; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025771; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025772; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025773; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025774; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025775; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025781; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025785; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025789; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025792; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025794; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025798; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025799; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025803; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025808; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025811; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025813; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025815; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025816; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025817; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025818; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025820; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025822; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025823; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025824; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025825; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025827; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025844; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025847; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025856; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025860; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025862; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025863; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025866; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025868; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025878; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025881; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025884; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025886; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025899; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025904; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025905; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025907; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025912; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025913; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025916; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025918; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025919; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025927; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025928; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025931; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025943; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025944; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025946; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025947; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025949; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025955; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025959; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025961; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025964; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025968; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025972; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025973; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025975; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025977; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025979; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025982; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025984; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025986; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025990; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025992; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025996; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025997; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025998; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025999; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026001; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026004; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026005; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026007; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026011; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026019; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026024; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026028; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026031; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026034; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026035; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026044; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026046; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026050; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026052; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026061; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026064; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026068; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026069; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026072; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026073; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026081; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026084; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026085; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026086; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026087; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026088; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026089; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026092; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026094; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026095; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026096; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026097; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026103; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026104; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026105; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026106; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026108; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026113; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026114; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022701; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024498; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024499; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024500; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024505; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024513; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024514; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024518; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024525; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024529; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024530; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024532; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024535; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024538; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024542; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024548; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024549; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024552; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024553; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024554; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024555; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024556; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024562; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024566; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024568; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024570; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024575; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024579; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024580; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024588; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024589; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024591; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024593; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024595; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024596; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024597; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024598; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024600; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024602; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024603; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024604; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024605; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024624; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024627; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024636; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024640; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024642; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024643; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024646; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024648; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024649; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024650; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024658; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024661; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024664; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024666; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024679; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024684; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024687; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024692; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024693; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024699; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024707; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024708; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024711; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024722; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024723; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024724; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024726; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024727; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024735; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024739; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024741; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024744; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024748; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024751; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024752; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024753; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024755; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024760; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024762; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024764; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024774; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024775; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024776; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024777; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024779; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024782; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024783; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024785; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024799; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024801; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024802; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024806; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024809; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024812; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024813; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024822; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024824; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024828; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024830; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024842; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024846; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024847; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024849; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024851; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024859; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024862; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024863; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024864; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024865; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024867; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024870; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024872; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024873; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024874; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024875; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024876; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024882; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024883; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024886; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024891; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024892; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027014; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020448; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023175; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025014; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025015; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025016; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025021; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025024; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025029; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025030; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025034; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025041; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025045; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025046; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025051; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025058; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025059; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025064; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025066; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025071; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025078; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025082; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025083; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025085; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025090; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025094; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025095; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025099; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025103; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025106; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025108; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025110; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025111; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025112; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025113; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025115; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025116; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025118; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025119; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025120; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025122; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025142; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025151; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025155; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025157; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025158; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025161; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025163; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025164; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025165; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025173; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025176; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025179; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025181; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025199; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025200; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025202; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025207; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025208; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025211; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025213; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025222; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025223; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025226; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025237; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025238; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025239; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025241; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025242; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025244; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025250; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025254; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025255; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025258; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025262; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025266; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025267; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025268; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025270; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025275; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025277; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025279; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025283; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025285; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025289; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025290; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025291; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025292; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025294; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025297; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025298; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025304; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025312; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025313; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025315; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025322; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025325; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025328; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025329; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025338; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025340; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025344; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025346; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025355; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025358; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025362; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025363; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025365; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025366; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025367; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025375; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025378; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025379; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025380; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025381; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025382; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025383; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025386; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025388; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025389; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025390; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025391; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025392; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025397; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025398; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025402; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025407; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025408; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023305; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025145; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025146; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025147; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025152; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025161; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025166; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025173; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025177; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025178; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025180; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025183; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025190; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025197; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025200; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025201; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025202; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025203; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025204; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025210; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025214; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025215; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025217; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025220; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025222; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025231; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025236; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025239; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025241; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025244; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025246; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025248; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025249; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025252; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025253; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025255; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025272; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025275; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025284; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025288; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025290; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025296; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025297; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025306; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025309; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025312; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025314; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025327; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025332; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025335; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025340; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025341; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025344; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025346; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025347; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025355; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025356; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025359; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025370; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025371; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025372; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025374; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025375; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025383; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025387; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025388; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025391; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025395; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025399; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025400; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025401; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025403; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025404; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025408; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025410; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025412; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025416; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025418; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025422; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025423; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025425; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025427; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025430; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025431; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025433; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025437; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025445; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025446; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025448; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025451; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025455; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025458; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025461; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025471; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025473; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025477; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025479; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025488; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025491; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025496; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025498; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025499; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025500; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025508; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025511; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025512; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025513; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025514; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025515; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025516; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025519; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025521; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025522; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025523; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025524; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025525; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025530; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025531; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025532; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025534; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025539; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025540; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025107; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025108; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025109; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025114; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025118; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025123; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025124; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025128; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025135; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025139; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025140; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025142; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025145; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025152; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025153; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025158; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025159; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025160; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025162; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025163; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025166; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025172; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025177; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025178; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025183; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025185; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025189; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025190; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025201; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025203; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025205; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025206; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025207; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025211; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025213; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025214; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025215; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025217; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025234; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025237; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025250; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025252; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025253; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025258; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025259; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025260; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025268; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025274; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025276; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025289; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025294; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025295; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025297; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025302; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025306; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025308; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025309; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025317; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025318; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025321; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025332; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025333; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025334; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025336; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025337; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025339; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025345; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025349; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025351; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025354; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025358; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025362; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025363; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025364; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025366; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025373; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025375; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025379; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025381; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025385; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025386; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025387; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025388; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025390; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025394; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025396; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025408; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025410; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025413; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025417; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025420; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025423; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025424; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025433; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025435; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025439; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025441; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025450; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025451; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025453; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025457; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025458; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025460; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025461; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025462; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025470; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025473; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025474; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025475; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025476; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025477; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025478; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025481; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025483; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025484; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025485; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025486; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025487; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025492; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025493; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025494; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025496; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025501; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025502; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020646; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023383; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025233; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025234; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025239; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025242; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025247; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025248; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025252; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025259; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025263; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025283; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025284; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025287; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025288; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025289; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025296; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025300; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025302; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025304; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025309; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025314; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025318; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025322; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025325; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025329; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025330; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025331; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025332; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025334; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025337; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025338; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025339; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025358; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025361; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025370; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025374; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025376; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025377; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025380; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025382; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025383; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025384; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025392; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025398; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025413; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025418; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025421; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025426; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025427; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025430; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025432; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025433; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025441; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025445; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025456; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025457; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025458; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025460; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025461; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025469; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025473; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025477; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025481; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025485; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025486; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025487; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025489; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025494; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025496; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025498; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025502; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025504; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025508; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025509; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025510; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025511; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025513; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025516; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025517; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025519; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025523; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025531; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025532; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025534; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025537; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025541; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025544; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025547; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025548; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025557; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025559; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025563; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025565; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025574; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025577; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025581; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025582; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025584; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025586; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025594; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025597; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025598; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025599; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025600; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025601; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025605; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025607; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025608; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025609; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025610; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025611; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025616; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025617; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025618; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025621; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025626; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025627; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023293; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025140; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025142; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025147; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025150; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025160; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025167; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025171; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025172; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025174; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025177; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025184; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025185; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025190; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025192; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025194; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025195; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025196; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025198; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025204; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025208; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025209; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025214; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025216; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025220; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025225; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025229; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025232; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025234; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025236; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025239; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025241; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025242; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025243; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025244; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025245; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025246; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025248; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025268; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025277; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025281; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025283; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025287; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025289; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025290; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025302; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025305; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025307; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025320; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025325; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025326; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025333; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025334; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025337; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025339; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025340; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025348; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025349; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025350; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025352; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025363; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025364; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025365; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025367; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025368; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025376; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025380; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025381; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025384; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025388; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025392; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025394; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025396; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025401; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025403; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025405; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025409; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025411; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025415; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025416; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025417; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025418; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025420; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025424; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025426; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025430; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025438; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025439; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025441; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025443; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025444; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025448; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025451; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025454; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025455; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025464; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025466; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025470; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025472; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025481; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025484; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025488; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025489; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025491; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025492; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025493; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025501; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025504; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025505; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025506; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025507; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025508; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025509; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025512; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025514; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025515; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025516; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025517; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025518; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025523; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025524; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025525; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025527; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025532; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025533; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023923; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025775; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025785; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025790; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025791; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025795; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025802; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025806; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025807; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025809; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025812; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025819; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025820; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025826; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025829; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025830; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025831; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025832; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025833; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025844; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025845; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025847; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025850; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025852; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025856; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025857; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025861; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025867; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025870; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025874; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025875; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025876; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025877; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025881; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025882; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025883; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025884; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025886; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025906; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025919; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025921; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025922; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025925; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025927; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025928; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025929; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025937; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025940; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025943; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025958; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025963; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025964; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025966; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025972; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025977; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025978; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025986; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025987; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025990; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026001; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026002; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026003; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026006; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026014; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026018; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026020; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026023; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026027; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026031; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026032; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026033; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026035; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026040; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026042; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026044; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026048; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026050; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026055; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026056; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026057; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026059; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026063; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026065; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026069; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026077; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026079; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026082; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026086; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026089; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026092; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026093; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026102; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026104; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026108; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026110; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026119; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026122; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026126; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026127; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026129; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026130; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026131; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026139; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026142; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026144; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026145; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026146; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026147; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026150; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026152; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026153; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026154; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026155; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026156; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026161; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026162; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026163; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026166; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026172; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022451; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024247; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024249; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024254; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024258; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024263; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024264; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024265; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024269; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024276; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024280; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024281; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024283; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024286; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024289; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024293; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024294; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024299; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024300; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024301; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024303; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024304; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024305; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024306; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024307; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024313; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024319; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024324; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024328; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024329; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024333; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024337; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024342; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024344; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024346; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024347; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024349; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024351; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024352; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024353; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024355; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024372; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024375; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024384; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024388; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024390; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024394; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024396; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024397; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024398; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024406; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024409; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024412; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024414; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024427; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024432; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024433; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024435; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024441; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024446; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024447; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024455; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024456; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024459; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024469; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024470; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024471; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024473; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024474; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024476; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024482; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024486; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024487; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024494; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024499; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024500; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024502; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024507; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024509; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024511; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024515; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024517; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024521; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024522; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024523; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024524; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024526; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024530; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024532; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024536; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024544; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024545; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024547; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024549; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024550; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024554; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024557; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024561; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024570; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024572; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024576; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024578; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024587; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024590; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024594; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024595; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024597; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024598; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024599; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024607; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024608; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024609; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024610; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024614; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024617; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024618; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024619; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024620; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024625; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024626; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024627; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024628; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024633; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020064; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022763; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024568; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024569; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024570; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024575; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024578; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024583; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024584; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024588; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024595; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024599; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024600; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024602; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024605; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024608; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024612; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024613; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024618; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024619; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024620; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024622; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024624; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024625; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024626; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024632; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024636; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024638; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024640; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024643; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024645; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024649; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024650; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024654; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024661; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024663; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024665; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024666; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024667; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024668; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024670; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024671; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024672; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024673; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024674; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024676; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024693; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024696; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024705; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024709; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024711; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024712; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024715; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024717; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024718; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024719; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024727; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024730; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024733; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024735; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024753; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024754; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024756; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024761; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024762; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024765; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024767; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024768; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024776; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024777; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024780; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024791; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024792; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024793; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024795; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024796; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024804; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024808; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024809; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024812; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024816; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024819; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024820; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024821; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024823; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024824; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024828; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024830; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024832; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024836; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024838; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024842; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024843; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024844; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024845; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024847; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024850; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024851; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024853; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024857; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024865; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024866; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024868; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024871; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024875; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024878; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024881; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024882; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024891; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024893; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024897; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024899; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024908; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024911; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024916; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024918; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024919; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024920; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024928; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024930; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024931; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024932; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024933; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024934; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024938; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024940; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024941; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024942; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024943; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024944; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024949; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024950; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024951; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024954; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024959; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024960; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028135; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028200; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028286; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044009; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095035; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113612; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114251; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114942; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115055; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123202; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000195688; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201185; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214897; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217479; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037550; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046701; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052304; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052307; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052310; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052331; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052344; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052384; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052387; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052408; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052446; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052485; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052491; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052495; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052509; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052558; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052625; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052632; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052633; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052647; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052650; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052656; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052658; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052660; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052693; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052721; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052729; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052763; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052774; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052784; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052785; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052826; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052842; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052855; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052884; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052886; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052887; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052893; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052897; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052898; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052899; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052901; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052905; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052906; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052922; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053042; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053054; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053099; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053128; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053145; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053150; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053176; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053183; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053190; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053199; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053237; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053252; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053307; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053352; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053358; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053372; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053411; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053412; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053424; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053441; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053447; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053483; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053484; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053504; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053549; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053561; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053583; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053590; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053617; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053646; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053658; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053672; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053725; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053746; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053755; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053763; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053772; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053780; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053805; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053831; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053869; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053884; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053906; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053913; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053918; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053921; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053968; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053973; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053985; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054058; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054065; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054093; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054123; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054144; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054153; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054175; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054181; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054231; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054249; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054281; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054289; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054359; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054371; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054403; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054414; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054423; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054424; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054426; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054474; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054483; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054484; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054485; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054486; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054490; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054492; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054493; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054494; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054495; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054496; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054503; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054504; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054505; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054507; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054526; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037494; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052312; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052319; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052340; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052396; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052399; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052457; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052502; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052506; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052632; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052640; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052653; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052656; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052662; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052664; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052666; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052700; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052728; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052736; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052769; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052780; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052791; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052792; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052833; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052849; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052862; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052883; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052893; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052894; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052900; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052905; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052906; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052908; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052912; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052913; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052929; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053050; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053062; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053136; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053153; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053158; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053184; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053191; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053198; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053207; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053245; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053252; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053258; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053260; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053318; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053363; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053422; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053423; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053452; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053458; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053497; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053498; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053518; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053573; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053575; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053586; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053604; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053631; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053659; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053686; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053739; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053761; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053770; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053778; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053787; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053812; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053846; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053884; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053899; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053921; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053928; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053933; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053936; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053964; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053983; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053987; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0053999; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054017; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054073; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054137; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054158; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054167; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054189; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054195; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054245; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054296; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054304; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054375; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054387; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054419; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054430; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054439; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054440; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054442; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054490; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054497; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054498; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054499; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054500; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054501; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054502; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054506; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054508; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054509; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054510; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054512; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054517; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054523; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054539; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0054542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0046633; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052260; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052262; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052266; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052287; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052302; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052342; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052345; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052366; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052404; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052444; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052454; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052513; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052581; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052605; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052611; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052613; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052615; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052648; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052675; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052676; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052684; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052718; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052728; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052738; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052739; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052781; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052798; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052811; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052833; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052842; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052844; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052851; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052856; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052857; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052860; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052864; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052865; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053002; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053014; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053059; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053088; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053105; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053110; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053136; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053150; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053159; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053197; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053204; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053210; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053212; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053274; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053319; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053339; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053379; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053391; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053408; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053453; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053454; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053474; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053519; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053531; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053553; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053559; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053587; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053615; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053626; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053640; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053693; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053714; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053723; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053731; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053740; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053765; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053773; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053799; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053837; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053852; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053875; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053882; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053887; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053918; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053941; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053953; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053972; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054029; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054036; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054065; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054095; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054116; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054125; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054149; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054207; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054225; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054257; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054265; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054336; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054348; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054381; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054392; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054401; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054402; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054404; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054452; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054459; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054461; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054462; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054463; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054464; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054468; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054470; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054471; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054472; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054473; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054474; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054479; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054481; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054482; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054485; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054501; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0054504; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037511; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046642; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052258; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052260; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052263; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052284; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052301; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052341; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052365; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052402; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052441; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052447; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052451; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052464; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052509; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052512; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052579; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052586; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052600; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052603; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052609; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052611; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052613; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052646; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052673; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052674; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052682; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052715; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052725; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052735; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052736; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052777; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052793; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052806; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052836; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052838; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052839; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052845; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052850; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052851; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052853; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052854; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052858; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052859; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052875; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052994; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053006; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053051; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053080; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053097; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053102; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053128; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053135; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053142; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053151; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053189; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053196; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053202; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053205; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053264; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053309; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053315; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053329; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053368; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053381; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053398; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053404; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053443; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053444; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053464; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053509; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053519; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053543; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053550; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053604; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053615; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053629; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053682; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053703; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053712; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053730; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053738; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053755; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053763; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053789; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053827; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053842; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053864; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053871; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053876; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053879; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053908; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053931; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053943; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053961; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054018; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054025; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054054; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054084; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054105; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054114; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054136; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054142; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054193; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054211; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054243; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054251; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054322; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054334; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054366; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054377; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054386; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054387; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054389; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054436; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054443; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054444; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054445; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054446; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054447; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054448; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054452; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054454; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054455; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054456; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054457; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054458; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054466; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054486; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046373; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051991; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051993; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051997; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052018; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052034; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052074; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052077; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052098; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052135; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052180; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052184; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052198; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052243; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052311; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052318; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052319; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052333; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052344; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052346; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052379; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052406; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052407; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052459; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052469; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052470; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052529; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052542; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052564; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052572; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052575; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052586; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052587; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052590; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052594; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052595; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052611; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052729; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052741; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052786; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052815; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052832; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052837; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052863; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052870; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052877; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052886; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052924; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052931; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052937; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052940; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052994; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053039; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053045; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053059; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053098; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053099; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053111; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053128; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053173; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053250; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053274; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053281; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053308; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053337; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053350; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053417; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053438; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053447; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053455; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053464; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053472; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053497; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053523; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053561; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053576; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053598; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053610; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053613; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053641; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053660; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053663; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053675; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053693; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053749; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053782; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053812; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053833; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053864; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053870; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053921; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053939; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053971; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053979; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054050; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054093; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054113; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054114; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054116; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054164; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054171; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054172; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054173; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054180; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054182; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054183; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054184; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054185; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054186; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054191; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054196; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054212; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0054215; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037971; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0047123; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052744; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052746; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052770; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052785; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052827; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052830; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052888; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052927; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052931; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052935; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052993; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052996; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053063; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053070; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053071; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053088; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053094; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053096; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053099; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053132; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053159; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053161; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053203; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053213; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053223; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053224; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053266; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053283; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053296; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053318; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053326; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053328; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053329; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053335; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053340; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053341; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053342; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053344; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053348; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053349; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053365; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053486; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053494; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053539; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053568; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053585; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053590; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053616; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053623; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053630; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053639; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053677; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053684; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053690; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053692; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053753; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053799; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053805; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053819; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053858; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053871; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053895; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053935; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054009; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054021; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054066; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054094; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054107; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054121; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054174; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054194; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054203; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054212; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054221; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054231; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054243; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054277; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054330; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054352; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054359; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054364; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054367; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054395; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054418; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054430; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054448; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054504; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054537; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054567; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054588; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054597; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054619; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054625; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054675; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054693; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054725; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054733; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054805; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054817; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054849; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054869; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054870; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054872; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054918; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054925; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054927; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054928; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054930; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054936; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054938; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054939; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054945; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054947; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054949; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054967; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054970; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046473; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052145; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052149; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052152; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052186; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052226; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052229; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052250; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052289; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052329; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052335; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052339; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052363; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052401; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052469; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052477; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052503; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052507; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052541; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052568; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052578; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052622; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052634; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052635; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052693; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052695; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052706; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052728; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052736; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052738; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052739; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052745; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052748; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052749; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052751; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052759; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052760; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052776; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052897; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052909; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052955; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052984; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053001; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053006; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053032; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053039; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053046; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053055; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053093; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053100; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053106; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053163; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053209; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053215; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053229; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053268; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053298; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053304; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053340; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053341; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053360; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053407; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053417; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053419; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053430; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053441; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053448; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053504; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053516; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053530; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053583; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053602; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053611; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053628; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053653; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053661; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053687; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053762; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053763; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053779; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053809; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053827; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053831; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053843; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053862; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053918; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053951; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053975; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053981; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054003; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054012; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054034; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054040; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054092; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054111; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054143; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054151; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054225; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054237; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054280; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054289; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054290; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054292; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054343; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054350; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054351; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054353; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054354; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054359; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054361; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054362; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054363; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054364; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054365; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054370; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054372; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054376; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054392; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0063560; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037170; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046311; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051937; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051939; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051943; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051964; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051979; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052019; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052022; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052043; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052081; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052120; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052126; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052143; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052188; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052191; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052258; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052265; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052266; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052279; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052282; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052288; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052290; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052294; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052327; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052354; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052355; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052363; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052415; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052458; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052474; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052509; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052517; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052519; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052520; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052526; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052531; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052532; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052535; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052539; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052540; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052556; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052683; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052728; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052757; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052779; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052805; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052812; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052819; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052828; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052866; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052873; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052879; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052881; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052940; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052985; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0052991; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053044; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053045; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053057; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053082; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053121; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053142; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053197; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053199; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053228; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053255; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053283; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053295; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053309; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053362; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053391; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053399; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053408; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053433; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053441; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053467; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053505; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053520; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053542; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053549; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053554; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053585; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053604; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053609; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053621; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053639; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053695; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053702; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053728; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053758; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053779; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053788; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053812; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053818; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053870; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053888; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053920; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053928; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0053999; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054011; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054044; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054055; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054064; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054065; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054067; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054115; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054123; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054124; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054125; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054126; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054131; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054133; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054134; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054136; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054137; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054142; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054144; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054145; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054148; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054164; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0054167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0046424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052040; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052042; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052083; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052122; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052125; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052146; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052183; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052222; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052228; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052232; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052246; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052291; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052359; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052366; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052367; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052383; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052391; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052426; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052453; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052454; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052462; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052496; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052507; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052560; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052577; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052590; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052620; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052629; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052634; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052636; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052638; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052642; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052643; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052659; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052781; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052793; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052838; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052867; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052884; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052889; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052915; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052929; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052976; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052983; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0052992; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053050; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053096; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053102; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053116; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053155; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053156; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053168; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053193; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053232; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053298; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053310; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053321; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053332; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053338; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053365; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053404; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053418; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053471; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053491; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053500; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053508; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053525; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053542; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053550; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053576; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053614; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053629; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053651; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053658; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053666; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053694; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053713; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053717; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053729; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053747; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053803; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053810; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053838; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053868; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053889; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053898; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053978; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0053996; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054028; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054036; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054107; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054119; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054152; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054172; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054173; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054175; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054223; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054230; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054231; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054232; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054234; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054239; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054241; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054243; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054244; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054245; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054250; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054252; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054255; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054271; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0054274; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0046389; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051999; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052001; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052004; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052025; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052042; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052080; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052083; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052104; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052141; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052180; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052186; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052190; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052248; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052251; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052326; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052327; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052340; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052349; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052351; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052353; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052387; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052415; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052416; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052424; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052457; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052468; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052478; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052479; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052520; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052549; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052571; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052579; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052582; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052588; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052594; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052597; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052604; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052621; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052741; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052753; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052798; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052827; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052844; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052875; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052898; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052936; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052949; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0052952; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053010; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053055; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053061; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053075; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053114; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053115; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053127; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053150; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053189; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053190; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053256; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053266; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053279; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053290; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053297; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053324; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053353; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053366; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053380; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053433; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053454; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053471; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053480; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053505; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053513; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053539; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053592; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053621; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053626; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053657; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053678; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053690; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053707; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053765; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053798; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053828; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053858; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053880; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053886; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053936; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053954; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053987; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0053995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054065; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054080; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054123; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054132; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054133; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054135; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054183; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054190; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054191; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054192; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054193; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054194; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054195; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054199; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054202; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054204; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054205; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054212; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054213; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054215; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054231; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0054234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037437; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052159; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052162; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052165; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052186; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052201; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052241; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052244; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052302; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052341; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052347; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052364; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052409; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052477; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052485; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052510; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052545; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052572; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052574; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052582; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052677; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052692; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052705; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052727; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052735; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052737; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052738; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052744; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052749; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052750; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052753; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052757; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052774; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052894; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052906; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052951; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052980; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0052997; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053002; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053028; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053035; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053042; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053089; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053096; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053102; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053104; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053163; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053208; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053214; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053228; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053267; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053268; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053280; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053303; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053339; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053340; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053359; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053416; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053427; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053438; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053445; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053500; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053512; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053579; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053599; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053608; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053658; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053684; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053722; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053737; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053759; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053766; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053771; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053774; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053802; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053821; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053823; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053835; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053853; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053909; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053916; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053974; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0053995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054004; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054026; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054032; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054081; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054099; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054131; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054139; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054210; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054254; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054274; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054275; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054277; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054325; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054332; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054334; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054335; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054337; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054341; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054343; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054346; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054347; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054352; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054354; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054355; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054358; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054374; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0054377; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046368; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051993; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051995; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052019; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052035; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052074; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052077; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052098; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052135; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052174; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052180; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052197; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052242; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052245; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052312; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052319; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052336; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052342; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052344; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052346; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052406; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052407; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052415; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052449; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052468; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052469; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052526; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052539; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052561; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052570; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052572; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052583; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052584; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052585; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052591; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052592; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052728; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052740; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052785; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052814; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052831; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052836; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052862; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052869; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052876; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052885; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052923; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052930; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052936; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052938; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052996; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053042; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053048; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053062; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053101; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053102; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053114; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053131; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053137; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053176; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053177; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053197; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053242; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053252; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053254; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053285; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053312; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053365; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053440; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053449; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053457; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053466; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053474; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053499; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053525; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053563; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053600; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053607; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053612; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053616; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053644; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053667; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053679; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053697; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053754; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053761; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053789; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053813; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053819; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053840; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053849; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053871; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053877; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053929; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053947; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053980; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053988; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054059; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054071; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054103; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054114; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054123; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054124; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054126; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054174; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054181; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054182; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054183; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054186; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054192; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054193; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054194; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054195; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054201; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054203; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054204; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054206; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054222; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0054225; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038024; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047217; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052878; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052881; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052884; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052905; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052920; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052959; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052962; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052983; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053020; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053059; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053065; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053127; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053130; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053197; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053204; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053205; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053222; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053228; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053230; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053232; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053268; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053295; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053296; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053304; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053337; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053348; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053358; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053359; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053400; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053418; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053431; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053461; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053463; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053464; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053470; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053475; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053476; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053477; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053479; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053484; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053621; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053633; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053678; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053707; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053724; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053729; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053755; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053762; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053769; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053778; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053822; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053828; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053830; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053934; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053940; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053993; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053994; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054006; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054023; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054029; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054068; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054146; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054157; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054168; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054175; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054230; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054257; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054310; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054331; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054340; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054348; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054357; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054382; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054416; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054454; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054469; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054491; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054503; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054506; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054534; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054557; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054569; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054587; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054677; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054707; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054728; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054737; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054759; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054765; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054816; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054867; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054875; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054946; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054958; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054990; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055000; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055009; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055010; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055012; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055059; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055066; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055068; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055070; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055071; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055075; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055078; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055079; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055080; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055081; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055086; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055088; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055092; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055108; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055111; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046063; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051750; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051754; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051758; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051778; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051794; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051835; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051838; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051839; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051860; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051900; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051940; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051976; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052010; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052013; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052081; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052088; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052089; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052103; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052106; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052115; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052117; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052153; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052180; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052188; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052225; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052236; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052237; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052279; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052295; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052308; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052327; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052336; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052339; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052345; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052350; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052351; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052353; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052360; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052361; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052377; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052507; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052553; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052582; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052599; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052604; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052653; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052692; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052699; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052705; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052708; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052766; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052811; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052831; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052870; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052900; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052906; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052941; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052942; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052961; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053007; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053017; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053019; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053030; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053041; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053048; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053076; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053106; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053118; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053185; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053203; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053212; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053229; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053254; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053262; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053288; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053326; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053341; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053364; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053371; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053377; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053381; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053411; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053430; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053447; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053466; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053524; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053531; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053559; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053584; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053590; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053610; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053619; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053643; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053649; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053700; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053719; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053751; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053759; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053837; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053850; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053882; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053893; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053902; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053903; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053905; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053956; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053961; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053962; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053963; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053968; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053970; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053972; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053973; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053974; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053979; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053981; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053982; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053983; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053999; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0054002; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036667; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045741; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051271; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051274; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051277; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051298; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051313; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051353; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051356; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051377; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051415; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051454; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051460; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051464; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051478; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051523; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051525; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051592; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051599; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051600; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051614; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051617; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051623; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051625; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051629; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051662; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051689; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051691; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051699; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051733; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051743; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051753; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051754; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051796; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051812; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051814; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051825; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051847; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051855; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051856; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051857; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051863; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051868; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051869; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051871; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051875; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051876; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051892; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052024; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052069; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052098; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052115; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052146; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052153; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052160; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052169; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052207; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052214; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052220; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052222; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052278; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052323; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052329; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052343; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052382; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052383; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052395; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052413; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052419; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052456; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052475; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052520; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052530; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052532; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052542; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052553; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052560; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052586; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052615; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052627; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052641; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052694; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052710; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052719; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052727; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052736; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052744; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052761; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052769; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052795; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052848; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052870; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052877; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052882; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052885; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052913; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052932; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052948; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052966; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053021; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053028; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053056; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053086; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053107; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053116; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053138; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053144; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053195; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053245; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053253; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053337; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053379; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053388; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053389; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053391; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053438; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053444; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053445; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053446; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053447; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053448; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053453; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053456; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053458; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053459; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053464; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053466; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053467; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053470; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053486; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053489; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..34874695
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    6550..6912
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    19464..19483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22297..22316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29528..29547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30678..30697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31964..31983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35418..36579
FT                   /estimated_length=1162
FT                   /gap_type="unknown"
FT   assembly_gap    42949..43026
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            65904..179822
FT                   /locus_tag="mCG_17280"
FT                   /note="gene_id=mCG17280.2"
FT   mRNA            join(65904..65947,130188..130415,138409..138501,
FT                   149261..149419,154521..154697,172275..172391,
FT                   175490..175604,176838..179822)
FT                   /locus_tag="mCG_17280"
FT                   /product="mCG17280"
FT                   /note="gene_id=mCG17280.2 transcript_id=mCT17100.2 created
FT                   on 09-SEP-2002"
FT   assembly_gap    69743..70497
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    95331..96130
FT                   /estimated_length=800
FT                   /gap_type="unknown"
FT   assembly_gap    103191..103210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    104652..105133
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    112517..112536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(138459..138501,149261..149419,154521..154697,
FT                   172275..172391,175490..175604,176838..178530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17280"
FT                   /product="mCG17280"
FT                   /note="gene_id=mCG17280.2 transcript_id=mCT17100.2
FT                   protein_id=mCP15884.2"
FT                   /db_xref="GOA:A2ATL1"
FT                   /db_xref="InterPro:IPR018890"
FT                   /db_xref="MGI:MGI:2442917"
FT                   /db_xref="UniProtKB/TrEMBL:A2ATL1"
FT                   /protein_id="EDL07920.1"
FT                   /translation="MVYEDVVQIVSGFQGARPQPRVHFQRRALRLPENTSYSDLTAFLT
FT                   AASSPSEVDSFPYLRGLDGNGTGNSTRYDLTPVTAVSVHLLSGNGMPVLVDGPIYVTVP
FT                   LATQSSLRHNAYVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPP
FT                   IPGPVMTQDITTYHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPPA
FT                   LESSKRDQATSMSHINLLFSRRASDYPGPLSVSSHSRPEAPGTKELMGGVHLEMMSPKG
FT                   EGDLHTPMLKLSYSTSQEFSSREELLSHKEEDKSQTSFDNLTPSGTLGKDYHKSVEIFP
FT                   LKARKSMEKEDYEAPGNDDYRGSYNTVLSQSLFEKQDQEGLASAGSKLTIQEHMYHVPL
FT                   SPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVI
FT                   PAHYMKLPGDHSYVSQPLVVPADQQLEIGRLQAELSNPHAGIFPHPSSQIQGQPLSSQA
FT                   ISQQHLQEAGAREWSSQSASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKP
FT                   LPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDPL
FT                   SLQQSHTPLQEHQQKDPRAPDSTACTQLLYLEDMDPSGSECAATVCTPEDSALRCLLEG
FT                   SGRRSGGQLPSLQEETTKRTSDVPLEPLASPNQRRSANDEDEDDDDDDDDQGEDKKSPW
FT                   QKREERPLMAFNIK"
FT   assembly_gap    162738..162757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    170823..171000
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    197596..197759
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    202816..202859
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    220160..220179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222596..222615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    235895..235914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <236026..278108
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /note="gene_id=mCG17292.2"
FT   mRNA            join(<236026..236147,256551..256686,257136..257178,
FT                   261206..261350,264195..264313,264401..264492,
FT                   264600..264716,266433..266603,267879..267987,
FT                   274310..274480,276570..276737,277003..277140,
FT                   277810..277934)
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, transcript variant
FT                   mCT190151"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT190151.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(236029..236147,256551..256686,257136..257178,
FT                   258722..258771,261206..261350,264195..264313,
FT                   264401..264492,264600..264716,266433..266603,
FT                   267879..267987,274310..274480,276570..276737,
FT                   277003..277140,277810..278108)
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, transcript variant
FT                   mCT17292"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT17292.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(236038..236147,256551..256686,257136..257178,
FT                   258722..258771,261206..261350,264195..264313,
FT                   264401..264492,264600..264716,266433..266603,
FT                   267879..267987,274310..274480,276570..276737,
FT                   277003..277140,277810..277830)
FT                   /codon_start=1
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, isoform CRA_a"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT17292.0
FT                   protein_id=mCP15866.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3THR4"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="MGI:MGI:1202298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3THR4"
FT                   /protein_id="EDL07921.1"
FT                   /translation="MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGDLGA
FT                   KKKKKKQKRKKEKPNSGGTKSDSASDSQEIKIQQSSKHNAIWQQISAGAAMGGDTMEGE
FT                   WIDLRMYHKNPTIPIQKLQDIQRAMELLSACQGPARNIDEATKRRYQFWDTQPVPKLNE
FT                   VITSHGAIEPDKDNIRQEPYSLPQGFMWDTLDLSNAEVLKELYTLLNENYVEDDDNMFR
FT                   FDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKRMVEINFL
FT                   CVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVATCRYWHRSLNPRKLV
FT                   EVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKAVRELINIYLKQFHLAPVM
FT                   DDAEVAHWFLPREHIIDTFVVENPSGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNI
FT                   HTETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCP
FT                   GTDSEKVGLVLQ"
FT   CDS             join(<236111..236147,256551..256686,257136..257178,
FT                   261206..261350,264195..264313,264401..264492,
FT                   264600..264716,266433..266603,267879..267987,
FT                   274310..274480,276570..276737,277003..277140,
FT                   277810..277830)
FT                   /codon_start=1
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT190151.0
FT                   protein_id=mCP111146.0 isoform=CRA_b"
FT                   /protein_id="EDL07922.1"
FT                   /translation="TETMRRRPNTPKEALEGIWEQKRKRRNKREKRRSQILGVPSPTLH
FT                   LTPRRLRFSSLLNTTPSGSRFQQEQPWNPTIPIQKLQDIQRAMELLSACQGPARNIDEA
FT                   TKRRYQFWDTQPVPKLNEVITSHGAIEPDKDNIRQEPYSLPQGFMWDTLDLSNAEVLKE
FT                   LYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIP
FT                   ANIRIYDSVKRMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPK
FT                   PVATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKA
FT                   VRELINIYLKQFHLAPVMDDAEVAHWFLPREHIIDTFVVENPSGKLTDFLSFYTLPSTV
FT                   MHHPAHKSLKAAYSFYNIHTETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLK
FT                   FGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ"
FT   gene            complement(280684..284340)
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /note="gene_id=mCG17284.1"
FT   mRNA            complement(join(280684..281612,284266..284340))
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /product="ribonuclease P/MRP 38 subunit (human)"
FT                   /note="gene_id=mCG17284.1 transcript_id=mCT17284.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(280760..281602)
FT                   /codon_start=1
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /product="ribonuclease P/MRP 38 subunit (human)"
FT                   /note="gene_id=mCG17284.1 transcript_id=mCT17284.1
FT                   protein_id=mCP15859.2"
FT                   /db_xref="GOA:A2AJG0"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="MGI:MGI:2443607"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJG0"
FT                   /protein_id="EDL07923.1"
FT                   /translation="MAAAPQAPKRGSIRKTRPLVVKTSLNNPYVISWSTLEREDIHFIL
FT                   QTLEAKFKLIGLQKIEDKKKRKKTALMKKQSCRPDIEISEDPKEPDGDVLVSGWTPVHV
FT                   RKQLVIGVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQLSERI
FT                   APVIGLKCVLALGFRKNTRDFADEVEAIIPRVPSLNVPWLPDRTQGPTDSLETEPSESQ
FT                   DNEILDTSFDDLTKLSKRKLAEGGQASAATLQPLKIKKLIPNPSKIRKPPKSKKSISK"
FT   assembly_gap    284477..284621
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            287766..292590
FT                   /locus_tag="mCG_17289"
FT                   /note="gene_id=mCG17289.1"
FT   mRNA            join(287766..287821,291927..292047,292149..292211,
FT                   292292..292590)
FT                   /locus_tag="mCG_17289"
FT                   /product="mCG17289"
FT                   /note="gene_id=mCG17289.1 transcript_id=mCT17289.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(287810..287821,291927..292047,292149..292211,
FT                   292292..292365)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17289"
FT                   /product="mCG17289"
FT                   /note="gene_id=mCG17289.1 transcript_id=mCT17289.0
FT                   protein_id=mCP15855.1"
FT                   /protein_id="EDL07924.1"
FT                   /translation="MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIGA
FT                   CPAMLDLKGKAKWEAWNLQKGLSKEDAMCAYISKARELIEKYGI"
FT   gene            complement(293171..>318848)
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /note="gene_id=mCG17290.2"
FT   mRNA            complement(join(293171..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..317002,318695..318824))
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, transcript variant
FT                   mCT17290"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT17290.1 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(293589..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..316999,318695..>318848))
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, transcript variant
FT                   mCT190147"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT190147.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(294004..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..>316856))
FT                   /codon_start=1
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, isoform CRA_a"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT190147.0
FT                   protein_id=mCP111145.0 isoform=CRA_a"
FT                   /protein_id="EDL07925.1"
FT                   /translation="STHRMETAVYAKSTRNEKVLNCLCQKPDALFKLICFPWAGGGSTH
FT                   FAKWGRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTALLPIIRDKAFAFFGH
FT                   SFGSYIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINKLSEEQIRDHLLIF
FT                   GGTPKHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITCFIGSEDVVKDIE
FT                   GWKDITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCLELSSLDYF"
FT   CDS             complement(join(294004..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..316844))
FT                   /codon_start=1
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, isoform CRA_b"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT17290.1
FT                   protein_id=mCP15868.1 isoform=CRA_b"
FT                   /protein_id="EDL07926.1"
FT                   /translation="METAVYAKSTRNEKVLNCLCQKPDALFKLICFPWAGGGSTHFAKW
FT                   GRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTALLPIIRDKAFAFFGHSFGS
FT                   YIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINKLSEEQIRDHLLIFGGTP
FT                   KHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITCFIGSEDVVKDIEGWKD
FT                   ITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCLELSSLDYF"
FT   assembly_gap    301941..301988
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    309061..309136
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    318096..318115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    333479..333871
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    337775..337794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(359961..369950)
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /note="gene_id=mCG17279.1"
FT   mRNA            complement(join(359961..360241,362763..362929,
FT                   369889..369950))
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /product="meiosis expressed gene 1"
FT                   /note="gene_id=mCG17279.1 transcript_id=mCT17099.0 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(360113..360241,362763..362900))
FT                   /codon_start=1
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /product="meiosis expressed gene 1"
FT                   /note="gene_id=mCG17279.1 transcript_id=mCT17099.0
FT                   protein_id=mCP15878.1"
FT                   /protein_id="EDL07927.1"
FT                   /translation="MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVA
FT                   MVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY"
FT   gene            375066..410876
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /note="gene_id=mCG17278.3"
FT   mRNA            join(375066..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..405080)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT17098"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT17098.2 created
FT                   on 09-SEP-2002"
FT   mRNA            join(375067..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,408532..408572,409679..410229)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT173201"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT173201.0 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<375067..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..405080)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190075"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190075.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<375093..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404186,408532..408572,
FT                   409679..410876)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190077"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190077.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<375094..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404186,408532..408572,
FT                   409679..409942)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_e"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190077.0
FT                   protein_id=mCP111076.0 isoform=CRA_e"
FT                   /protein_id="EDL07932.1"
FT                   /translation="LFPRWALGLVFPGAMSSFQGQMAEYPTISIDRFDRENLKARAYFL
FT                   SHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETP
FT                   TQISLVDEASGEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMEL
FT                   LHSGGRVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKA
FT                   AYGYEYLFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQW
FT                   NKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIK
FT                   DFLSYICPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDS
FT                   EEDDDLFDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSL
FT                   ANFIDCEESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITV
FT                   DTMIRTPRPRKMKGCGQWSLKMLLQNLEIQEEKHIFENRGWKMAGQVKGSCGLLEGQSS
FT                   LPTFKLATSLASNSSFWPPWHLHSHAHTQIFTFKKKTKTLL"
FT   mRNA            join(<375109..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..>404764)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190076"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190076.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<375109..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..>404764)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190076.0
FT                   protein_id=mCP111075.0 isoform=CRA_d"
FT                   /protein_id="EDL07931.1"
FT                   /translation="ALGLVFPGAMSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHK
FT                   DHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISL
FT                   VDEASGEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG
FT                   RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYE
FT                   YLFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPC
FT                   GITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSY
FT                   ICPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDD
FT                   LFDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFID
FT                   CEESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEH
FT                   LPSSIETGGSQSPKLCSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGW
FT                   DSQCDTVLLSSQEKSGGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAE
FT                   VNGAPCLVELDTLSGRKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYR
FT                   KLATGQSIVV"
FT   CDS             join(375136..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,408532..408572,409679..409942)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT173201.0
FT                   protein_id=mCP96120.0 isoform=CRA_b"
FT                   /protein_id="EDL07929.1"
FT                   /translation="MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAP
FT                   SLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISLVDEASGEKE
FT                   EVVVTLLPAGHCPGSGSNGTVLYTGDFRLAKGEASRMELLHSGGRVKDIQSVYLDTTFC
FT                   DPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVH
FT                   VDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCGITSQNKTALHTISI
FT                   KPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYICPVNVYPNVIPVGL
FT                   TVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSVDTMIRTPRPRKMKGCGQWS
FT                   LKMLLQNLEIQEEKHIFENRGWKMAGQVKGSCGLLEGQSSLPTFKLATSLASNSSFWPP
FT                   WHLHSHAHTQIFTFKKKTKTLL"
FT   CDS             join(375136..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404797)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT17098.2
FT                   protein_id=mCP15877.2 isoform=CRA_a"
FT                   /protein_id="EDL07928.1"
FT                   /translation="MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAP
FT                   SLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISLVDEASGEKE
FT                   EVVVTLLPAGHCPGSGSNGTVLYTGDFRLAKGEASRMELLHSGGRVKDIQSVYLDTTFC
FT                   DPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVH
FT                   VDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCGITSQNKTALHTISI
FT                   KPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYICPVNVYPNVIPVGL
FT                   TVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDDLFDDPLPTPLRHKVP
FT                   YQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFIDCEESNSDSGEELETP
FT                   PPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEHLPSSIETGGSQSPKL
FT                   CSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGWDSQCDTVLLSSQEKS
FT                   GGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAEVNGAPCLVELDTLSG
FT                   RKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYRKLATGQSIVVEKRKC
FT                   SLLDS"
FT   gene            382784..383278
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /note="gene_id=mCG17281.1"
FT   mRNA            382784..383278
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /product="per-hexamer repeat gene 1"
FT                   /note="gene_id=mCG17281.1 transcript_id=mCT17101.1 created
FT                   on 09-SEP-2002"
FT   CDS             382814..382996
FT                   /codon_start=1
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /product="per-hexamer repeat gene 1"
FT                   /note="gene_id=mCG17281.1 transcript_id=mCT17101.1
FT                   protein_id=mCP15880.1"
FT                   /protein_id="EDL07933.1"
FT                   /translation="MPIVCFDPAYELHLHWPLAGEVQSQHWGTGDRGISGAHWPAPGSL
FT                   REAVSEKKKIIKKDT"
FT   assembly_gap    385490..385561
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   CDS             join(<387444..387475,387976..388077,388663..388735,
FT                   388939..389079,391745..391846,394642..394778,
FT                   395189..395243,398062..398150,401267..401361,
FT                   403836..404797)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190075.0
FT                   protein_id=mCP111074.0 isoform=CRA_c"
FT                   /protein_id="EDL07930.1"
FT                   /translation="LSYQLVTAQDQFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGGR
FT                   VKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEY
FT                   LFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCG
FT                   ITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYI
FT                   CPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDDL
FT                   FDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFIDC
FT                   EESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEHL
FT                   PSSIETGGSQSPKLCSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGWD
FT                   SQCDTVLLSSQEKSGGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAEV
FT                   NGAPCLVELDTLSGRKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYRK
FT                   LATGQSIVVEKRKCSLLDS"
FT   gene            complement(<409611..425951)
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /note="gene_id=mCG17283.1"
FT   mRNA            complement(join(<409611..409717,410745..410874,
FT                   413469..413615,415255..415914,423489..423634,
FT                   425690..425951))
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /product="suppressor of variegation 3-9 homolog 2
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17283.1 transcript_id=mCT17283.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(409611..409717,410745..410874,
FT                   413469..413615,415255..415914,423489..423634,
FT                   425690..425933))
FT                   /codon_start=1
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /product="suppressor of variegation 3-9 homolog 2
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17283.1 transcript_id=mCT17283.1
FT                   protein_id=mCP15881.1"
FT                   /db_xref="GOA:A0A0R4J074"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR007728"
FT                   /db_xref="InterPro:IPR011381"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="MGI:MGI:1890396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J074"
FT                   /protein_id="EDL07934.1"
FT                   /translation="MAAARAKARGSEAGARCHRAPGPPPRPKARRTARRRRAETLTARR
FT                   SRPSAGERRAGSQRAWSGAPRAAVFGDECARGALFKAWCVPCLVSLDTLQELCRKEKLT
FT                   CKSIGITKRNLNNYEVEYLCDYKVAKGVEYYLVKWKGWPDSTNTWEPLRNLRCPQLLRQ
FT                   FSDDKKTYLAQERKCKAVNSKSLQPAIAEYIVQKAKQRIALQRWQDYLNRRKNHKGMIF
FT                   VENTVDLEGPPLDFYYINEYRPAPGISINSEATFGCSCTDCFFDKCCPAEAGVVLAYNK
FT                   KQQIKIQPGTPIYECNSRCRCGPECPNRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKR
FT                   MSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHS
FT                   CDPNLQVFSVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGEASSDSIDHSPAK
FT                   KRVRTQCKCGAETCRGYLN"
FT   assembly_gap    435215..437449
FT                   /estimated_length=2235
FT                   /gap_type="unknown"
FT   gene            complement(439507..463399)
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /note="gene_id=mCG17286.1"
FT   mRNA            complement(join(439507..439722,440351..440421,
FT                   441590..441763,442173..442385,445149..445251,
FT                   447215..447370,448673..448834,449858..449962,
FT                   451699..451789,453145..453250,453382..453430,
FT                   461658..461740,461817..461897,463277..463399))
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /product="heat shock protein 14"
FT                   /note="gene_id=mCG17286.1 transcript_id=mCT17286.0 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(439644..439722,440351..440421,
FT                   441590..441763,442173..442385,445149..445251,
FT                   447215..447370,448673..448834,449858..449962,
FT                   451699..451789,453145..453250,453382..453430,
FT                   461658..461740,461817..461897,463277..463333))
FT                   /codon_start=1
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /product="heat shock protein 14"
FT                   /note="gene_id=mCG17286.1 transcript_id=mCT17286.0
FT                   protein_id=mCP15888.1"
FT                   /protein_id="EDL07935.1"
FT                   /translation="MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSERE
FT                   QVVGLAAKQSRIRHVSSTVVKVKQILGRSSADPQAQKYISESKCLVIEKNGKLRYEIDT
FT                   GEETKLVNPEDVARLIFSKMKETAHSVLGSDANDVVVTVPFDFGEKQKSALGEAAGAAG
FT                   FNVLRLIHEPSAALLAYGIGQDHPTGKSNVLVFKLGGTSLSLSVMEVNSGMYRVLSTNT
FT                   SDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMMKLMNSAEVAKHSLSTLGSANCF
FT                   VDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGFTADDINKVVLCGGSSR
FT                   IPKLQQLIKDLFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDI
FT                   LVKGVDESGADRFTVLFPSGTPLPARRQHTLQAPGRVSSVCLELYESEGKNSAKEEAKF
FT                   AQVVLQDLDKKENGLRDILAVLTMKRDGSLQVTCTDQDTGKCEAITVEVAS"
FT   gene            <463705..474659
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /note="gene_id=mCG17282.1"
FT   mRNA            join(<463705..463884,469947..470074,471662..471803,
FT                   474457..474659)
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /product="arginine-rich, mutated in early stage tumors-like
FT                   1"
FT                   /note="gene_id=mCG17282.1 transcript_id=mCT17102.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<463707..463884,469947..470074,471662..471803,
FT                   474457..474635)
FT                   /codon_start=1
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /product="arginine-rich, mutated in early stage tumors-like
FT                   1"
FT                   /note="gene_id=mCG17282.1 transcript_id=mCT17102.1
FT                   protein_id=mCP15847.1"
FT                   /protein_id="EDL07936.1"
FT                   /translation="LHEAAPTTVRKVWVVPGPRLSMRCISPTALVTFCAGFCISNPVLA
FT                   QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCY
FT                   YLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKM
FT                   RVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL"
FT   assembly_gap    478290..478400
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            481791..482124
FT                   /pseudo
FT                   /locus_tag="mCG_50792"
FT                   /note="gene_id=mCG50792.1"
FT   mRNA            481791..482124
FT                   /pseudo
FT                   /locus_tag="mCG_50792"
FT                   /note="gene_id=mCG50792.1 transcript_id=mCT50975.1 created
FT                   on 09-SEP-2002"
FT   assembly_gap    494960..495063
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            501271..501734
FT                   /locus_tag="mCG_17287"
FT                   /note="gene_id=mCG17287.0"
FT   mRNA            501271..501734
FT                   /locus_tag="mCG_17287"
FT                   /product="mCG17287"
FT                   /note="gene_id=mCG17287.0 transcript_id=mCT17287.0 created
FT                   on 09-SEP-2002"
FT   CDS             501294..501605
FT                   /codon_start=1
FT                   /locus_tag="mCG_17287"
FT                   /product="mCG17287"
FT                   /note="gene_id=mCG17287.0 transcript_id=mCT17287.0
FT                   protein_id=mCP15851.1"
FT                   /protein_id="EDL07937.1"
FT                   /translation="MADKEKKKKESILDLSKYIDKTIRVKFQGGWETSGILKGFDPLLN
FT                   LVLDGTMEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQQDT"
FT   assembly_gap    516842..516927
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    555726..556199
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    585107..585126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    610083..610199
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    612517..612536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    622195..622245
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    628679..628698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(630762..631536)
FT                   /pseudo
FT                   /locus_tag="mCG_49142"
FT                   /note="gene_id=mCG49142.2"
FT   mRNA            complement(630762..631536)
FT                   /pseudo
FT                   /locus_tag="mCG_49142"
FT                   /note="gene_id=mCG49142.2 transcript_id=mCT49325.2 created
FT                   on 09-SEP-2002"
FT   gene            637260..638319
FT                   /pseudo
FT                   /locus_tag="mCG_49141"
FT                   /note="gene_id=mCG49141.2"
FT   mRNA            637260..638319
FT                   /pseudo
FT                   /locus_tag="mCG_49141"
FT                   /note="gene_id=mCG49141.2 transcript_id=mCT49324.2 created
FT                   on 09-SEP-2002"
FT   gene            664384..731187
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /note="gene_id=mCG115758.0"
FT   mRNA            join(664384..664527,723739..723922,729291..729441,
FT                   730545..731187)
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /product="RIKEN cDNA 3110001A13"
FT                   /note="gene_id=mCG115758.0 transcript_id=mCT116868.0
FT                   created on 09-SEP-2002"
FT   assembly_gap    684426..684692
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    691975..692003
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    718306..719582
FT                   /estimated_length=1277
FT                   /gap_type="unknown"
FT   CDS             join(723795..723922,729291..729441,730545..730661)
FT                   /codon_start=1
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /product="RIKEN cDNA 3110001A13"
FT                   /note="gene_id=mCG115758.0 transcript_id=mCT116868.0
FT                   protein_id=mCP51184.1"
FT                   /db_xref="GOA:Q3TGF2"
FT                   /db_xref="InterPro:IPR009533"
FT                   /db_xref="MGI:MGI:1913790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TGF2"
FT                   /protein_id="EDL07938.1"
FT                   /translation="MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGL
FT                   APQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEE
FT                   QENAPEFVKVKGNLRRTGQEVAQAQES"
FT   assembly_gap    725342..725362
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    729914..730262
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    765994..766031
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    768207..768481
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    775520..775539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    786537..787481
FT                   /estimated_length=945
FT                   /gap_type="unknown"
FT   assembly_gap    794673..797385
FT                   /estimated_length=2713
FT                   /gap_type="unknown"
FT   assembly_gap    799219..800815
FT                   /estimated_length=1597
FT                   /gap_type="unknown"
FT   assembly_gap    815752..816263
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    820085..820134
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    885990..890205
FT                   /estimated_length=4216
FT                   /gap_type="unknown"
FT   assembly_gap    892599..892618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    908366..908406
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            963838..968031
FT                   /locus_tag="mCG_147250"
FT                   /note="gene_id=mCG147250.0"
FT   mRNA            join(963838..964125,964557..968031)
FT                   /locus_tag="mCG_147250"
FT                   /product="mCG147250"
FT                   /note="gene_id=mCG147250.0 transcript_id=mCT187513.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    964728..964747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             967173..967490
FT                   /codon_start=1
FT                   /locus_tag="mCG_147250"
FT                   /product="mCG147250"
FT                   /note="gene_id=mCG147250.0 transcript_id=mCT187513.0
FT                   protein_id=mCP109133.0 partial"
FT                   /protein_id="EDL07939.1"
FT                   /translation="MLSPPPSPPPPPETQHGNSIAFLKGGIWFHPGGFSARESMFPIIS
FT                   WLFTLSCQPQRSLLCSPEQNPLTPGQYLTYLCQLDVGLSGGVQHCVLALWENYTDSFHR
FT                   G"
FT   gene            complement(997457..998633)
FT                   /pseudo
FT                   /locus_tag="mCG_59690"
FT                   /note="gene_id=mCG59690.2"
FT   mRNA            complement(997457..998633)
FT                   /pseudo
FT                   /locus_tag="mCG_59690"
FT                   /note="gene_id=mCG59690.2 transcript_id=mCT59873.2 created
FT                   on 09-SEP-2002"
FT   gene            complement(1027861..1028458)
FT                   /pseudo
FT                   /locus_tag="mCG_15453"
FT                   /note="gene_id=mCG15453.2"
FT   mRNA            complement(1027861..1028458)
FT                   /pseudo
FT                   /locus_tag="mCG_15453"
FT                   /note="gene_id=mCG15453.2 transcript_id=mCT17303.2 created
FT                   on 09-SEP-2002"
FT   assembly_gap    1077471..1077696
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            complement(1078082..>1087342)
FT                   /locus_tag="mCG_141120"
FT                   /note="gene_id=mCG141120.0"
FT   mRNA            complement(join(1078082..1078226,1081723..1081802,
FT                   1087133..>1087342))
FT                   /locus_tag="mCG_141120"
FT                   /product="mCG141120"
FT                   /note="gene_id=mCG141120.0 transcript_id=mCT173192.0
FT                   created on 09-SEP-2002"
FT   assembly_gap    1082984..1083003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(1087163..>1087342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141120"
FT                   /product="mCG141120"
FT                   /note="gene_id=mCG141120.0 transcript_id=mCT173192.0
FT                   protein_id=mCP96111.0"
FT                   /protein_id="EDL07940.1"
FT                   /translation="QEHLNLWAGTAGETVTRFCREQDRVLMTVGKRQLVPPIENGLARV
FT                   QVAGEAEPFVSKAA"
FT   assembly_gap    1098194..1100659
FT                   /estimated_length=2466
FT                   /gap_type="unknown"
FT   gene            1101190..1118460
FT                   /locus_tag="mCG_147251"
FT                   /note="gene_id=mCG147251.0"
FT   mRNA            join(1101190..1101429,1115051..1118460)
FT                   /locus_tag="mCG_147251"
FT                   /product="mCG147251"
FT                   /note="gene_id=mCG147251.0 transcript_id=mCT187514.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    1112799..1113410
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   CDS             1115476..1115835
FT                   /codon_start=1
FT                   /locus_tag="mCG_147251"
FT                   /product="mCG147251"
FT                   /note="gene_id=mCG147251.0 transcript_id=mCT187514.0
FT                   protein_id=mCP109134.0"
FT                   /db_xref="MGI:MGI:1919850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ57"
FT                   /protein_id="EDL07941.1"
FT                   /translation="MKKLVADPAQTQHSGISESQVWAGCRHHLGRCCCPWSARVPAPPL
FT                   SSVQAQPVWQHCHRAPGLQQHCCVLWAGHLQPLLRAPHSQAWSSPRENSTLPSGAGTTG
FT                   TAFGKEEMSLLGLGF"
FT   assembly_gap    1128115..1128134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1132342..1132361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1147611..1152043
FT                   /estimated_length=4433
FT                   /gap_type="unknown"
FT   assembly_gap    1153387..1153641
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    1167921..1168069
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1223237..1223256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1239007..>1249025)
FT                   /locus_tag="mCG_145105"
FT                   /note="gene_id=mCG145105.0"
FT   mRNA            complement(join(1239007..1239650,1240142..1240317,
FT                   1245871..1246044,1248428..1248557,1248891..>1249025))
FT                   /locus_tag="mCG_145105"
FT                   /product="mCG145105"
FT                   /note="gene_id=mCG145105.0 transcript_id=mCT184529.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1239897..1240022
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   CDS             complement(join(1246009..1246044,1248428..1248557,
FT                   1248891..>1248958))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145105"
FT                   /product="mCG145105"
FT                   /note="gene_id=mCG145105.0 transcript_id=mCT184529.0
FT                   protein_id=mCP105476.0"
FT                   /protein_id="EDL07942.1"
FT                   /translation="KQTADYSHVAYPLHAAPSQRSISFLLAVPAALAQRDLLPQEWVRG
FT                   ACEENDPEMSTWLLRASDGNQEGTDTHTDMTT"
FT   assembly_gap    1266852..1266871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1290636..1290655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303385..1303893
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    1305792..1305944
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1333048..1333155
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    1334665..1335384
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    1337385..1337464
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1342595..1342614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1345978..1346182
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    1347244..1347273
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1349508..1349770
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   gene            <1379337..1566352
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /note="gene_id=mCG115684.0"
FT   mRNA            join(<1379337..1379399,1421476..1421570,1432402..1432494,
FT                   1446349..1446433,1462149..1462212,1481514..1481597,
FT                   1486268..1486333,1486895..1486952,1488961..1489047,
FT                   1512256..1512332,1518319..1518457,1524565..1524706,
FT                   1538627..1538760,1542886..1543008,1546804..1547076,
FT                   1553523..1553662,1554422..1554586,1555684..1556558,
FT                   1563333..1566352)
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /product="FERM domain containing 4A"
FT                   /note="gene_id=mCG115684.0 transcript_id=mCT116793.1
FT                   created on 09-SEP-2002"
FT   assembly_gap    1386412..1386431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1405781..1405800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1416507..1416526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1422564..1422583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1451445..1451542
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   CDS             join(<1462184..1462212,1481514..1481597,1486268..1486333,
FT                   1486895..1486952,1488961..1489047,1512256..1512332,
FT                   1518319..1518457,1524565..1524706,1538627..1538760,
FT                   1542886..1543008,1546804..1547076,1553523..1553662,
FT                   1554422..1554586,1555684..1556558,1563333..1563391)
FT                   /codon_start=1
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /product="FERM domain containing 4A"
FT                   /note="gene_id=mCG115684.0 transcript_id=mCT116793.1
FT                   protein_id=mCP50669.1"
FT                   /protein_id="EDL07943.1"
FT                   /translation="ISFLYFTGKFNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEY
FT                   YKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKV
FT                   KPRKIFQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIW
FT                   AMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSG
FT                   SLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKRLCLREAELTGKLPVE
FT                   YPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASD
FT                   PNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLVIDGQCHPQAPAP
FT                   LPDNQSLEGLRQLHYHRTDYDKSPLKPKMWSESSLDEPYEKVKKRSSHGHSSSHKRFPS
FT                   TGSCTEAGVSSSLQNSPIRSLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLHS
FT                   LALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHY
FT                   YPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARSGAASTGGGVY
FT                   LHSQSQPSSQYRIKEYPLYIEGSATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFK
FT                   ESWRGGGDEGDAGRLTPSRSQILRTPSLGRDGAHDKGSGRAAVSDELRQWYQRSTASHK
FT                   EHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSELADVQWYGQEKAKP
FT                   GTLV"
FT   assembly_gap    1463348..1464506
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    1465635..1465654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1467021..1470038
FT                   /estimated_length=3018
FT                   /gap_type="unknown"
FT   assembly_gap    1490877..1491684
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    1515377..1515446
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1517534..1517796
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1549976..1550104
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1556635..1556807
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            complement(1574652..1604714)
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /note="gene_id=mCG15455.1"
FT   mRNA            complement(join(1574652..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1589802,
FT                   1591423..1591569,1596226..1596339,1598144..1598248,
FT                   1600816..1600893,1604491..1604714))
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), transcript variant mCT17305"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT17305.1 created
FT                   on 09-SEP-2002"
FT   mRNA            complement(join(1576523..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1591569,
FT                   1596226..1596339,1598144..1598248,1600816..1600893,
FT                   1604491..>1604682))
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), transcript variant mCT190063"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT190063.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1577032..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1589802,
FT                   1591423..1591569,1596226..1596339,1598144..1598248,
FT                   1600816..1600893,1604491..1604556))
FT                   /codon_start=1
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT17305.1
FT                   protein_id=mCP15856.1 isoform=CRA_a"
FT                   /protein_id="EDL07944.1"
FT                   /translation="MDILKSEILRKRQLVEDRNLLVENKKYFKRSELARKEEEAYYERC
FT                   GYKIQPKEDDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYD
FT                   AFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEEN
FT                   TTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSAT
FT                   QKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPI
FT                   GVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYN
FT                   AL"
FT   CDS             complement(join(1577032..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..>1589892))
FT                   /codon_start=1
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT190063.0
FT                   protein_id=mCP111071.0 isoform=CRA_b"
FT                   /protein_id="EDL07945.1"
FT                   /translation="HIAGHMHTLVHLLFKLLCVSEQACFLFPLEALGESLGKGDDHKDM
FT                   DIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPA
FT                   DIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVA
FT                   HVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL"
FT   gene            complement(1605938..1607085)
FT                   /pseudo
FT                   /locus_tag="mCG_1030028"
FT                   /note="gene_id=mCG1030028.1"
FT   mRNA            complement(join(1605938..1606298,1607004..1607085))
FT                   /pseudo
FT                   /locus_tag="mCG_1030028"
FT                   /note="gene_id=mCG1030028.1 transcript_id=mCT147732.1
FT                   created on 09-SEP-2002"
FT   gene            <1652744..>1653178
FT                   /locus_tag="mCG_1029871"
FT                   /note="gene_id=mCG1029871.0"
FT   mRNA            <1652744..>1653178
FT                   /locus_tag="mCG_1029871"
FT                   /product="mCG1029871"
FT                   /note="gene_id=mCG1029871.0 transcript_id=mCT147575.0
FT                   created on 09-SEP-2002"
FT   CDS             1652744..1653178
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029871"
FT                   /product="mCG1029871"
FT                   /note="gene_id=mCG1029871.0 transcript_id=mCT147575.0
FT                   protein_id=mCP51199.0"
FT                   /protein_id="EDL07946.1"
FT                   /translation="MVPVKKLVEKGGKKKKKKKKQVLKCTLDCTHPVEDGIIDAANFEQ
FT                   FLQERIKVNGKAGNLGGGVVTIEQSKSKITVTSEVPFSKRYLKYLTKKYLKKNSLRDWL
FT                   RVVANSKESYELLTSYFQINQDERRTRIRTHWSAMFCINS"
FT   assembly_gap    1670205..1670313
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            <1670559..1755510
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /note="gene_id=mCG115686.0"
FT   mRNA            join(<1670559..1670638,1672870..1672953,1698691..1698993,
FT                   1703889..1704011,1707073..1707344,1717431..1717656,
FT                   1743039..1743158,1754547..1755510)
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /product="RIKEN cDNA E130319B15"
FT                   /note="gene_id=mCG115686.0 transcript_id=mCT116795.1
FT                   created on 09-SEP-2002"
FT   CDS             join(<1670575..1670638,1672870..1672953,1698691..1698993,
FT                   1703889..1704011,1707073..1707344,1717431..1717656,
FT                   1743039..1743158,1754547..1754608)
FT                   /codon_start=1
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /product="RIKEN cDNA E130319B15"
FT                   /note="gene_id=mCG115686.0 transcript_id=mCT116795.1
FT                   protein_id=mCP50697.1"
FT                   /protein_id="EDL07947.1"
FT                   /translation="HEPASAAASVSCRAATLPAPWNYHHEVYKISEFSNDVNGETKETQ
FT                   PIYLGDESMEIKKQITGMRRLLNDSTGRIYQRVGKEGEKLKQEPQVVDLVWPQRSNSST
FT                   EASQGLHSNSRGAWNELPTQSGQFSGQSGPRSRTFQTQPHISASSNGELPGVNSIVGSN
FT                   CCTCNCQSTLQAILQELKTMRKLMQFQAVGTQNRQQPPISLMCSQRTAVSRKRNKKKKV
FT                   LPKTVQPVTAVEPKPSPLETEKKPAASATRPPGLQAAERTSTEENHVLGFGIVLESPSS
FT                   DPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRG
FT                   FNDNRKGLDQNIVGAIKVFTENYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSGH
FT                   TFVIKRETPEDPEPGSVA"
FT   assembly_gap    1670642..1670771
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1685510..1685758
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    1695263..1697804
FT                   /estimated_length=2542
FT                   /gap_type="unknown"
FT   assembly_gap    1699130..1699662
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    1718022..1718041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1730633..1730652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1735272..1735291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1766657..1766711
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    1769608..1769627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1771093..1771702
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    1773809..1773828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1797246..1797445
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    1804096..1804304
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    1807380..1808029
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    1836391..1836568
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            1836889..1864613
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /note="gene_id=mCG15456.1"
FT   mRNA            join(1836889..1836981,1839453..1839726,1844304..1844407,
FT                   1846708..1846815,1848307..1848461,1851779..1851869,
FT                   1854554..1854653,1860562..1860774,1861671..1864613)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, transcript variant
FT                   mCT17306"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT17306.1 created
FT                   on 09-SEP-2002"
FT   mRNA            join(1836890..1836981,1839453..1839726,1844304..1844407,
FT                   1848307..1848461,1851779..1851869,1854554..1854653,
FT                   1860562..1860774,1861671..1863710)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, transcript variant
FT                   mCT173769"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT173769.0 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<1837365..1837696,1839453..1839726,1844304..1844407,
FT                   1846708..1846815,1848307..1848461,1851779..1851869,
FT                   1854554..1854653,1860562..1860774,1861671..1863227)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selen