spacer

EBI Dbfetch

ID   CH466542; SV 1; linear; genomic DNA; CON; MUS; 34874695 BP.
XX
AC   CH466542;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009753004 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-34874695
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-34874695
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 605651218202441b8bf1377f8c93a68e.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000210.
DR   Ensembl-Gn; ENSMUSG00000000194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000889; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007476; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014873; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015085; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015094; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015790; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023206; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024026; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026655; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026735; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026737; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026739; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026743; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026774; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026779; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026788; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026796; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026809; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026810; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026814; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026816; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026820; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026821; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026840; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026848; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026851; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026857; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026860; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026870; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026879; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026882; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026919; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026922; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026925; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026938; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026942; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026976; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026984; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026985; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035437; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036160; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037254; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038765; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039648; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039686; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045684; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047250; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049630; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061305; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063275; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068947; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069682; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075383; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075419; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000076441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079502; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000083361; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094266; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094949; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000099041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028135; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028200; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028286; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044009; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076703; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078854; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095035; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113612; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114251; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114831; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114833; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114942; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115052; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115055; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184164; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..34874695
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            65904..179822
FT                   /locus_tag="mCG_17280"
FT                   /note="gene_id=mCG17280.2"
FT   mRNA            join(65904..65947,130188..130415,138409..138501,
FT                   149261..149419,154521..154697,172275..172391,
FT                   175490..175604,176838..179822)
FT                   /locus_tag="mCG_17280"
FT                   /product="mCG17280"
FT                   /note="gene_id=mCG17280.2 transcript_id=mCT17100.2 created
FT                   on 09-SEP-2002"
FT   CDS             join(138459..138501,149261..149419,154521..154697,
FT                   172275..172391,175490..175604,176838..178530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17280"
FT                   /product="mCG17280"
FT                   /note="gene_id=mCG17280.2 transcript_id=mCT17100.2
FT                   protein_id=mCP15884.2"
FT                   /db_xref="GOA:A2ATL1"
FT                   /db_xref="InterPro:IPR018890"
FT                   /db_xref="MGI:MGI:2442917"
FT                   /db_xref="UniProtKB/TrEMBL:A2ATL1"
FT                   /protein_id="EDL07920.1"
FT                   /translation="MVYEDVVQIVSGFQGARPQPRVHFQRRALRLPENTSYSDLTAFLT
FT                   AASSPSEVDSFPYLRGLDGNGTGNSTRYDLTPVTAVSVHLLSGNGMPVLVDGPIYVTVP
FT                   LATQSSLRHNAYVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPP
FT                   IPGPVMTQDITTYHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPPA
FT                   LESSKRDQATSMSHINLLFSRRASDYPGPLSVSSHSRPEAPGTKELMGGVHLEMMSPKG
FT                   EGDLHTPMLKLSYSTSQEFSSREELLSHKEEDKSQTSFDNLTPSGTLGKDYHKSVEIFP
FT                   LKARKSMEKEDYEAPGNDDYRGSYNTVLSQSLFEKQDQEGLASAGSKLTIQEHMYHVPL
FT                   SPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVI
FT                   PAHYMKLPGDHSYVSQPLVVPADQQLEIGRLQAELSNPHAGIFPHPSSQIQGQPLSSQA
FT                   ISQQHLQEAGAREWSSQSASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKP
FT                   LPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDPL
FT                   SLQQSHTPLQEHQQKDPRAPDSTACTQLLYLEDMDPSGSECAATVCTPEDSALRCLLEG
FT                   SGRRSGGQLPSLQEETTKRTSDVPLEPLASPNQRRSANDEDEDDDDDDDDQGEDKKSPW
FT                   QKREERPLMAFNIK"
FT   gene            <236026..278108
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /note="gene_id=mCG17292.2"
FT   mRNA            join(<236026..236147,256551..256686,257136..257178,
FT                   261206..261350,264195..264313,264401..264492,
FT                   264600..264716,266433..266603,267879..267987,
FT                   274310..274480,276570..276737,277003..277140,
FT                   277810..277934)
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, transcript variant
FT                   mCT190151"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT190151.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(236029..236147,256551..256686,257136..257178,
FT                   258722..258771,261206..261350,264195..264313,
FT                   264401..264492,264600..264716,266433..266603,
FT                   267879..267987,274310..274480,276570..276737,
FT                   277003..277140,277810..278108)
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, transcript variant
FT                   mCT17292"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT17292.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(236038..236147,256551..256686,257136..257178,
FT                   258722..258771,261206..261350,264195..264313,
FT                   264401..264492,264600..264716,266433..266603,
FT                   267879..267987,274310..274480,276570..276737,
FT                   277003..277140,277810..277830)
FT                   /codon_start=1
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, isoform CRA_a"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT17292.0
FT                   protein_id=mCP15866.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3THR4"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="MGI:MGI:1202298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3THR4"
FT                   /protein_id="EDL07921.1"
FT                   /translation="MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGDLGA
FT                   KKKKKKQKRKKEKPNSGGTKSDSASDSQEIKIQQSSKHNAIWQQISAGAAMGGDTMEGE
FT                   WIDLRMYHKNPTIPIQKLQDIQRAMELLSACQGPARNIDEATKRRYQFWDTQPVPKLNE
FT                   VITSHGAIEPDKDNIRQEPYSLPQGFMWDTLDLSNAEVLKELYTLLNENYVEDDDNMFR
FT                   FDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKRMVEINFL
FT                   CVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVATCRYWHRSLNPRKLV
FT                   EVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKAVRELINIYLKQFHLAPVM
FT                   DDAEVAHWFLPREHIIDTFVVENPSGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNI
FT                   HTETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCP
FT                   GTDSEKVGLVLQ"
FT   CDS             join(<236111..236147,256551..256686,257136..257178,
FT                   261206..261350,264195..264313,264401..264492,
FT                   264600..264716,266433..266603,267879..267987,
FT                   274310..274480,276570..276737,277003..277140,
FT                   277810..277830)
FT                   /codon_start=1
FT                   /gene="Nmt2"
FT                   /locus_tag="mCG_17292"
FT                   /product="N-myristoyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG17292.2 transcript_id=mCT190151.0
FT                   protein_id=mCP111146.0 isoform=CRA_b"
FT                   /protein_id="EDL07922.1"
FT                   /translation="TETMRRRPNTPKEALEGIWEQKRKRRNKREKRRSQILGVPSPTLH
FT                   LTPRRLRFSSLLNTTPSGSRFQQEQPWNPTIPIQKLQDIQRAMELLSACQGPARNIDEA
FT                   TKRRYQFWDTQPVPKLNEVITSHGAIEPDKDNIRQEPYSLPQGFMWDTLDLSNAEVLKE
FT                   LYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIP
FT                   ANIRIYDSVKRMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPK
FT                   PVATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKA
FT                   VRELINIYLKQFHLAPVMDDAEVAHWFLPREHIIDTFVVENPSGKLTDFLSFYTLPSTV
FT                   MHHPAHKSLKAAYSFYNIHTETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLK
FT                   FGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ"
FT   gene            complement(280684..284340)
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /note="gene_id=mCG17284.1"
FT   mRNA            complement(join(280684..281612,284266..284340))
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /product="ribonuclease P/MRP 38 subunit (human)"
FT                   /note="gene_id=mCG17284.1 transcript_id=mCT17284.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(280760..281602)
FT                   /codon_start=1
FT                   /gene="Rpp38"
FT                   /locus_tag="mCG_17284"
FT                   /product="ribonuclease P/MRP 38 subunit (human)"
FT                   /note="gene_id=mCG17284.1 transcript_id=mCT17284.1
FT                   protein_id=mCP15859.2"
FT                   /db_xref="GOA:A2AJG0"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="MGI:MGI:2443607"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJG0"
FT                   /protein_id="EDL07923.1"
FT                   /translation="MAAAPQAPKRGSIRKTRPLVVKTSLNNPYVISWSTLEREDIHFIL
FT                   QTLEAKFKLIGLQKIEDKKKRKKTALMKKQSCRPDIEISEDPKEPDGDVLVSGWTPVHV
FT                   RKQLVIGVNEVTRALERNELLLVLVCKSVKPAIITSHLIQLSLSRTVPACQVPQLSERI
FT                   APVIGLKCVLALGFRKNTRDFADEVEAIIPRVPSLNVPWLPDRTQGPTDSLETEPSESQ
FT                   DNEILDTSFDDLTKLSKRKLAEGGQASAATLQPLKIKKLIPNPSKIRKPPKSKKSISK"
FT   gene            287766..292590
FT                   /locus_tag="mCG_17289"
FT                   /note="gene_id=mCG17289.1"
FT   mRNA            join(287766..287821,291927..292047,292149..292211,
FT                   292292..292590)
FT                   /locus_tag="mCG_17289"
FT                   /product="mCG17289"
FT                   /note="gene_id=mCG17289.1 transcript_id=mCT17289.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(287810..287821,291927..292047,292149..292211,
FT                   292292..292365)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17289"
FT                   /product="mCG17289"
FT                   /note="gene_id=mCG17289.1 transcript_id=mCT17289.0
FT                   protein_id=mCP15855.1"
FT                   /protein_id="EDL07924.1"
FT                   /translation="MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIGA
FT                   CPAMLDLKGKAKWEAWNLQKGLSKEDAMCAYISKARELIEKYGI"
FT   gene            complement(293171..>318848)
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /note="gene_id=mCG17290.2"
FT   mRNA            complement(join(293171..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..317002,318695..318824))
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, transcript variant
FT                   mCT17290"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT17290.1 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(293589..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..316999,318695..>318848))
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, transcript variant
FT                   mCT190147"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT190147.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(294004..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..>316856))
FT                   /codon_start=1
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, isoform CRA_a"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT190147.0
FT                   protein_id=mCP111145.0 isoform=CRA_a"
FT                   /protein_id="EDL07925.1"
FT                   /translation="STHRMETAVYAKSTRNEKVLNCLCQKPDALFKLICFPWAGGGSTH
FT                   FAKWGRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTALLPIIRDKAFAFFGH
FT                   SFGSYIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINKLSEEQIRDHLLIF
FT                   GGTPKHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITCFIGSEDVVKDIE
FT                   GWKDITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCLELSSLDYF"
FT   CDS             complement(join(294004..294146,294513..294595,
FT                   297781..297950,298391..298490,299835..299973,
FT                   313173..313303,316813..316844))
FT                   /codon_start=1
FT                   /gene="Olah"
FT                   /locus_tag="mCG_17290"
FT                   /product="oleoyl-ACP hydrolase, isoform CRA_b"
FT                   /note="gene_id=mCG17290.2 transcript_id=mCT17290.1
FT                   protein_id=mCP15868.1 isoform=CRA_b"
FT                   /protein_id="EDL07926.1"
FT                   /translation="METAVYAKSTRNEKVLNCLCQKPDALFKLICFPWAGGGSTHFAKW
FT                   GRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTALLPIIRDKAFAFFGHSFGS
FT                   YIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINKLSEEQIRDHLLIFGGTP
FT                   KHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITCFIGSEDVVKDIEGWKD
FT                   ITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCLELSSLDYF"
FT   gene            complement(359961..369950)
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /note="gene_id=mCG17279.1"
FT   mRNA            complement(join(359961..360241,362763..362929,
FT                   369889..369950))
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /product="meiosis expressed gene 1"
FT                   /note="gene_id=mCG17279.1 transcript_id=mCT17099.0 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(360113..360241,362763..362900))
FT                   /codon_start=1
FT                   /gene="Meig1"
FT                   /locus_tag="mCG_17279"
FT                   /product="meiosis expressed gene 1"
FT                   /note="gene_id=mCG17279.1 transcript_id=mCT17099.0
FT                   protein_id=mCP15878.1"
FT                   /protein_id="EDL07927.1"
FT                   /translation="MATSDVKPKSISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVA
FT                   MVDRWPETGYVKKLQRRDNTFFYYNKERECEDKEVHKVKVYVY"
FT   gene            375066..410876
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /note="gene_id=mCG17278.3"
FT   mRNA            join(375066..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..405080)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT17098"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT17098.2 created
FT                   on 09-SEP-2002"
FT   mRNA            join(375067..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,408532..408572,409679..410229)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT173201"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT173201.0 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<375067..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..405080)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190075"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190075.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<375093..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404186,408532..408572,
FT                   409679..410876)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190077"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190077.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<375094..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404186,408532..408572,
FT                   409679..409942)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_e"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190077.0
FT                   protein_id=mCP111076.0 isoform=CRA_e"
FT                   /protein_id="EDL07932.1"
FT                   /translation="LFPRWALGLVFPGAMSSFQGQMAEYPTISIDRFDRENLKARAYFL
FT                   SHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETP
FT                   TQISLVDEASGEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMEL
FT                   LHSGGRVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKA
FT                   AYGYEYLFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQW
FT                   NKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIK
FT                   DFLSYICPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDS
FT                   EEDDDLFDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSL
FT                   ANFIDCEESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITV
FT                   DTMIRTPRPRKMKGCGQWSLKMLLQNLEIQEEKHIFENRGWKMAGQVKGSCGLLEGQSS
FT                   LPTFKLATSLASNSSFWPPWHLHSHAHTQIFTFKKKTKTLL"
FT   mRNA            join(<375109..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..>404764)
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), transcript variant mCT190076"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190076.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<375109..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387480,387976..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..>404764)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190076.0
FT                   protein_id=mCP111075.0 isoform=CRA_d"
FT                   /protein_id="EDL07931.1"
FT                   /translation="ALGLVFPGAMSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHK
FT                   DHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISL
FT                   VDEASGEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG
FT                   RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYE
FT                   YLFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPC
FT                   GITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSY
FT                   ICPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDD
FT                   LFDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFID
FT                   CEESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEH
FT                   LPSSIETGGSQSPKLCSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGW
FT                   DSQCDTVLLSSQEKSGGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAE
FT                   VNGAPCLVELDTLSGRKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYR
FT                   KLATGQSIVV"
FT   CDS             join(375136..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,408532..408572,409679..409942)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT173201.0
FT                   protein_id=mCP96120.0 isoform=CRA_b"
FT                   /protein_id="EDL07929.1"
FT                   /translation="MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAP
FT                   SLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISLVDEASGEKE
FT                   EVVVTLLPAGHCPGSGSNGTVLYTGDFRLAKGEASRMELLHSGGRVKDIQSVYLDTTFC
FT                   DPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVH
FT                   VDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCGITSQNKTALHTISI
FT                   KPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYICPVNVYPNVIPVGL
FT                   TVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSVDTMIRTPRPRKMKGCGQWS
FT                   LKMLLQNLEIQEEKHIFENRGWKMAGQVKGSCGLLEGQSSLPTFKLATSLASNSSFWPP
FT                   WHLHSHAHTQIFTFKKKTKTLL"
FT   CDS             join(375136..375244,376282..376333,380187..380271,
FT                   384655..384714,387425..387475,387989..388077,
FT                   388663..388735,388939..389079,391745..391846,
FT                   394642..394778,395189..395243,398062..398150,
FT                   401267..401361,403836..404797)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT17098.2
FT                   protein_id=mCP15877.2 isoform=CRA_a"
FT                   /protein_id="EDL07928.1"
FT                   /translation="MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAP
FT                   SLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRIITIEIETPTQISLVDEASGEKE
FT                   EVVVTLLPAGHCPGSGSNGTVLYTGDFRLAKGEASRMELLHSGGRVKDIQSVYLDTTFC
FT                   DPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVH
FT                   VDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCGITSQNKTALHTISI
FT                   KPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYICPVNVYPNVIPVGL
FT                   TVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDDLFDDPLPTPLRHKVP
FT                   YQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFIDCEESNSDSGEELETP
FT                   PPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEHLPSSIETGGSQSPKL
FT                   CSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGWDSQCDTVLLSSQEKS
FT                   GGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAEVNGAPCLVELDTLSG
FT                   RKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYRKLATGQSIVVEKRKC
FT                   SLLDS"
FT   gene            382784..383278
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /note="gene_id=mCG17281.1"
FT   mRNA            382784..383278
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /product="per-hexamer repeat gene 1"
FT                   /note="gene_id=mCG17281.1 transcript_id=mCT17101.1 created
FT                   on 09-SEP-2002"
FT   CDS             382814..382996
FT                   /codon_start=1
FT                   /gene="Phxr1"
FT                   /locus_tag="mCG_17281"
FT                   /product="per-hexamer repeat gene 1"
FT                   /note="gene_id=mCG17281.1 transcript_id=mCT17101.1
FT                   protein_id=mCP15880.1"
FT                   /protein_id="EDL07933.1"
FT                   /translation="MPIVCFDPAYELHLHWPLAGEVQSQHWGTGDRGISGAHWPAPGSL
FT                   REAVSEKKKIIKKDT"
FT   CDS             join(<387444..387475,387976..388077,388663..388735,
FT                   388939..389079,391745..391846,394642..394778,
FT                   395189..395243,398062..398150,401267..401361,
FT                   403836..404797)
FT                   /codon_start=1
FT                   /gene="Dclre1c"
FT                   /locus_tag="mCG_17278"
FT                   /product="DNA cross-link repair 1C, PSO2 homolog (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG17278.3 transcript_id=mCT190075.0
FT                   protein_id=mCP111074.0 isoform=CRA_c"
FT                   /protein_id="EDL07930.1"
FT                   /translation="LSYQLVTAQDQFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGGR
FT                   VKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEY
FT                   LFTNLSEELGVQVHVDKLDMFKNMPDILHHLTTDRNTQIHACRHPKAEECFQWNKLPCG
FT                   ITSQNKTALHTISIKPSTMWFGERTRKTNVIVRTGESSYRACFSFHSSFSEIKDFLSYI
FT                   CPVNVYPNVIPVGLTVDKVMDVLKPLCRSPQSVEPKYKPLGKLKRARTIHLDSEEDDDL
FT                   FDDPLPTPLRHKVPYQLTLQPELFSMKALPLDQPELRQSPGGCKAESVWSPSLANFIDC
FT                   EESNSDSGEELETPPPSLQGGLGPSTLVQQNADPDVDIPQWEVFFKRRDEITGECLEHL
FT                   PSSIETGGSQSPKLCSDSPKLCSDSPKLCSDSDGDSTHISSQNSSQSTHITDQGSQGWD
FT                   SQCDTVLLSSQEKSGGDSTSLNKGAYKPKLKESISASQIEQDALCPQDTHCDLKSRAEV
FT                   NGAPCLVELDTLSGRKSPPEKTLLSSTRADSQSSSDFEIPSTPEAELPTPEHLQCLYRK
FT                   LATGQSIVVEKRKCSLLDS"
FT   gene            complement(<409611..425951)
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /note="gene_id=mCG17283.1"
FT   mRNA            complement(join(<409611..409717,410745..410874,
FT                   413469..413615,415255..415914,423489..423634,
FT                   425690..425951))
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /product="suppressor of variegation 3-9 homolog 2
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17283.1 transcript_id=mCT17283.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(409611..409717,410745..410874,
FT                   413469..413615,415255..415914,423489..423634,
FT                   425690..425933))
FT                   /codon_start=1
FT                   /gene="Suv39h2"
FT                   /locus_tag="mCG_17283"
FT                   /product="suppressor of variegation 3-9 homolog 2
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17283.1 transcript_id=mCT17283.1
FT                   protein_id=mCP15881.1"
FT                   /protein_id="EDL07934.1"
FT                   /translation="MAAARAKARGSEAGARCHRAPGPPPRPKARRTARRRRAETLTARR
FT                   SRPSAGERRAGSQRAWSGAPRAAVFGDECARGALFKAWCVPCLVSLDTLQELCRKEKLT
FT                   CKSIGITKRNLNNYEVEYLCDYKVAKGVEYYLVKWKGWPDSTNTWEPLRNLRCPQLLRQ
FT                   FSDDKKTYLAQERKCKAVNSKSLQPAIAEYIVQKAKQRIALQRWQDYLNRRKNHKGMIF
FT                   VENTVDLEGPPLDFYYINEYRPAPGISINSEATFGCSCTDCFFDKCCPAEAGVVLAYNK
FT                   KQQIKIQPGTPIYECNSRCRCGPECPNRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKR
FT                   MSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHS
FT                   CDPNLQVFSVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGEASSDSIDHSPAK
FT                   KRVRTQCKCGAETCRGYLN"
FT   gene            complement(439507..463399)
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /note="gene_id=mCG17286.1"
FT   mRNA            complement(join(439507..439722,440351..440421,
FT                   441590..441763,442173..442385,445149..445251,
FT                   447215..447370,448673..448834,449858..449962,
FT                   451699..451789,453145..453250,453382..453430,
FT                   461658..461740,461817..461897,463277..463399))
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /product="heat shock protein 14"
FT                   /note="gene_id=mCG17286.1 transcript_id=mCT17286.0 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(439644..439722,440351..440421,
FT                   441590..441763,442173..442385,445149..445251,
FT                   447215..447370,448673..448834,449858..449962,
FT                   451699..451789,453145..453250,453382..453430,
FT                   461658..461740,461817..461897,463277..463333))
FT                   /codon_start=1
FT                   /gene="Hspa14"
FT                   /locus_tag="mCG_17286"
FT                   /product="heat shock protein 14"
FT                   /note="gene_id=mCG17286.1 transcript_id=mCT17286.0
FT                   protein_id=mCP15888.1"
FT                   /protein_id="EDL07935.1"
FT                   /translation="MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSERE
FT                   QVVGLAAKQSRIRHVSSTVVKVKQILGRSSADPQAQKYISESKCLVIEKNGKLRYEIDT
FT                   GEETKLVNPEDVARLIFSKMKETAHSVLGSDANDVVVTVPFDFGEKQKSALGEAAGAAG
FT                   FNVLRLIHEPSAALLAYGIGQDHPTGKSNVLVFKLGGTSLSLSVMEVNSGMYRVLSTNT
FT                   SDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMMKLMNSAEVAKHSLSTLGSANCF
FT                   VDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGFTADDINKVVLCGGSSR
FT                   IPKLQQLIKDLFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDI
FT                   LVKGVDESGADRFTVLFPSGTPLPARRQHTLQAPGRVSSVCLELYESEGKNSAKEEAKF
FT                   AQVVLQDLDKKENGLRDILAVLTMKRDGSLQVTCTDQDTGKCEAITVEVAS"
FT   gene            <463705..474659
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /note="gene_id=mCG17282.1"
FT   mRNA            join(<463705..463884,469947..470074,471662..471803,
FT                   474457..474659)
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /product="arginine-rich, mutated in early stage tumors-like
FT                   1"
FT                   /note="gene_id=mCG17282.1 transcript_id=mCT17102.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<463707..463884,469947..470074,471662..471803,
FT                   474457..474635)
FT                   /codon_start=1
FT                   /gene="Armetl1"
FT                   /locus_tag="mCG_17282"
FT                   /product="arginine-rich, mutated in early stage tumors-like
FT                   1"
FT                   /note="gene_id=mCG17282.1 transcript_id=mCT17102.1
FT                   protein_id=mCP15847.1"
FT                   /protein_id="EDL07936.1"
FT                   /translation="LHEAAPTTVRKVWVVPGPRLSMRCISPTALVTFCAGFCISNPVLA
FT                   QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCY
FT                   YLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKM
FT                   RVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL"
FT   gene            481791..482124
FT                   /pseudo
FT                   /locus_tag="mCG_50792"
FT                   /note="gene_id=mCG50792.1"
FT   mRNA            481791..482124
FT                   /pseudo
FT                   /locus_tag="mCG_50792"
FT                   /note="gene_id=mCG50792.1 transcript_id=mCT50975.1 created
FT                   on 09-SEP-2002"
FT   gene            501271..501734
FT                   /locus_tag="mCG_17287"
FT                   /note="gene_id=mCG17287.0"
FT   mRNA            501271..501734
FT                   /locus_tag="mCG_17287"
FT                   /product="mCG17287"
FT                   /note="gene_id=mCG17287.0 transcript_id=mCT17287.0 created
FT                   on 09-SEP-2002"
FT   CDS             501294..501605
FT                   /codon_start=1
FT                   /locus_tag="mCG_17287"
FT                   /product="mCG17287"
FT                   /note="gene_id=mCG17287.0 transcript_id=mCT17287.0
FT                   protein_id=mCP15851.1"
FT                   /protein_id="EDL07937.1"
FT                   /translation="MADKEKKKKESILDLSKYIDKTIRVKFQGGWETSGILKGFDPLLN
FT                   LVLDGTMEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQQDT"
FT   gene            complement(630762..631536)
FT                   /pseudo
FT                   /locus_tag="mCG_49142"
FT                   /note="gene_id=mCG49142.2"
FT   mRNA            complement(630762..631536)
FT                   /pseudo
FT                   /locus_tag="mCG_49142"
FT                   /note="gene_id=mCG49142.2 transcript_id=mCT49325.2 created
FT                   on 09-SEP-2002"
FT   gene            637260..638319
FT                   /pseudo
FT                   /locus_tag="mCG_49141"
FT                   /note="gene_id=mCG49141.2"
FT   mRNA            637260..638319
FT                   /pseudo
FT                   /locus_tag="mCG_49141"
FT                   /note="gene_id=mCG49141.2 transcript_id=mCT49324.2 created
FT                   on 09-SEP-2002"
FT   gene            664384..731187
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /note="gene_id=mCG115758.0"
FT   mRNA            join(664384..664527,723739..723922,729291..729441,
FT                   730545..731187)
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /product="RIKEN cDNA 3110001A13"
FT                   /note="gene_id=mCG115758.0 transcript_id=mCT116868.0
FT                   created on 09-SEP-2002"
FT   CDS             join(723795..723922,729291..729441,730545..730661)
FT                   /codon_start=1
FT                   /gene="3110001A13Rik"
FT                   /locus_tag="mCG_115758"
FT                   /product="RIKEN cDNA 3110001A13"
FT                   /note="gene_id=mCG115758.0 transcript_id=mCT116868.0
FT                   protein_id=mCP51184.1"
FT                   /db_xref="GOA:Q3TGF2"
FT                   /db_xref="InterPro:IPR009533"
FT                   /db_xref="MGI:MGI:1913790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TGF2"
FT                   /protein_id="EDL07938.1"
FT                   /translation="MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGL
FT                   APQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEE
FT                   QENAPEFVKVKGNLRRTGQEVAQAQES"
FT   gene            963838..968031
FT                   /locus_tag="mCG_147250"
FT                   /note="gene_id=mCG147250.0"
FT   mRNA            join(963838..964125,964557..968031)
FT                   /locus_tag="mCG_147250"
FT                   /product="mCG147250"
FT                   /note="gene_id=mCG147250.0 transcript_id=mCT187513.0
FT                   created on 13-JAN-2004"
FT   CDS             967173..967490
FT                   /codon_start=1
FT                   /locus_tag="mCG_147250"
FT                   /product="mCG147250"
FT                   /note="gene_id=mCG147250.0 transcript_id=mCT187513.0
FT                   protein_id=mCP109133.0 partial"
FT                   /protein_id="EDL07939.1"
FT                   /translation="MLSPPPSPPPPPETQHGNSIAFLKGGIWFHPGGFSARESMFPIIS
FT                   WLFTLSCQPQRSLLCSPEQNPLTPGQYLTYLCQLDVGLSGGVQHCVLALWENYTDSFHR
FT                   G"
FT   gene            complement(997457..998633)
FT                   /pseudo
FT                   /locus_tag="mCG_59690"
FT                   /note="gene_id=mCG59690.2"
FT   mRNA            complement(997457..998633)
FT                   /pseudo
FT                   /locus_tag="mCG_59690"
FT                   /note="gene_id=mCG59690.2 transcript_id=mCT59873.2 created
FT                   on 09-SEP-2002"
FT   gene            complement(1027861..1028458)
FT                   /pseudo
FT                   /locus_tag="mCG_15453"
FT                   /note="gene_id=mCG15453.2"
FT   mRNA            complement(1027861..1028458)
FT                   /pseudo
FT                   /locus_tag="mCG_15453"
FT                   /note="gene_id=mCG15453.2 transcript_id=mCT17303.2 created
FT                   on 09-SEP-2002"
FT   gene            complement(1078082..>1087342)
FT                   /locus_tag="mCG_141120"
FT                   /note="gene_id=mCG141120.0"
FT   mRNA            complement(join(1078082..1078226,1081723..1081802,
FT                   1087133..>1087342))
FT                   /locus_tag="mCG_141120"
FT                   /product="mCG141120"
FT                   /note="gene_id=mCG141120.0 transcript_id=mCT173192.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(1087163..>1087342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141120"
FT                   /product="mCG141120"
FT                   /note="gene_id=mCG141120.0 transcript_id=mCT173192.0
FT                   protein_id=mCP96111.0"
FT                   /protein_id="EDL07940.1"
FT                   /translation="QEHLNLWAGTAGETVTRFCREQDRVLMTVGKRQLVPPIENGLARV
FT                   QVAGEAEPFVSKAA"
FT   gene            1101190..1118460
FT                   /locus_tag="mCG_147251"
FT                   /note="gene_id=mCG147251.0"
FT   mRNA            join(1101190..1101429,1115051..1118460)
FT                   /locus_tag="mCG_147251"
FT                   /product="mCG147251"
FT                   /note="gene_id=mCG147251.0 transcript_id=mCT187514.0
FT                   created on 13-JAN-2004"
FT   CDS             1115476..1115835
FT                   /codon_start=1
FT                   /locus_tag="mCG_147251"
FT                   /product="mCG147251"
FT                   /note="gene_id=mCG147251.0 transcript_id=mCT187514.0
FT                   protein_id=mCP109134.0"
FT                   /db_xref="GOA:Q3TQ57"
FT                   /db_xref="MGI:MGI:1919850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ57"
FT                   /protein_id="EDL07941.1"
FT                   /translation="MKKLVADPAQTQHSGISESQVWAGCRHHLGRCCCPWSARVPAPPL
FT                   SSVQAQPVWQHCHRAPGLQQHCCVLWAGHLQPLLRAPHSQAWSSPRENSTLPSGAGTTG
FT                   TAFGKEEMSLLGLGF"
FT   gene            complement(1239007..>1249025)
FT                   /locus_tag="mCG_145105"
FT                   /note="gene_id=mCG145105.0"
FT   mRNA            complement(join(1239007..1239650,1240142..1240317,
FT                   1245871..1246044,1248428..1248557,1248891..>1249025))
FT                   /locus_tag="mCG_145105"
FT                   /product="mCG145105"
FT                   /note="gene_id=mCG145105.0 transcript_id=mCT184529.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1246009..1246044,1248428..1248557,
FT                   1248891..>1248958))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145105"
FT                   /product="mCG145105"
FT                   /note="gene_id=mCG145105.0 transcript_id=mCT184529.0
FT                   protein_id=mCP105476.0"
FT                   /protein_id="EDL07942.1"
FT                   /translation="KQTADYSHVAYPLHAAPSQRSISFLLAVPAALAQRDLLPQEWVRG
FT                   ACEENDPEMSTWLLRASDGNQEGTDTHTDMTT"
FT   gene            <1379337..1566352
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /note="gene_id=mCG115684.0"
FT   mRNA            join(<1379337..1379399,1421476..1421570,1432402..1432494,
FT                   1446349..1446433,1462149..1462212,1481514..1481597,
FT                   1486268..1486333,1486895..1486952,1488961..1489047,
FT                   1512256..1512332,1518319..1518457,1524565..1524706,
FT                   1538627..1538760,1542886..1543008,1546804..1547076,
FT                   1553523..1553662,1554422..1554586,1555684..1556558,
FT                   1563333..1566352)
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /product="FERM domain containing 4A"
FT                   /note="gene_id=mCG115684.0 transcript_id=mCT116793.1
FT                   created on 09-SEP-2002"
FT   CDS             join(<1462184..1462212,1481514..1481597,1486268..1486333,
FT                   1486895..1486952,1488961..1489047,1512256..1512332,
FT                   1518319..1518457,1524565..1524706,1538627..1538760,
FT                   1542886..1543008,1546804..1547076,1553523..1553662,
FT                   1554422..1554586,1555684..1556558,1563333..1563391)
FT                   /codon_start=1
FT                   /gene="Frmd4a"
FT                   /locus_tag="mCG_115684"
FT                   /product="FERM domain containing 4A"
FT                   /note="gene_id=mCG115684.0 transcript_id=mCT116793.1
FT                   protein_id=mCP50669.1"
FT                   /protein_id="EDL07943.1"
FT                   /translation="ISFLYFTGKFNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEY
FT                   YKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKV
FT                   KPRKIFQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIW
FT                   AMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSG
FT                   SLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKRLCLREAELTGKLPVE
FT                   YPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASD
FT                   PNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLVIDGQCHPQAPAP
FT                   LPDNQSLEGLRQLHYHRTDYDKSPLKPKMWSESSLDEPYEKVKKRSSHGHSSSHKRFPS
FT                   TGSCTEAGVSSSLQNSPIRSLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLHS
FT                   LALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHY
FT                   YPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARSGAASTGGGVY
FT                   LHSQSQPSSQYRIKEYPLYIEGSATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFK
FT                   ESWRGGGDEGDAGRLTPSRSQILRTPSLGRDGAHDKGSGRAAVSDELRQWYQRSTASHK
FT                   EHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSELADVQWYGQEKAKP
FT                   GTLV"
FT   gene            complement(1574652..1604714)
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /note="gene_id=mCG15455.1"
FT   mRNA            complement(join(1574652..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1589802,
FT                   1591423..1591569,1596226..1596339,1598144..1598248,
FT                   1600816..1600893,1604491..1604714))
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), transcript variant mCT17305"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT17305.1 created
FT                   on 09-SEP-2002"
FT   mRNA            complement(join(1576523..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1591569,
FT                   1596226..1596339,1598144..1598248,1600816..1600893,
FT                   1604491..>1604682))
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), transcript variant mCT190063"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT190063.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1577032..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..1589802,
FT                   1591423..1591569,1596226..1596339,1598144..1598248,
FT                   1600816..1600893,1604491..1604556))
FT                   /codon_start=1
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT17305.1
FT                   protein_id=mCP15856.1 isoform=CRA_a"
FT                   /protein_id="EDL07944.1"
FT                   /translation="MDILKSEILRKRQLVEDRNLLVENKKYFKRSELARKEEEAYYERC
FT                   GYKIQPKEDDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYD
FT                   AFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEEN
FT                   TTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSAT
FT                   QKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPI
FT                   GVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYN
FT                   AL"
FT   CDS             complement(join(1577032..1577112,1586020..1586175,
FT                   1588217..1588288,1588414..1588554,1589734..>1589892))
FT                   /codon_start=1
FT                   /gene="Prpf18"
FT                   /locus_tag="mCG_15455"
FT                   /product="PRP18 pre-mRNA processing factor 18 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG15455.1 transcript_id=mCT190063.0
FT                   protein_id=mCP111071.0 isoform=CRA_b"
FT                   /protein_id="EDL07945.1"
FT                   /translation="HIAGHMHTLVHLLFKLLCVSEQACFLFPLEALGESLGKGDDHKDM
FT                   DIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPA
FT                   DIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVA
FT                   HVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL"
FT   gene            complement(1605938..1607085)
FT                   /pseudo
FT                   /locus_tag="mCG_1030028"
FT                   /note="gene_id=mCG1030028.1"
FT   mRNA            complement(join(1605938..1606298,1607004..1607085))
FT                   /pseudo
FT                   /locus_tag="mCG_1030028"
FT                   /note="gene_id=mCG1030028.1 transcript_id=mCT147732.1
FT                   created on 09-SEP-2002"
FT   gene            <1652744..>1653178
FT                   /locus_tag="mCG_1029871"
FT                   /note="gene_id=mCG1029871.0"
FT   mRNA            <1652744..>1653178
FT                   /locus_tag="mCG_1029871"
FT                   /product="mCG1029871"
FT                   /note="gene_id=mCG1029871.0 transcript_id=mCT147575.0
FT                   created on 09-SEP-2002"
FT   CDS             1652744..1653178
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029871"
FT                   /product="mCG1029871"
FT                   /note="gene_id=mCG1029871.0 transcript_id=mCT147575.0
FT                   protein_id=mCP51199.0"
FT                   /protein_id="EDL07946.1"
FT                   /translation="MVPVKKLVEKGGKKKKKKKKQVLKCTLDCTHPVEDGIIDAANFEQ
FT                   FLQERIKVNGKAGNLGGGVVTIEQSKSKITVTSEVPFSKRYLKYLTKKYLKKNSLRDWL
FT                   RVVANSKESYELLTSYFQINQDERRTRIRTHWSAMFCINS"
FT   gene            <1670559..1755510
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /note="gene_id=mCG115686.0"
FT   mRNA            join(<1670559..1670638,1672870..1672953,1698691..1698993,
FT                   1703889..1704011,1707073..1707344,1717431..1717656,
FT                   1743039..1743158,1754547..1755510)
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /product="RIKEN cDNA E130319B15"
FT                   /note="gene_id=mCG115686.0 transcript_id=mCT116795.1
FT                   created on 09-SEP-2002"
FT   CDS             join(<1670575..1670638,1672870..1672953,1698691..1698993,
FT                   1703889..1704011,1707073..1707344,1717431..1717656,
FT                   1743039..1743158,1754547..1754608)
FT                   /codon_start=1
FT                   /gene="E130319B15Rik"
FT                   /locus_tag="mCG_115686"
FT                   /product="RIKEN cDNA E130319B15"
FT                   /note="gene_id=mCG115686.0 transcript_id=mCT116795.1
FT                   protein_id=mCP50697.1"
FT                   /protein_id="EDL07947.1"
FT                   /translation="HEPASAAASVSCRAATLPAPWNYHHEVYKISEFSNDVNGETKETQ
FT                   PIYLGDESMEIKKQITGMRRLLNDSTGRIYQRVGKEGEKLKQEPQVVDLVWPQRSNSST
FT                   EASQGLHSNSRGAWNELPTQSGQFSGQSGPRSRTFQTQPHISASSNGELPGVNSIVGSN
FT                   CCTCNCQSTLQAILQELKTMRKLMQFQAVGTQNRQQPPISLMCSQRTAVSRKRNKKKKV
FT                   LPKTVQPVTAVEPKPSPLETEKKPAASATRPPGLQAAERTSTEENHVLGFGIVLESPSS
FT                   DPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRG
FT                   FNDNRKGLDQNIVGAIKVFTENYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSGH
FT                   TFVIKRETPEDPEPGSVA"
FT   gene            1836889..1864613
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /note="gene_id=mCG15456.1"
FT   mRNA            join(1836889..1836981,1839453..1839726,1844304..1844407,
FT                   1846708..1846815,1848307..1848461,1851779..1851869,
FT                   1854554..1854653,1860562..1860774,1861671..1864613)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, transcript variant
FT                   mCT17306"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT17306.1 created
FT                   on 09-SEP-2002"
FT   mRNA            join(1836890..1836981,1839453..1839726,1844304..1844407,
FT                   1848307..1848461,1851779..1851869,1854554..1854653,
FT                   1860562..1860774,1861671..1863710)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, transcript variant
FT                   mCT173769"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT173769.0 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<1837365..1837696,1839453..1839726,1844304..1844407,
FT                   1846708..1846815,1848307..1848461,1851779..1851869,
FT                   1854554..1854653,1860562..1860774,1861671..1863227)
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, transcript variant
FT                   mCT190066"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT190066.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1839486..1839726,1844304..1844407,1846708..1846815,
FT                   1848307..1848461,1851779..1851869,1854554..1854653,
FT                   1860562..1860774,1861671..1861885)
FT                   /codon_start=1
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, isoform CRA_b"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT190066.0
FT                   protein_id=mCP111072.0 isoform=CRA_b"
FT                   /protein_id="EDL07949.1"
FT                   /translation="REGGEGLSCGECGPRTMSTRESFNPETYELDKSFRLTRFTELKGT
FT                   GCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQTTDY
FT                   IYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVIPLIIQG
FT                   FKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQ
FT                   VAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATD
FT                   ITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGL
FT                   LICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQN
FT                   VNPTPGATS"
FT   CDS             join(1839534..1839726,1844304..1844407,1846708..1846815,
FT                   1848307..1848461,1851779..1851869,1854554..1854653,
FT                   1860562..1860774,1861671..1861885)
FT                   /codon_start=1
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, isoform CRA_a"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT17306.1
FT                   protein_id=mCP15861.1 isoform=CRA_a"
FT                   /protein_id="EDL07948.1"
FT                   /translation="MSTRESFNPETYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESL
FT                   QENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIAC
FT                   ANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVIPLIIQGFKDAAEEAGTSVTGGQ
FT                   TVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWN
FT                   KIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQ
FT                   QRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEI
FT                   KSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS"
FT   CDS             join(1839534..1839726,1844304..1844407,1848307..1848461,
FT                   1851779..1851869,1854554..1854653,1860562..1860774,
FT                   1861671..1861885)
FT                   /codon_start=1
FT                   /gene="Sephs1"
FT                   /locus_tag="mCG_15456"
FT                   /product="selenophosphate synthetase 1, isoform CRA_c"
FT                   /note="gene_id=mCG15456.1 transcript_id=mCT173769.0
FT                   protein_id=mCP96688.0 isoform=CRA_c"
FT                   /protein_id="EDL07950.1"
FT                   /translation="MSTRESFNPETYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESL
FT                   QENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMERDKV
FT                   IPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVL
FT                   TKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTF
FT                   NAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTC
FT                   PETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVA
FT                   PQVATQNVNPTPGATS"
FT   gene            1874119..1893818
FT                   /gene="Phyh"
FT                   /locus_tag="mCG_15452"
FT                   /note="gene_id=mCG15452.1"
FT   mRNA            join(1874119..1874232,1877914..1877972,1880686..1880796,
FT                   1882438..1882606,1883759..1883840,1885801..1885982,
FT                   1891063..1891212,1892770..1892904,1893401..1893818)
FT                   /gene="Phyh"
FT                   /locus_tag="mCG_15452"
FT                   /product="phytanoyl-CoA hydroxylase, transcript variant
FT                   mCT17302"
FT                   /note="gene_id=mCG15452.1 transcript_id=mCT17302.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(1874158..1874232,1877914..1877972,1880686..1880796,
FT                   1882438..1882606,1883759..1883840,1885801..1885982,
FT                   1891063..1891212,1892770..1892904,1893401..1893454)
FT                   /codon_start=1
FT                   /gene="Phyh"
FT                   /locus_tag="mCG_15452"
FT                   /product="phytanoyl-CoA hydroxylase, isoform CRA_a"
FT                   /note="gene_id=mCG15452.1 transcript_id=mCT17302.0
FT                   protein_id=mCP15857.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPC7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="MGI:MGI:891978"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPC7"
FT                   /protein_id="EDL07951.1"
FT                   /translation="MNLTRAGARLQVLLGHLGRPSAPTIVAQPVSGLASPASFQPEQFQ
FT                   YTLDNNVLTLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDV
FT                   ALAKQDYMPSDRMVSKIQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPP
FT                   DVGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDY
FT                   PKWEGGVNKMYHGIQDYDPNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRKAISCH
FT                   FGSSDCQCIDVSGTSQENIAREVVEMAEKKYGFQGVMDFKDTWIFRSRLVKGERINI"
FT   mRNA            join(<1874161..1874232,1877914..1877972,1880686..1880796,
FT                   1882438..1882606,1883759..1883840,1885801..1885986,
FT                   1891067..>1891184)
FT                   /gene="Phyh"
FT                   /locus_tag="mCG_15452"
FT                   /product="phytanoyl-CoA hydroxylase, transcript variant
FT                   mCT190061"
FT                   /note="gene_id=mCG15452.1 transcript_id=mCT190061.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1874161..1874232,1877914..1877972,1880686..1880796,
FT                   1882438..1882606,1883759..1883840,1885801..1885986,
FT                   1891067..>1891184)
FT                   /codon_start=1
FT                   /gene="Phyh"
FT                   /locus_tag="mCG_15452"
FT                   /product="phytanoyl-CoA hydroxylase, isoform CRA_b"
FT                   /note="gene_id=mCG15452.1 transcript_id=mCT190061.0
FT                   protein_id=mCP111070.0 isoform=CRA_b"
FT                   /protein_id="EDL07952.1"
FT                   /translation="NLTRAGARLQVLLGHLGRPSAPTIVAQPVSGLASPASFQPEQFQY
FT                   TLDNNVLTLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDVA
FT                   LAKQDYMPSDRMVSKIQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPPD
FT                   VGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYP
FT                   KWEVGVNKMYHGIQDYDPNSPRVHLVMEKGDTVFFHPLLIHGSG"
FT   gene            1897246..1897786
FT                   /locus_tag="mCG_15454"
FT                   /note="gene_id=mCG15454.0"
FT   mRNA            join(1897246..1897567,1897733..1897786)
FT                   /locus_tag="mCG_15454"
FT                   /product="mCG15454"
FT                   /note="gene_id=mCG15454.0 transcript_id=mCT17304.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(1897268..1897567,1897733..1897753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15454"
FT                   /product="mCG15454"
FT                   /note="gene_id=mCG15454.0 transcript_id=mCT17304.0
FT                   protein_id=mCP15862.1"
FT                   /protein_id="EDL07953.1"
FT                   /translation="MVNMPKTRQTFCKKCGKHQPHKVTQYKKGKDSLYAQRKRRYDRKR
FT                   SGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSKRMLAIKRCKHFELGGNKKRKGQVI
FT                   QF"
FT   gene            complement(1914551..>1914854)
FT                   /locus_tag="mCG_49140"
FT                   /note="gene_id=mCG49140.2"
FT   mRNA            complement(1914551..>1914854)
FT                   /locus_tag="mCG_49140"
FT                   /product="mCG49140"
FT                   /note="gene_id=mCG49140.2 transcript_id=mCT49323.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(1914645..1914854)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49140"
FT                   /product="mCG49140"
FT                   /note="gene_id=mCG49140.2 transcript_id=mCT49323.2
FT                   protein_id=mCP36720.2"
FT                   /db_xref="GOA:J3QNN8"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="MGI:MGI:3642825"
FT                   /db_xref="UniProtKB/TrEMBL:J3QNN8"
FT                   /protein_id="EDL07954.1"
FT                   /translation="MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRN
FT                   VKGPVREGDMLTLLESEREARRLR"
FT   gene            1931500..1941088
FT                   /gene="1110017I16Rik"
FT                   /locus_tag="mCG_15447"
FT                   /note="gene_id=mCG15447.2"
FT   mRNA            join(1931500..1931651,1931997..1932062,1932152..1932247,
FT                   1936581..1936679,1940657..1941087)
FT                   /gene="1110017I16Rik"
FT                   /locus_tag="mCG_15447"
FT                   /product="RIKEN cDNA 1110017I16, transcript variant
FT                   mCT17297"
FT                   /note="gene_id=mCG15447.2 transcript_id=mCT17297.2 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<1931522..1931651,1932152..1932247,1936581..1936679,
FT                   1940657..1941088)
FT                   /gene="1110017I16Rik"
FT                   /locus_tag="mCG_15447"
FT                   /product="RIKEN cDNA 1110017I16, transcript variant
FT                   mCT190172"
FT                   /note="gene_id=mCG15447.2 transcript_id=mCT190172.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1931522..1931651,1932152..1932247,1936581..1936679,
FT                   1940657..1940754)
FT                   /codon_start=1
FT                   /gene="1110017I16Rik"
FT                   /locus_tag="mCG_15447"
FT                   /product="RIKEN cDNA 1110017I16, isoform CRA_b"
FT                   /note="gene_id=mCG15447.2 transcript_id=mCT190172.0
FT                   protein_id=mCP111144.0 isoform=CRA_b"
FT                   /protein_id="EDL07956.1"
FT                   /translation="QSTGDFQDTSPYYLSCGFWGCSVKMSWRRVILLSSLLALVLLCSV
FT                   KQKIFMQESDASNFLKRRGKRSPKSRDEVNAENRQRLRDDELRREYYEEQRNEFENFVE
FT                   EQRDEQEERTREAVEQWRQWHYDGLYPSYLYNRQNI"
FT   CDS             join(1931594..1931651,1931997..1932062,1932152..1932247,
FT                   1936581..1936679,1940657..1940754)
FT                   /codon_start=1
FT                   /gene="1110017I16Rik"
FT                   /locus_tag="mCG_15447"
FT                   /product="RIKEN cDNA 1110017I16, isoform CRA_a"
FT                   /note="gene_id=mCG15447.2 transcript_id=mCT17297.2
FT                   protein_id=mCP15876.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BU0"
FT                   /db_xref="MGI:MGI:1915777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14BU0"
FT                   /protein_id="EDL07955.1"
FT                   /translation="MSWRRVILLSSLLALVLLCMLQEGTSASVGSRQAAAEGVQEGVKQ
FT                   KIFMQESDASNFLKRRGKRSPKSRDEVNAENRQRLRDDELRREYYEEQRNEFENFVEEQ
FT                   RDEQEERTREAVEQWRQWHYDGLYPSYLYNRQNI"
FT   gene            complement(1945504..1967512)
FT                   /gene="Mcm10"
FT                   /locus_tag="mCG_15450"
FT                   /note="gene_id=mCG15450.1"
FT   mRNA            complement(join(1945504..1946814,1947433..1947475,
FT                   1948216..1948361,1949081..1949194,1949908..1950020,
FT                   1951059..1951203,1952442..1952670,1953872..1953980,
FT                   1954068..1954178,1955018..1955118,1956198..1956394,
FT                   1956602..1956718,1959346..1959513,1960284..1960449,
FT                   1961682..1961916,1962405..1962539,1962666..1962770,
FT                   1963818..1964150,1965469..1965555,1967485..1967512))
FT                   /gene="Mcm10"
FT                   /locus_tag="mCG_15450"
FT                   /product="minichromosome maintenance deficient 10 (S.
FT                   cerevisiae), transcript variant mCT17300"
FT                   /note="gene_id=mCG15450.1 transcript_id=mCT17300.2 created
FT                   on 09-SEP-2002"
FT   mRNA            complement(join(1946063..1946814,1947433..1947475,
FT                   1948216..1948361,1949081..1949194,1949908..1950020,
FT                   1951059..1951203,1952442..1952670,1953872..1953980,
FT                   1954068..1954178,1955018..1955118,1956198..1956394,
FT                   1956602..1956718,1959346..1959513,1960284..1960449,
FT                   1961682..1961916,1962405..1962539,1962666..1962770,
FT                   1963818..1964150,1965469..1965555,1966675..>1967124))
FT                   /gene="Mcm10"
FT                   /locus_tag="mCG_15450"
FT                   /product="minichromosome maintenance deficient 10 (S.
FT                   cerevisiae), transcript variant mCT190059"
FT                   /note="gene_id=mCG15450.1 transcript_id=mCT190059.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1946731..1946814,1947433..1947475,
FT                   1948216..1948361,1949081..1949194,1949908..1950020,
FT                   1951059..1951203,1952442..1952670,1953872..1953980,
FT                   1954068..1954178,1955018..1955118,1956198..1956394,
FT                   1956602..1956718,1959346..1959513,1960284..1960449,
FT                   1961682..1961916,1962405..1962539,1962666..1962770,
FT                   1963818..1964150,1965469..1965555,1966675..>1966696))
FT                   /codon_start=1
FT                   /gene="Mcm10"
FT                   /locus_tag="mCG_15450"
FT                   /product="minichromosome maintenance deficient 10 (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG15450.1 transcript_id=mCT190059.0
FT                   protein_id=mCP111069.0 isoform=CRA_b"
FT                   /protein_id="EDL07958.1"
FT                   /translation="GNRNKEEAKAPHCVSWTAYLILLYSCHLSCSFDNMDVEEDDLCLL
FT                   TSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDELFDADGDGESYTEEAGSGEEGKTGNQ
FT                   EERLATLFGDVEDLTDDEVATSKVGNSGPPPAPSQEKTSEELQDELKKLQEQMKSLQEQ
FT                   LKAASIKQPPGTAPLQEPPDSSLQPLLKEKRIRRIQESACFSAELDVPTLPKAKRVARK
FT                   PKTPAESSSRMRTPAQPLQVSSSFLEPNHSSSSRSSTPSPQAVPGNKCSRTIRNQNTVS
FT                   PGNSGDRPQQVSQVSVEAFSGLRLRRPRVSSTEMSRKMAGRKLIRLPQIKEKMATENLE
FT                   ETDWVTFGVILRKVTPQSATSGQTFSIWKLNDLHDLTQCVSLFLFGDVHKDLWKTEQGT
FT                   VIGLLNANPMKPKDGLKEVCLSIDHPQKVLIMGEAMDLGACKAKKKNGEPCTQTVNLHD
FT                   CEYCQYHIQAQYKKLSAKRTDLQSTFSGGRIPKKFRKGTSLKERLCQDGFYYGGVSSES
FT                   FAASRAAAIAPKKKVQTTLTNLVVRGTNSIIQETKQKLGIPQKSLSCSEEFRELMALPT
FT                   FGARNLQKHLARAKASGSSKPAIQSISASALLKQQKQQMLEMRKRRSEDIQKRFLQSSS
FT                   EVQSPAVPSSSRQAAAQSPRTGAEFPRLEGTATPRMPKLGRGISEGDDVLFFDDSPPPR
FT                   PKLSAAAEAKKLAAIAKLRAKGQILTKVDPNNTVRKQMDGRAMLGVKERVENSNTVSPE
FT                   EELEPARKKRREQLAYLESEEFQKILKAKSKHTDILKEAEAELQKSYFEPLVKKEQMEE
FT                   KMRATREVKCRVVTCRTCTYTHFKPLETCVSEQHNLHWHDGVKRFFKCPCGNRTISLDK
FT                   LPNKHCRNCGLYKWERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK"
FT   CDS             complement(join(1946731..1946814,1947433..1947475,
FT                   1948216..1948361,1949081..1949194,1949908..1950020,
FT                   1951059..1951203,1952442..1952670,1953872..1953980,
FT                   1954068..1954178,1955018..1955118,1956198..1956394,
FT                   1956602..1956718,1959346..1959513,1960284..1960449,
FT                   1961682..1961916,1962405..1962539,1962666..1962770,
FT                   1963818..1964150,1965469..1965475))
FT                   /codon_start=1
FT                   /gene="Mcm10"
FT                   /locus_tag="mCG_15450"
FT                   /product="minichromosome maintenance deficient 10 (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG15450.1 transcript_id=mCT17300.2
FT                   protein_id=mCP15883.2 isoform=CRA_a"
FT                   /protein_id="EDL07957.1"
FT                   /translation="MDVEEDDLCLLTSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDEL
FT                   FDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEVATSKVGNSGPPPAPS
FT                   QEKTSEELQDELKKLQEQMKSLQEQLKAASIKQPPGTAPLQEPPDSSLQPLLKEKRIRR
FT                   IQESACFSAELDVPTLPKAKRVARKPKTPAESSSRMRTPAQPLQVSSSFLEPNHSSSSR
FT                   SSTPSPQAVPGNKCSRTIRNQNTVSPGNSGDRPQQVSQVSVEAFSGLRLRRPRVSSTEM
FT                   SRKMAGRKLIRLPQIKEKMATENLEETDWVTFGVILRKVTPQSATSGQTFSIWKLNDLH
FT                   DLTQCVSLFLFGDVHKDLWKTEQGTVIGLLNANPMKPKDGLKEVCLSIDHPQKVLIMGE
FT                   AMDLGACKAKKKNGEPCTQTVNLHDCEYCQYHIQAQYKKLSAKRTDLQSTFSGGRIPKK
FT                   FRKGTSLKERLCQDGFYYGGVSSESFAASRAAAIAPKKKVQTTLTNLVVRGTNSIIQET
FT                   KQKLGIPQKSLSCSEEFRELMALPTFGARNLQKHLARAKASGSSKPAIQSISASALLKQ
FT                   QKQQMLEMRKRRSEDIQKRFLQSSSEVQSPAVPSSSRQAAAQSPRTGAEFPRLEGTATP
FT                   RMPKLGRGISEGDDVLFFDDSPPPRPKLSAAAEAKKLAAIAKLRAKGQILTKVDPNNTV
FT                   RKQMDGRAMLGVKERVENSNTVSPEEELEPARKKRREQLAYLESEEFQKILKAKSKHTD
FT                   ILKEAEAELQKSYFEPLVKKEQMEEKMRATREVKCRVVTCRTCTYTHFKPLETCVSEQH
FT                   NLHWHDGVKRFFKCPCGNRTISLDKLPNKHCRNCGLYKWERDGMLKEKTGPKIGGETLL
FT                   PRGEEHAKFLNSLK"
FT   gene            complement(1973226..1974458)
FT                   /locus_tag="mCG_1030031"
FT                   /note="gene_id=mCG1030031.1"
FT   mRNA            complement(join(1973226..1973442,1973488..1974458))
FT                   /locus_tag="mCG_1030031"
FT                   /product="mCG1030031"
FT                   /note="gene_id=mCG1030031.1 transcript_id=mCT147735.1
FT                   created on 09-SEP-2002"
FT   CDS             complement(1973851..1974075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030031"
FT                   /product="mCG1030031"
FT                   /note="gene_id=mCG1030031.1 transcript_id=mCT147735.1
FT                   protein_id=mCP50584.1"
FT                   /protein_id="EDL07959.1"
FT                   /translation="MCLLQFIDRFQVVLLGLLGFILFMVADILYINHFVYTHTHIHTHA
FT                   VCFANILFHSVVGSNKCWLFLWPGRLLLL"
FT   gene            complement(1975402..>2009507)
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /note="gene_id=mCG141122.1"
FT   mRNA            complement(join(1975402..1976242,1978828..1978910,
FT                   1981875..1982005,1986021..1986179,1987912..1988005,
FT                   1988936..1989085,1991406..1991552,1994921..1995055,
FT                   1997243..1997316,2000783..2000995,2007766..2007968,
FT                   2009330..2009506))
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, transcript variant mCT173194"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT173194.0
FT                   created on 09-SEP-2002"
FT   mRNA            complement(join(1975403..1975989,1976084..1976242,
FT                   1978828..1978910,1981875..1982005,1986021..1986179,
FT                   1987912..1988005,1988936..1989085,1989750..1989865,
FT                   1991453..1991552,1994921..1995055,1997243..1997316,
FT                   2000783..2000995,2007766..2007968,2009330..>2009507))
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, transcript variant mCT190080"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT190080.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1975994..1976242,1978828..1978910,
FT                   1981875..1982005,1986021..1986179,1987912..1988005,
FT                   1988936..1989085,1989750..1989865,1991453..1991552,
FT                   1994921..1995055,1997243..1997316,2000783..2000995,
FT                   2007766..2007968,2009330..>2009507))
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, transcript variant mCT190079"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT190079.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1976112..1976242,1978828..1978910,
FT                   1981875..1982005,1986021..1986179,1987912..1988005,
FT                   1988936..1989085,1989750..1989865,1991453..1991552,
FT                   1994921..1995055,1997243..1997316,2000783..2000995,
FT                   2007766..2007968,2009330..>2009507))
FT                   /codon_start=1
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, isoform CRA_b"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT190079.0
FT                   protein_id=mCP111064.0 isoform=CRA_b"
FT                   /protein_id="EDL07961.1"
FT                   /translation="GPVTMSHQPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELL
FT                   QQMKELLVENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERLLFEMQSKEVKERLKAL
FT                   THENERLKEELGKFKEKSEKPLEDLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMR
FT                   LRAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMTEGETEGAMKEMKNCPTPTRTDPIS
FT                   LSNCTEDARSCAEFEELTVSQLLLCLREGNQKVERLEVALREAKERISDFEKKANGHSS
FT                   TEKQTARRADREKEDKGQESVGSEVETLSIQVTSLFKELQEAHTKLSEAELMKKRLQEK
FT                   CQALERKNSATPSELNEKQELVYSNKKLELQVESMRSEIKMEQAKTEEEKSRLATLQAT
FT                   HNKLLQEHNKALKTIEELTKQQAEKVDKMLLQELSEKLELAEQALASKQLQMDEMKQTL
FT                   AKQEEDLETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAILLKENNDIEEGG
FT                   SRQSLMEMQCRHGARTSDSDQQTYLFQRGAEDRSWQHGQQPRSIPIHSCPKCGEVLPDI
FT                   DTLQIHVMDCII"
FT   CDS             complement(join(1976112..1976242,1978828..1978910,
FT                   1981875..1982005,1986021..1986179,1987912..1988005,
FT                   1988936..1989085,1989750..1989865,1991453..1991552,
FT                   1994921..1995055,1997243..1997316,2000783..2000995,
FT                   2007766..2007968,2009330..>2009507))
FT                   /codon_start=1
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, isoform CRA_b"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT190080.0
FT                   protein_id=mCP111065.0 isoform=CRA_b"
FT                   /protein_id="EDL07962.1"
FT                   /translation="GPVTMSHQPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELL
FT                   QQMKELLVENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERLLFEMQSKEVKERLKAL
FT                   THENERLKEELGKFKEKSEKPLEDLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMR
FT                   LRAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMTEGETEGAMKEMKNCPTPTRTDPIS
FT                   LSNCTEDARSCAEFEELTVSQLLLCLREGNQKVERLEVALREAKERISDFEKKANGHSS
FT                   TEKQTARRADREKEDKGQESVGSEVETLSIQVTSLFKELQEAHTKLSEAELMKKRLQEK
FT                   CQALERKNSATPSELNEKQELVYSNKKLELQVESMRSEIKMEQAKTEEEKSRLATLQAT
FT                   HNKLLQEHNKALKTIEELTKQQAEKVDKMLLQELSEKLELAEQALASKQLQMDEMKQTL
FT                   AKQEEDLETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAILLKENNDIEEGG
FT                   SRQSLMEMQCRHGARTSDSDQQTYLFQRGAEDRSWQHGQQPRSIPIHSCPKCGEVLPDI
FT                   DTLQIHVMDCII"
FT   CDS             complement(join(1976112..1976242,1978828..1978910,
FT                   1981875..1982005,1986021..1986179,1987912..1988005,
FT                   1988936..1989085,1991406..1991552,1994921..1995055,
FT                   1997243..1997316,2000783..2000995,2007766..2007968,
FT                   2009330..2009495))
FT                   /codon_start=1
FT                   /gene="Optn"
FT                   /locus_tag="mCG_141122"
FT                   /product="optineurin, isoform CRA_a"
FT                   /note="gene_id=mCG141122.1 transcript_id=mCT173194.0
FT                   protein_id=mCP96113.0 isoform=CRA_a"
FT                   /protein_id="EDL07960.1"
FT                   /translation="MSHQPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELLQQMK
FT                   ELLVENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERLLFEMQSKEVKERLKALTHEN
FT                   ERLKEELGKFKEKSEKPLEDLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMRLRAE
FT                   KADLLGIVSELQLKLNSGGSSEDSFVEIRMTEGETEGAMKEMKNCPTPTRTDPISLSNC
FT                   TEDARSCAEFEELTVSQLLLCLREGNQKVERLEVALREAKERISDFEKKANGHSSTEKQ
FT                   TARRADREKEDKGQESVGTAPPKDWHVPGMSPCQALERKNSATPSELNEKQELVYSNKK
FT                   LELQVESMRSEIKMEQAKTEEEKSRLATLQATHNKLLQEHNKALKTIEELTKQQAEKVD
FT                   KMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETMAVLRAQMEVYCSDFHAE
FT                   RAAREKIHEEKEQLALQLAILLKENNDIEEGGSRQSLMEMQCRHGARTSDSDQQTYLFQ
FT                   RGAEDRSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCII"
FT   gene            2092775..2185514
FT                   /gene="Ccdc3"
FT                   /locus_tag="mCG_18145"
FT                   /note="gene_id=mCG18145.1"
FT   mRNA            join(2092775..2093151,2096075..2096249,2183553..2183821,
FT                   2184953..2185514)
FT                   /gene="Ccdc3"
FT                   /locus_tag="mCG_18145"
FT                   /product="coiled-coil domain containing 3, transcript
FT                   variant mCT20050"
FT                   /note="gene_id=mCG18145.1 transcript_id=mCT20050.1 created
FT                   on 09-SEP-2002"
FT   mRNA            join(2092776..2093151,2096075..2096249,2183553..2185501)
FT                   /gene="Ccdc3"
FT                   /locus_tag="mCG_18145"
FT                   /product="coiled-coil domain containing 3, transcript
FT                   variant mCT190064"
FT                   /note="gene_id=mCG18145.1 transcript_id=mCT190064.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(2092778..2093151,2096075..2096249,2183553..2183821,
FT                   2184953..2185091)
FT                   /codon_start=1
FT                   /gene="Ccdc3"
FT                   /locus_tag="mCG_18145"
FT                   /product="coiled-coil domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG18145.1 transcript_id=mCT20050.1
FT                   protein_id=mCP15854.2 isoform=CRA_b"
FT                   /protein_id="EDL07964.1"
FT                   /translation="MPLPLLLAALCLAASPAPARACQLPSEWRPLSEGCRAELAETIVY
FT                   AKVLALHPEVPGLYNYLPWQYQAGEGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGL
FT                   GYFSCHSHTVVQDYSYFFFVRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFANC
FT                   SQGQQLTTFSSDWEVQEDNRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVK
FT                   KVKRSLRQARKNSRHLELVNQKLNEKLGASSAQQHINALGREPVRAPYLHGSQWSGCWF
FT                   IASNGGPPDLMPCHTVPPIERILQLYTIDHLEPIPDT"
FT   CDS             join(2092778..2093151,2096075..2096249,2183553..2183825)
FT                   /codon_start=1
FT                   /gene="Ccdc3"
FT                   /locus_tag="mCG_18145"
FT                   /product="coiled-coil domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG18145.1 transcript_id=mCT190064.0
FT                   protein_id=mCP111013.0 isoform=CRA_a"
FT                   /protein_id="EDL07963.1"
FT                   /translation="MPLPLLLAALCLAASPAPARACQLPSEWRPLSEGCRAELAETIVY
FT                   AKVLALHPEVPGLYNYLPWQYQAGEGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGL
FT                   GYFSCHSHTVVQDYSYFFFVRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFANC
FT                   SQGQQLTTFSSDWEVQEDNRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVK
FT                   KVKRSLRQARKNSRHLELVNQKLNEKLGASSAQQHINALGREPVRAPYLHG"
FT   gene            complement(2253187..2664623)
FT                   /gene="Camk1d"
FT                   /locus_tag="mCG_18149"
FT                   /note="gene_id=mCG18149.2"
FT   mRNA            complement(join(2253187..2253683,2256078..2256195,
FT                   2257873..2257960,2265573..2265651,2267670..2267782,
FT                   2293692..2293767,2309024..2309150,2316408..2316546,
FT                   2399421..2399495,2520373..2520504,2664327..2664623))
FT                   /gene="Camk1d"
FT                   /locus_tag="mCG_18149"
FT                   /product="calcium/calmodulin-dependent protein kinase ID,
FT                   transcript variant mCT20054"
FT                   /note="gene_id=mCG18149.2 transcript_id=mCT20054.2 created
FT                   on 09-SEP-2002"
FT   mRNA            complement(join(2253469..2253683,2256078..2256195,
FT                   2257873..2257960,2265573..2265651,2267670..2267782,
FT                   2293692..2293767,2309024..2309150,2316408..2316546,
FT                   2399421..2399495,2520373..2520504,2632176..>2632308))
FT                   /gene="Camk1d"
FT                   /locus_tag="mCG_18149"
FT                   /product="calcium/calmodulin-dependent protein kinase ID,
FT                   transcript variant mCT190069"
FT                   /note="gene_id=mCG18149.2 transcript_id=mCT190069.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2253565..2253683,2256078..2256195,
FT                   2257873..2257960,2265573..2265651,2267670..2267782,
FT                   2293692..2293767,2309024..2309150,2316408..2316546,
FT                   2399421..2399495,2520373..2520504,2664327..2664418))
FT                   /codon_start=1
FT                   /gene="Camk1d"
FT                   /locus_tag="mCG_18149"
FT                   /product="calcium/calmodulin-dependent protein kinase ID,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18149.2 transcript_id=mCT20054.2
FT                   protein_id=mCP15872.2 isoform=CRA_b"
FT                   /db_xref="GOA:B1AW58"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="MGI:MGI:2442190"
FT                   /db_xref="UniProtKB/TrEMBL:B1AW58"
FT                   /protein_id="EDL07966.1"
FT                   /translation="MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKAT
FT                   GKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG
FT                   ELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMI
FT                   SDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFY
FT                   DENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAG
FT                   DTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRRLQLGSSLDSSNASVSSNLS
FT                   LASQKDCLAPSTLCSFLSSSSGVAGVGAERRPRPTTVTTGHTGSK"
FT   CDS             complement(join(2253565..2253683,2256078..2256195,
FT                   2257873..2257960,2265573..2265651,2267670..2267782,
FT                   2293692..2293767,2309024..2309150,2316408..2316546,
FT                   2399421..2399495,2520373..2520504,2632176..>2632306))
FT                   /codon_start=1
FT                   /gene="Camk1d"
FT                   /locus_tag="mCG_18149"
FT                   /product="calcium/calmodulin-dependent protein kinase ID,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18149.2 transcript_id=mCT190069.0
FT                   protein_id=mCP111014.0 isoform=CRA_a"
FT                   /protein_id="EDL07965.1"
FT                   /translation="ANYAGFQGSLPAPDWNILHARMAEFVSWSCLNFRWSWIKGSRNSG
FT                   AFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESP
FT                   NHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENL
FT                   LYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGV
FT                   IAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRY
FT                   TCEQAARHPWIAGDTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRRLQLGSS
FT                   LDSSNASVSSNLSLASQKDCLAPSTLCSFLSSSSGVAGVGAERRPRPTTVTTGHTGSK"
FT   gene            2558974..2572805
FT                   /pseudo
FT                   /locus_tag="mCG_141251"
FT                   /note="gene_id=mCG141251.0"
FT   mRNA            join(2558974..2559534,2572784..2572805)
FT                   /pseudo
FT                   /locus_tag="mCG_141251"
FT                   /note="gene_id=mCG141251.0 transcript_id=mCT174053.0
FT                   created on 26-SEP-2002"
FT   gene            complement(2725848..2727953)
FT                   /locus_tag="mCG_1029965"
FT                   /note="gene_id=mCG1029965.1"
FT   mRNA            complement(2725848..2727953)
FT                   /locus_tag="mCG_1029965"
FT                   /product="mCG1029965"
FT                   /note="gene_id=mCG1029965.1 transcript_id=mCT147669.1
FT                   created on 12-FEB-2003"
FT   CDS             complement(2725890..2727635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029965"
FT                   /product="mCG1029965"
FT                   /note="gene_id=mCG1029965.1 transcript_id=mCT147669.1
FT                   protein_id=mCP50784.1"
FT                   /protein_id="EDL07967.1"
FT                   /translation="MNPKMILLLLMIETRISIPLWAIVKSWPVPLPVHSNSSTLPLFFA
FT                   TECYLDAPCARQTPQEPRMYNSTSFHLNYTLCFVHNVDKPFTPCIFLKKKIISIWADPL
FT                   SQNKVSSGVLFNALTQVAQGEQSGSGDVGNNITSPINITTIMIKGKVTIPKRSQWPVNN
FT                   ATAIRSMPWCHPDLAFPIVFSPCQSKIFPWKEIAKGFVLSPPLDFAVMNDKGDATGKEN
FT                   IWPYYQWILSNEAGASTSLSAFALLTGPFHEILNVSATLSNTSTYLDNVTANRIIRNMT
FT                   TSPVEVCVNPPFFFILVEFQNNTEWLDCTNVTWFLMQCWNGTKFLALVVHLPTFVPVPV
FT                   EADPEKFLIMSLVRQKRGFGITAAIVTAIVVSVASAVTAGTAMAHQINTADTISQIAEK
FT                   LSEALLTLQRVDFHSTSGLMLVNQRVDILQHNMEQMMDVIQMSCVASTSHVCITPNRYI
FT                   NNSFIKSTDLLNYLKGNWSQEMERLQTRLQIQILNLNGTRVEPVTLRDYTSWLTSAFSY
FT                   FKEWVGVILFGAAICCGLVFMLWLVCKFRTQQKKKKRDKVIITQALLAIENGSSPEIWL
FT                   SMLKN"
FT   gene            complement(2745714..2796283)
FT                   /gene="G431001I09Rik"
FT                   /locus_tag="mCG_18138"
FT                   /note="gene_id=mCG18138.1"
FT   mRNA            complement(join(2745714..2745934,2746603..2746740,
FT                   2749415..2749543,2755001..2755029,2755965..2756087,
FT                   2758485..2758560,2761855..2761903,2772329..2772435,
FT                   2774155..2774250,2784127..2784159,2784702..2784759,
FT                   2793005..2793076,2795882..2796283))
FT                   /gene="G431001I09Rik"
FT                   /locus_tag="mCG_18138"
FT                   /product="RIKEN cDNA G431001I09"
FT                   /note="gene_id=mCG18138.1 transcript_id=mCT20043.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(2745908..2745934,2746603..2746740,
FT                   2749415..2749543,2755001..2755029,2755965..2756087,
FT                   2758485..2758560,2761855..2761903,2772329..2772435,
FT                   2774155..2774250,2784127..2784159,2784702..2784759,
FT                   2793005..2793076,2795882..2795955))
FT                   /codon_start=1
FT                   /gene="G431001I09Rik"
FT                   /locus_tag="mCG_18138"
FT                   /product="RIKEN cDNA G431001I09"
FT                   /note="gene_id=mCG18138.1 transcript_id=mCT20043.2
FT                   protein_id=mCP15882.2"
FT                   /protein_id="EDL07968.1"
FT                   /translation="MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLV
FT                   VSGREDPPTCSQSDSGNEAEETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPK
FT                   LNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFITHDFTQPFIHCTDDSPDPCIEYE
FT                   LVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKEHLQ
FT                   YKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELTSENNLRGEVTEGDAQE
FT                   QDSPAFRCTNSEVTVQPSPYLSFGLPKDFVDLSTGEDAHKLIDFLKLKRNEQEDD"
FT   gene            <2796080..2819835
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /note="gene_id=mCG18141.3"
FT   mRNA            join(<2796080..2796432,2805912..2806014,2807076..2807143,
FT                   2812123..2812172,2813397..2813504,2814675..2814770,
FT                   2815443..2815552,2817453..2817506,2819188..2819835)
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, transcript variant mCT190060"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT190060.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(2796082..2796432,2805910..2806014,2807076..2807143,
FT                   2812123..2812172,2813397..2813504,2814675..2814770,
FT                   2815443..2815544,2817453..2817506,2819188..2819465)
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, transcript variant mCT20046"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT20046.2 created
FT                   on 09-SEP-2002"
FT   mRNA            join(2796319..2796432,2799168..2799237,2805912..2806014,
FT                   2807076..2807143,2812123..2812172,2813397..2813504,
FT                   2814675..2814770,2815443..2815544,2817453..2817506,
FT                   2819188..2819597)
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, transcript variant mCT173202"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT173202.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(<2796428..2796432,2805912..2806014,2807076..2807143,
FT                   2812123..2812172,2813397..2813504,2814675..2814770,
FT                   2815443..2815552,2817453..2817467)
FT                   /codon_start=1
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, isoform CRA_b"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT190060.0
FT                   protein_id=mCP111011.0 isoform=CRA_b"
FT                   /protein_id="EDL07970.1"
FT                   /translation="CSLNFPPEDCGGRQVEMETRESTESSPGKHLVTSEELISEGKWVK
FT                   FEKTTYMDPTGKTRTWETVKLTTRKGKSADAVSVIPVLQRTLHHECVILVKQFRPPMGS
FT                   YCLEFPAGFIEDGESPEAAALRELEEETGYKGEVAECSPAVCMDPGLSNCTTHVVTVTI
FT                   NGDDAGNVRPKPKPGKDNLWK"
FT   CDS             join(2805955..2806014,2807076..2807143,2812123..2812172,
FT                   2813397..2813504,2814675..2814770,2815443..2815544,
FT                   2817453..2817506,2819188..2819297)
FT                   /codon_start=1
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, isoform CRA_a"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT173202.0
FT                   protein_id=mCP96121.0 isoform=CRA_a"
FT                   /protein_id="EDL07969.1"
FT                   /translation="METRESTESSPGKHLVTSEELISEGKWVKFEKTTYMDPTGKTRTW
FT                   ETVKLTTRKGKSADAVSVIPVLQRTLHHECVILVKQFRPPMGSYCLEFPAGFIEDGESP
FT                   EAAALRELEEETGYKGEVAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPEF
FT                   MEVISLPKNDLLTRLDALGAEQHLTVDAKVYAYGLALKHANSKPFEVPFLKF"
FT   CDS             join(2805955..2806014,2807076..2807143,2812123..2812172,
FT                   2813397..2813504,2814675..2814770,2815443..2815544,
FT                   2817453..2817506,2819188..2819297)
FT                   /codon_start=1
FT                   /gene="Nudt5"
FT                   /locus_tag="mCG_18141"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 5, isoform CRA_a"
FT                   /note="gene_id=mCG18141.3 transcript_id=mCT20046.2
FT                   protein_id=mCP15844.2 isoform=CRA_a"
FT                   /protein_id="EDL07971.1"
FT                   /translation="METRESTESSPGKHLVTSEELISEGKWVKFEKTTYMDPTGKTRTW
FT                   ETVKLTTRKGKSADAVSVIPVLQRTLHHECVILVKQFRPPMGSYCLEFPAGFIEDGESP
FT                   EAAALRELEEETGYKGEVAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPEF
FT                   MEVISLPKNDLLTRLDALGAEQHLTVDAKVYAYGLALKHANSKPFEVPFLKF"
FT   gene            complement(2822127..>2848591)
FT                   /gene="Sec61a2"
FT                   /locus_tag="mCG_18144"
FT                   /note="gene_id=mCG18144.3"
FT   mRNA            complement(join(2822127..2823119,2824841..2824917,
FT                   2825325..2825516,2827939..2828099,2828953..2829106,
FT                   2833678..2833787,2833915..2834046,2837592..2837670,
FT                   2842382..2842447,2844246..2844313,2848513..>2848591))
FT                   /gene="Sec61a2"
FT                   /locus_tag="mCG_18144"
FT                   /product="Sec61, alpha subunit 2 (S. cerevisiae),
FT                   transcript variant mCT190062"
FT                   /note="gene_id=mCG18144.3 transcript_id=mCT190062.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2822473..2823119,2824841..2824917,
FT                   2825325..2825516,2827462..2827659,2827939..2828099,
FT                   2828953..2829106,2833678..2833787,2833915..2834046,
FT                   2837592..2837670,2842382..2842447,2844246..2844313,
FT                   2848513..2848546))
FT                   /gene="Sec61a2"
FT                   /locus_tag="mCG_18144"
FT                   /product="Sec61, alpha subunit 2 (S. cerevisiae),
FT                   transcript variant mCT20048"
FT                   /note="gene_id=mCG18144.3 transcript_id=mCT20048.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(2822933..2823119,2824841..2824917,
FT                   2825325..2825516,2827939..2828099,2828953..2829106,
FT                   2833678..2833787,2833915..2834046,2837592..2837670,
FT                   2842382..2842447,2844246..2844313,2848513..>2848528))
FT                   /codon_start=1
FT                   /gene="Sec61a2"
FT                   /locus_tag="mCG_18144"
FT                   /product="Sec61, alpha subunit 2 (S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18144.3 transcript_id=mCT190062.0
FT                   protein_id=mCP111012.0 isoform=CRA_a"
FT                   /protein_id="EDL07972.1"
FT                   /translation="AAAMGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIF
FT                   LVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIE
FT                   VGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGL
FT                   IVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHL
FT                   LATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQDVSGGGPARSYPVGGLCYY
FT                   LSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRG
FT                   HRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFV
FT                   KEQAEVGGMGALFF"
FT   CDS             complement(join(2822933..2823119,2824841..2824917,
FT                   2825325..2825516,2827462..2827659,2827939..2828099,
FT                   2828953..2829106,2833678..2833787,2833915..2834046,
FT                   2837592..2837670,2842382..2842447,2844246..2844313,
FT                   2848513..2848519))
FT                   /codon_start=1
FT                   /gene="Sec61a2"
FT                   /locus_tag="mCG_18144"
FT                   /product="Sec61, alpha subunit 2 (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18144.3 transcript_id=mCT20048.2
FT                   protein_id=mCP15849.2 isoform=CRA_b"
FT                   /protein_id="EDL07973.1"
FT                   /translation="MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVC
FT                   CQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGD
FT                   TPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVL
FT                   LLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLAT
FT                   RTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPI
FT                   KLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGG
FT                   LCYYLSPPESMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQM
FT                   VMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYF
FT                   EIFVKEQAEVGGMGALFF"
FT   gene            complement(2850066..2857986)
FT                   /locus_tag="mCG_1050962"
FT                   /note="gene_id=mCG1050962.0"
FT   mRNA            complement(join(2850066..2851502,2851979..2852743,
FT                   2853842..2853927,2856166..2856335,2856825..2856907,
FT                   2857817..2857986))
FT                   /locus_tag="mCG_1050962"
FT                   /product="mCG1050962"
FT                   /note="gene_id=mCG1050962.0 transcript_id=mCT194751.0
FT                   created on 27-JAN-2005"
FT   gene            <2851277..2852334
FT                   /locus_tag="mCG_1030032"
FT                   /note="gene_id=mCG1030032.1"
FT   mRNA            join(<2851277..2851514,2851990..2852334)
FT                   /locus_tag="mCG_1030032"
FT                   /product="mCG1030032"
FT                   /note="gene_id=mCG1030032.1 transcript_id=mCT147736.1
FT                   created on 10-SEP-2002"
FT   CDS             <2851277..2851396
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030032"
FT                   /product="mCG1030032"
FT                   /note="gene_id=mCG1030032.1 transcript_id=mCT147736.1
FT                   protein_id=mCP50596.1"
FT                   /protein_id="EDL07975.1"
FT                   /translation="LDSTSMEPHVPGLGMWLKLNEIYSPNIHHICTCSFERQK"
FT   CDS             complement(join(2852639..2852743,2853842..2853927,
FT                   2856166..2856335,2856825..2856907,2857817..2857981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050962"
FT                   /product="mCG1050962"
FT                   /note="gene_id=mCG1050962.0 transcript_id=mCT194751.0
FT                   protein_id=mCP115780.0"
FT                   /protein_id="EDL07974.1"
FT                   /translation="MCDSAEEGVDSDTVNMFVVHPTTPAQYFHLLRRQMIRNFRKPLIV
FT                   ASPKMLLRYPAAVSTLEEMAPGTAFKPVIGDSSVDPKNVKTLIFCSGKHFYALLKQRES
FT                   LGTKKHDFAIIRLEELCPFPLDALQQEMSKYKHVRDVIWSQEEPQNMGPWSFVSPRFEK
FT                   QLACRLRLVSRPPLPAPAVGIGTVHQQQHEDILSKTFTQ"
FT   gene            2891472..2996020
FT                   /locus_tag="mCG_18140"
FT                   /note="gene_id=mCG18140.2"
FT   mRNA            join(2891472..2891528,2897435..2897814,2900897..2901676,
FT                   2913458..2913618,2915912..2916106,2919778..2919927,
FT                   2922996..2923099,2928451..2928536,2943625..2943733,
FT                   2950395..2950508,2958987..2959103,2963368..2963553,
FT                   2966184..2966387,2967282..2967557,2969431..2969614,
FT                   2974181..2974320,2980178..2980279,2980532..2980630,
FT                   2986964..2987128,2990401..2990542,2991572..2991692,
FT                   2995496..2996020)
FT                   /locus_tag="mCG_18140"
FT                   /product="mCG18140"
FT                   /note="gene_id=mCG18140.2 transcript_id=mCT20045.2 created
FT                   on 10-SEP-2002"
FT   CDS             join(2897453..2897814,2900897..2901676,2913458..2913618,
FT                   2915912..2916106,2919778..2919927,2922996..2923099,
FT                   2928451..2928536,2943625..2943733,2950395..2950508,
FT                   2958987..2959103,2963368..2963553,2966184..2966387,
FT                   2967282..2967557,2969431..2969614,2974181..2974320,
FT                   2980178..2980279,2980532..2980630,2986964..2987128,
FT                   2990401..2990542,2991572..2991692,2995496..2995505)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18140"
FT                   /product="mCG18140"
FT                   /note="gene_id=mCG18140.2 transcript_id=mCT20045.2
FT                   protein_id=mCP15886.2"
FT                   /protein_id="EDL07976.1"
FT                   /translation="MPAERKKSASMEEKESLLNNKEKDCSERRPVSSKEKPRDDLKVTA
FT                   KKEVSKVPEDKKKRLEEDKRKKEDKERKKKEEEKVKAEEELKKKEEEEKKKQEEEERKK
FT                   QEEQAKRQQEEAAAQLKEKEESLQLHQEAWERHQLRKELRSKNQNAPDNRPEENFFSRL
FT                   DSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKLSDVNCAA
FT                   HLCSLFHQRYSDFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKE
FT                   GLSLIYEQLKSIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPS
FT                   EIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYE
FT                   EFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIW
FT                   EDEDARNFYENLIDLKAFVPAILFKDNEKSQNKDSNKDDSKEAKEPKDNKEASSPDDLE
FT                   LELENLEINDDTLELEGADEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNC
FT                   VNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVA
FT                   EDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFS
FT                   HHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYC
FT                   NPPPAEKTVRKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMI
FT                   NIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAK
FT                   FLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQY
FT                   FDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCN
FT                   SLEESIRQVQDLEREFLIKLGLVNDKESKDSMTEGENLEEDEEEEEGGAETEEQSGNES
FT                   EVNEPEEEEGSEEEEEGEEEEEENTDYLTDSNKENETDEENAEVMIKGGGLKHVPCVED
FT                   EDFIQALDKMMLENLQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGETESADTMP
FT                   FVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQ
FT                   EMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR"
FT   gene            complement(3040396..3070450)
FT                   /gene="5430407P10Rik"
FT                   /locus_tag="mCG_18137"
FT                   /note="gene_id=mCG18137.1"
FT   mRNA            complement(join(3040396..3041713,3043166..3043418,
FT                   3054135..3054355,3070147..3070450))
FT                   /gene="5430407P10Rik"
FT                   /locus_tag="mCG_18137"
FT                   /product="RIKEN cDNA 5430407P10, transcript variant
FT                   mCT20029"
FT                   /note="gene_id=mCG18137.1 transcript_id=mCT20029.2 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(3040397..3041713,3043166..3043418,
FT                   3054135..3054355,3070293..>3070412))
FT                   /gene="5430407P10Rik"
FT                   /locus_tag="mCG_18137"
FT                   /product="RIKEN cDNA 5430407P10, transcript variant
FT                   mCT190173"
FT                   /note="gene_id=mCG18137.1 transcript_id=mCT190173.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3040689..3041713,3043166..3043418,
FT                   3054135..>3054287))
FT                   /codon_start=1
FT                   /gene="5430407P10Rik"
FT                   /locus_tag="mCG_18137"
FT                   /product="RIKEN cDNA 5430407P10, isoform CRA_a"
FT                   /note="gene_id=mCG18137.1 transcript_id=mCT190173.0
FT                   protein_id=mCP111149.0 isoform=CRA_a"
FT                   /protein_id="EDL07977.1"
FT                   /translation="QLCVGMPGNQQKPESLETDSDTSPSCGLSDLSRGGSLESRCSSSR
FT                   SRSFTMDDESLKHLTHEEKDVILFFEETLDSLEYDFDEPALCDSGIHCHSPQSLEESPS
FT                   SHSEPEDVIDLVQPAPASGEAESLPDMPQVTGAPSDTKHGTPFLEGGKQAAENSLPPPD
FT                   SRGPEVFPLPPSLPVPAPSAPRKELMSPSPPAEHPKLLRSVPTPLVIAQKISEKLAGNE
FT                   ALSPTSPSKEGRPGEWRTPTSPASRNGDHVGVWHRHTTQSAPKVHRFPSNISVTNSAGK
FT                   DFNKTISKAAVNVQERKAQVLANINGMSFIAAGDTSSEERWQKAEEQRSGSADGARTLG
FT                   RAGMAGEPGAPCAGVPARAQQSRAVQTEQPPALANGFQSVHEALRSEPSSFVPTSKTIT
FT                   FRPDPAVTGKLARQNASRSLYEPRPDGSQDARKRTGSLPRAVGFRPQGITVQFSGRGST
FT                   EEARREALRKLGLLKENL"
FT   CDS             complement(join(3040689..3041713,3043166..3043418,
FT                   3054135..3054272))
FT                   /codon_start=1
FT                   /gene="5430407P10Rik"
FT                   /locus_tag="mCG_18137"
FT                   /product="RIKEN cDNA 5430407P10, isoform CRA_b"
FT                   /note="gene_id=mCG18137.1 transcript_id=mCT20029.2
FT                   protein_id=mCP15858.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C5R2"
FT                   /db_xref="MGI:MGI:2442238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C5R2"
FT                   /protein_id="EDL07978.1"
FT                   /translation="MPGNQQKPESLETDSDTSPSCGLSDLSRGGSLESRCSSSRSRSFT
FT                   MDDESLKHLTHEEKDVILFFEETLDSLEYDFDEPALCDSGIHCHSPQSLEESPSSHSEP
FT                   EDVIDLVQPAPASGEAESLPDMPQVTGAPSDTKHGTPFLEGGKQAAENSLPPPDSRGPE
FT                   VFPLPPSLPVPAPSAPRKELMSPSPPAEHPKLLRSVPTPLVIAQKISEKLAGNEALSPT
FT                   SPSKEGRPGEWRTPTSPASRNGDHVGVWHRHTTQSAPKVHRFPSNISVTNSAGKDFNKT
FT                   ISKAAVNVQERKAQVLANINGMSFIAAGDTSSEERWQKAEEQRSGSADGARTLGRAGMA
FT                   GEPGAPCAGVPARAQQSRAVQTEQPPALANGFQSVHEALRSEPSSFVPTSKTITFRPDP
FT                   AVTGKLARQNASRSLYEPRPDGSQDARKRTGSLPRAVGFRPQGITVQFSGRGSTEEARR
FT                   EALRKLGLLKENL"
FT   gene            3049189..3056263
FT                   /locus_tag="mCG_147245"
FT                   /note="gene_id=mCG147245.0"
FT   mRNA            join(3049189..3050723,3056186..3056263)
FT                   /locus_tag="mCG_147245"
FT                   /product="mCG147245"
FT                   /note="gene_id=mCG147245.0 transcript_id=mCT187508.0
FT                   created on 13-JAN-2004"
FT   CDS             3049206..3049568
FT                   /codon_start=1
FT                   /locus_tag="mCG_147245"
FT                   /product="mCG147245"
FT                   /note="gene_id=mCG147245.0 transcript_id=mCT187508.0
FT                   protein_id=mCP109128.0"
FT                   /protein_id="EDL07979.1"
FT                   /translation="MYSRFRFIQSGLKLMITSASASSPGIRGMHHHAWPLWDGIWSYSR
FT                   SIFSFLKESPPLFFIAALTHTHTHTHTHAHAHAHAHTPLFSTSAPALDAFSLSDNHSPW
FT                   GKVISHCVSGLYFPGD"
FT   gene            complement(3072153..3074242)
FT                   /pseudo
FT                   /locus_tag="mCG_18135"
FT                   /note="gene_id=mCG18135.1"
FT   mRNA            complement(join(3072153..3072698,3073122..3073283,
FT                   3073395..3073557,3073756..3074242))
FT                   /pseudo
FT                   /locus_tag="mCG_18135"
FT                   /note="gene_id=mCG18135.1 transcript_id=mCT20027.1 created
FT                   on 10-SEP-2002"
FT   gene            complement(3129234..3152193)
FT                   /gene="Echdc3"
FT                   /locus_tag="mCG_18133"
FT                   /note="gene_id=mCG18133.1"
FT   mRNA            complement(join(3129234..3130065,3135997..3136197,
FT                   3145632..3145729,3147685..3147806,3152009..3152193))
FT                   /gene="Echdc3"
FT                   /locus_tag="mCG_18133"
FT                   /product="enoyl Coenzyme A hydratase domain containing 3"
FT                   /note="gene_id=mCG18133.1 transcript_id=mCT20025.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(3129754..3130065,3135997..3136197,
FT                   3145632..3145729,3147685..3147806,3152009..3152178))
FT                   /codon_start=1
FT                   /gene="Echdc3"
FT                   /locus_tag="mCG_18133"
FT                   /product="enoyl Coenzyme A hydratase domain containing 3"
FT                   /note="gene_id=mCG18133.1 transcript_id=mCT20025.1
FT                   protein_id=mCP15867.1"
FT                   /protein_id="EDL07980.1"
FT                   /translation="MAVVAGLRAFGVKWPSWLRRNPWAPLSAGFCSPGSAGPAGSESEP
FT                   RLTSTRQQDGIRNIVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISAEGPVFS
FT                   SGHDLKELTDAQGRDYHAEVFQTCSEVMMLIRNHPVPILAMVNGLATAAGCQLVASCDI
FT                   AVASDKSSFATPGVNVGLFCSTPAVALGRAVPRKVALEMLFTGEPISAQEALRHGLISK
FT                   VVPEEQLEAETMRIAKKISSLSRSVVALGKATFYKQLPQDLRTAYFLASQAMVDNLALQ
FT                   DGQEGIEAFIQKRKPIWSH"
FT   gene            3133664..3261704
FT                   /locus_tag="mCG_141243"
FT                   /note="gene_id=mCG141243.1"
FT   mRNA            join(3133664..3133735,3186175..3186259,3196947..3197094,
FT                   3223497..3223607,3252952..3253294,3255208..3255309,
FT                   3260065..3261704)
FT                   /locus_tag="mCG_141243"
FT                   /product="mCG141243"
FT                   /note="gene_id=mCG141243.1 transcript_id=mCT174036.1
FT                   created on 11-JUN-2003"
FT   CDS             3260649..3260957
FT                   /codon_start=1
FT                   /locus_tag="mCG_141243"
FT                   /product="mCG141243"
FT                   /note="gene_id=mCG141243.1 transcript_id=mCT174036.1
FT                   protein_id=mCP96955.1"
FT                   /protein_id="EDL07981.1"
FT                   /translation="MKAKDAWFTFENFPMFYIFMFSPQIILLTLVIMESCGKLKHVLLP
FT                   LAIFCKYCHEYNITFKNEMQTSLFLLCDRKVLNGWHLQNILIGDTNCLFPLSFSLGF"
FT   gene            3262966..3384814
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /note="gene_id=mCG115579.1"
FT   mRNA            join(3262966..3263088,3276457..3276548,3331288..3331355,
FT                   3334752..3334834,3340559..3340598,3349204..3349284,
FT                   3355208..3355315,3364547..3364667,3367170..3367264,
FT                   3367827..3367892,3367987..3368086,3370701..3370853,
FT                   3380636..3383454)
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, transcript variant
FT                   mCT173195"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT173195.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(3262968..3263088,3276457..3276548,3331288..3331355,
FT                   3334752..3334834,3340559..3340598,3349204..3349284,
FT                   3355208..3355315,3361178..3361287,3363697..3363745,
FT                   3364547..3364667,3367170..3367264,3367827..3367892,
FT                   3367987..3368086,3370701..3370853,3380636..3384814)
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, transcript variant
FT                   mCT116686"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT116686.1
FT                   created on 10-SEP-2002"
FT   mRNA            join(<3276457..3276548,3331288..3331355,3334752..3334834,
FT                   3340559..3340598,3349204..3349284,3355208..3355315,
FT                   3361178..3361287,3363697..3363745,3364547..3364667,
FT                   3367170..3367264,3367827..3367892,3367987..3368086,
FT                   3370701..3370853,3380636..3384068)
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, transcript variant
FT                   mCT190074"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT190074.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3276479..3276548,3331288..3331355,3334752..3334834,
FT                   3340559..3340598,3349204..3349284,3355208..3355315,
FT                   3361178..3361287,3363697..3363745,3364547..3364667,
FT                   3367170..3367264,3367827..3367892,3367987..3368086,
FT                   3370701..3370853,3380636..3382017)
FT                   /codon_start=1
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, isoform CRA_c"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT190074.0
FT                   protein_id=mCP111061.0 isoform=CRA_c"
FT                   /protein_id="EDL07984.1"
FT                   /translation="ETLDSRSWFNTGLEQHPQRFAVMNSDQDVALKLAQERAEIVAKYD
FT                   RGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPYHNAAADRQKQLEIERTSKWLKMLK
FT                   KWERYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDI
FT                   RQIDLDVNRTFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM
FT                   NEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIY
FT                   TSFYTMKWFFQCFLDRTPFRLNLRIWDIYIFEGERVLTAMSYTILKLHKKHLMKLSMEE
FT                   LVEFLQETLAKDFFFEDDFVIEQLQVSMAELKRAKLDLPEPGKEDEYPKKPLGQLPPES
FT                   ACVNHLSNGQRSVGRPSPKTSSRREDGSPRKNHEHSPVHHSRNGTPERAGQSRRKSVDE
FT                   GSKNLKHEAESQRKPSPGMQDSSRHYNHAAANQNSNAISNVRKEFMPKWRKPSDASAIE
FT                   RTTKYAVEGKSHSALPALPVAIPGSAETRLPNSRQKMKALDGGEGKRGSNASQYDNVPG
FT                   GESEHGASAEEGPERTHPHSPRKHPEPSPSPPKVPNKFTFKVQPPSHVRYPPQLPEEDH
FT                   RAAYPPSYSNPPVYHGNSPKHVPTAHSGFVSTQISPRPQINPSRRPYGSSLSVDTSPEK
FT                   AYSRPTPVVLPSSRIEVLPIDMGARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYTY
FT                   RPEMHGQSWTRDAHRSHLSNLPNYAAFQHIPFQAHGLPEVSVDSPVRYKMSAAVEDASP
FT                   PGYPYAGPSPSAHHYRNGEGLSVQESVLL"
FT   CDS             join(3276545..3276548,3331288..3331355,3334752..3334834,
FT                   3340559..3340598,3349204..3349284,3355208..3355315,
FT                   3361178..3361287,3363697..3363745,3364547..3364667,
FT                   3367170..3367264,3367827..3367892,3367987..3368086,
FT                   3370701..3370853,3380636..3382017)
FT                   /codon_start=1
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, isoform CRA_a"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT116686.1
FT                   protein_id=mCP51057.1 isoform=CRA_a"
FT                   /protein_id="EDL07982.1"
FT                   /translation="MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVT
FT                   DRFGFLHEEELPYHNAAADRQKQLEIERTSKWLKMLKKWERYKNTEKFHRRIYKGIPLQ
FT                   LRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYG
FT                   VKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHG
FT                   FFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFYTMKWFFQCFLDRTPFRLN
FT                   LRIWDIYIFEGERVLTAMSYTILKLHKKHLMKLSMEELVEFLQETLAKDFFFEDDFVIE
FT                   QLQVSMAELKRAKLDLPEPGKEDEYPKKPLGQLPPESACVNHLSNGQRSVGRPSPKTSS
FT                   RREDGSPRKNHEHSPVHHSRNGTPERAGQSRRKSVDEGSKNLKHEAESQRKPSPGMQDS
FT                   SRHYNHAAANQNSNAISNVRKEFMPKWRKPSDASAIERTTKYAVEGKSHSALPALPVAI
FT                   PGSAETRLPNSRQKMKALDGGEGKRGSNASQYDNVPGGESEHGASAEEGPERTHPHSPR
FT                   KHPEPSPSPPKVPNKFTFKVQPPSHVRYPPQLPEEDHRAAYPPSYSNPPVYHGNSPKHV
FT                   PTAHSGFVSTQISPRPQINPSRRPYGSSLSVDTSPEKAYSRPTPVVLPSSRIEVLPIDM
FT                   GARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYTYRPEMHGQSWTRDAHRSHLSNLP
FT                   NYAAFQHIPFQAHGLPEVSVDSPVRYKMSAAVEDASPPGYPYAGPSPSAHHYRNGEGLS
FT                   VQESVLL"
FT   CDS             join(3276545..3276548,3331288..3331355,3334752..3334834,
FT                   3340559..3340598,3349204..3349284,3355208..3355315,
FT                   3364547..3364667,3367170..3367264,3367827..3367892,
FT                   3367987..3368086,3370701..3370853,3380636..3382017)
FT                   /codon_start=1
FT                   /gene="Usp6nl"
FT                   /locus_tag="mCG_115579"
FT                   /product="USP6 N-terminal like, isoform CRA_b"
FT                   /note="gene_id=mCG115579.1 transcript_id=mCT173195.0
FT                   protein_id=mCP96114.0 isoform=CRA_b"
FT                   /protein_id="EDL07983.1"
FT                   /translation="MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVT
FT                   DRFGFLHEEELPYHNAAADRQKQLEIERTSKWLKMLKKWERYKNTEKFHRRIYKGIPLQ
FT                   LRGEVWALLLEIPKMKEETRDLYSEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGP
FT                   KHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFYTMKWFFQCFLDR
FT                   TPFRLNLRIWDIYIFEGERVLTAMSYTILKLHKKHLMKLSMEELVEFLQETLAKDFFFE
FT                   DDFVIEQLQVSMAELKRAKLDLPEPGKEDEYPKKPLGQLPPESACVNHLSNGQRSVGRP
FT                   SPKTSSRREDGSPRKNHEHSPVHHSRNGTPERAGQSRRKSVDEGSKNLKHEAESQRKPS
FT                   PGMQDSSRHYNHAAANQNSNAISNVRKEFMPKWRKPSDASAIERTTKYAVEGKSHSALP
FT                   ALPVAIPGSAETRLPNSRQKMKALDGGEGKRGSNASQYDNVPGGESEHGASAEEGPERT
FT                   HPHSPRKHPEPSPSPPKVPNKFTFKVQPPSHVRYPPQLPEEDHRAAYPPSYSNPPVYHG
FT                   NSPKHVPTAHSGFVSTQISPRPQINPSRRPYGSSLSVDTSPEKAYSRPTPVVLPSSRIE
FT                   VLPIDMGARGYGSSGSPKNGQFILPPVDYLPENRKWSEVSYTYRPEMHGQSWTRDAHRS
FT                   HLSNLPNYAAFQHIPFQAHGLPEVSVDSPVRYKMSAAVEDASPPGYPYAGPSPSAHHYR
FT                   NGEGLSVQESVLL"
FT   gene            3412273..3418892
FT                   /locus_tag="mCG_1030034"
FT                   /note="gene_id=mCG1030034.1"
FT   mRNA            join(3412273..3412727,3418337..3418458,3418654..3418892)
FT                   /locus_tag="mCG_1030034"
FT                   /product="mCG1030034, transcript variant mCT147738"
FT                   /note="gene_id=mCG1030034.1 transcript_id=mCT147738.1
FT                   created on 24-FEB-2003"
FT   mRNA            join(3412465..3412727,3413058..3413176)
FT                   /locus_tag="mCG_1030034"
FT                   /product="mCG1030034, transcript variant mCT181007"
FT                   /note="gene_id=mCG1030034.1 transcript_id=mCT181007.0
FT                   created on 24-FEB-2003"
FT   CDS             3412468..3412725
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030034"
FT                   /product="mCG1030034, isoform CRA_a"
FT                   /note="gene_id=mCG1030034.1 transcript_id=mCT147738.1
FT                   protein_id=mCP50614.1 isoform=CRA_a"
FT                   /protein_id="EDL07985.1"
FT                   /translation="MNREQQRSLTSAQGNLQVLETVEWPRMMNQGGCVLCSLALHRSFS
FT                   CVSASVCFFLQPHALNKMPLAEARVDGVSQVQYNFIVPDL"
FT   CDS             3412468..3412725
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030034"
FT                   /product="mCG1030034, isoform CRA_a"
FT                   /note="gene_id=mCG1030034.1 transcript_id=mCT181007.0
FT                   protein_id=mCP103929.0 isoform=CRA_a"
FT                   /protein_id="EDL07986.1"
FT                   /translation="MNREQQRSLTSAQGNLQVLETVEWPRMMNQGGCVLCSLALHRSFS
FT                   CVSASVCFFLQPHALNKMPLAEARVDGVSQVQYNFIVPDL"
FT   gene            complement(3477346..3479120)
FT                   /gene="B230218O03"
FT                   /locus_tag="mCG_147237"
FT                   /note="gene_id=mCG147237.0"
FT   mRNA            complement(3477346..3479120)
FT                   /gene="B230218O03"
FT                   /locus_tag="mCG_147237"
FT                   /product="hypothetical protein B230218O03"
FT                   /note="gene_id=mCG147237.0 transcript_id=mCT187500.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3478366..3478710)
FT                   /codon_start=1
FT                   /gene="B230218O03"
FT                   /locus_tag="mCG_147237"
FT                   /product="hypothetical protein B230218O03"
FT                   /note="gene_id=mCG147237.0 transcript_id=mCT187500.0
FT                   protein_id=mCP109120.0"
FT                   /protein_id="EDL07987.1"
FT                   /translation="MCSHCTQPLIREELPHCPCCDKPSPLYCLLAQESGCPQRVFPMAI
FT                   CSLLFSPVPGHLSWCQRKLWLPTLWFQLAPQAPFFSQVNNHGPTKQKKGGSFPRPNLSL
FT                   GMRFRALLLL"
FT   gene            complement(3479514..3822511)
FT                   /gene="Cugbp2"
FT                   /locus_tag="mCG_18134"
FT                   /note="gene_id=mCG18134.2"
FT   mRNA            complement(join(3479514..3483321,3484688..3484859,
FT                   3487478..3487621,3491431..3491610,3498316..3498435,
FT                   3523896..3524030,3537812..3537875,3541802..3541960,
FT                   3545660..3545739,3553467..3553601,3562450..3562498,
FT                   3601906..3601988,3659405..3659601,3822394..3822511))
FT                   /gene="Cugbp2"
FT                   /locus_tag="mCG_18134"
FT                   /product="CUG triplet repeat, RNA binding protein 2"
FT                   /note="gene_id=mCG18134.2 transcript_id=mCT20026.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(3484732..3484859,3487478..3487621,
FT                   3491431..3491610,3498316..3498435,3523896..3524030,
FT                   3537812..3537875,3541802..3541960,3545660..3545739,
FT                   3553467..3553601,3562450..3562498,3601906..3601988,
FT                   3659405..3659601,3822394..3822500))
FT                   /codon_start=1
FT                   /gene="Cugbp2"
FT                   /locus_tag="mCG_18134"
FT                   /product="CUG triplet repeat, RNA binding protein 2"
FT                   /note="gene_id=mCG18134.2 transcript_id=mCT20026.2
FT                   protein_id=mCP15870.2"
FT                   /protein_id="EDL07988.1"
FT                   /translation="MFERTSELAFVETISVESMRCPKSAVTMRNEELLLSNGTANKMNG
FT                   ALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCC
FT                   FVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNE
FT                   NDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSP
FT                   IVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNL
FT                   GAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANPLSSTSSALGALTSPVAAS
FT                   TPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGMAALNGGLGATGLTNGTAGTMD
FT                   ALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDIL
FT                   QMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLK
FT                   RSKNDSKPY"
FT   gene            complement(3773656..3805858)
FT                   /locus_tag="mCG_147235"
FT                   /note="gene_id=mCG147235.0"
FT   mRNA            complement(join(3773656..3773687,3802946..3805858))
FT                   /locus_tag="mCG_147235"
FT                   /product="mCG147235"
FT                   /note="gene_id=mCG147235.0 transcript_id=mCT187498.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3804466..3804588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147235"
FT                   /product="mCG147235"
FT                   /note="gene_id=mCG147235.0 transcript_id=mCT187498.0
FT                   protein_id=mCP109118.0"
FT                   /protein_id="EDL07989.1"
FT                   /translation="MSTHSDLGLILIISVNEGLSKLGRKDYIQLCSKNTDLDSV"
FT   gene            3821810..3826599
FT                   /locus_tag="mCG_147248"
FT                   /note="gene_id=mCG147248.0"
FT   mRNA            join(3821810..3821871,3823888..3826599)
FT                   /locus_tag="mCG_147248"
FT                   /product="mCG147248"
FT                   /note="gene_id=mCG147248.0 transcript_id=mCT187511.0
FT                   created on 13-JAN-2004"
FT   CDS             join(3821850..3821871,3823888..3824144)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147248"
FT                   /product="mCG147248"
FT                   /note="gene_id=mCG147248.0 transcript_id=mCT187511.0
FT                   protein_id=mCP109131.0"
FT                   /protein_id="EDL07990.1"
FT                   /translation="MNRGLQTVGRSGESVEGRVPQALLHNIPDWCILDYGNKERIDNCH
FT                   SHFYTSLRHGKPLDKDQVPKQEPHLKDNSIIPGLCFITRYENHQVNI"
FT   gene            complement(3888471..3889698)
FT                   /locus_tag="mCG_147252"
FT                   /note="gene_id=mCG147252.0"
FT   mRNA            complement(3888471..3889698)
FT                   /locus_tag="mCG_147252"
FT                   /product="mCG147252"
FT                   /note="gene_id=mCG147252.0 transcript_id=mCT187515.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3888724..3889044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147252"
FT                   /product="mCG147252"
FT                   /note="gene_id=mCG147252.0 transcript_id=mCT187515.0
FT                   protein_id=mCP109126.0"
FT                   /db_xref="GOA:Q8C4K5"
FT                   /db_xref="MGI:MGI:3641675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4K5"
FT                   /protein_id="EDL07991.1"
FT                   /translation="MDSSVGDTVRGDSWQQSCILCRFLIGLSQLDLHDLGLFYCVWGFI
FT                   FSGFLPTALALESPQLRKSYLSSTSMMQESLLYQSKVKLKGHMSLSPSLSSSSKLAQIL
FT                   QV"
FT   gene            complement(5079449..5080117)
FT                   /pseudo
FT                   /locus_tag="mCG_54498"
FT                   /note="gene_id=mCG54498.2"
FT   mRNA            complement(5079449..5080117)
FT                   /pseudo
FT                   /locus_tag="mCG_54498"
FT                   /note="gene_id=mCG54498.2 transcript_id=mCT54681.2 created
FT                   on 12-FEB-2003"
FT   gene            <5884757..5913867
FT                   /locus_tag="mCG_21089"
FT                   /note="gene_id=mCG21089.2"
FT   mRNA            join(<5884757..5884966,5911844..5911885,5913723..5913867)
FT                   /locus_tag="mCG_21089"
FT                   /product="mCG21089"
FT                   /note="gene_id=mCG21089.2 transcript_id=mCT19834.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(<5884831..5884966,5911844..5911881)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21089"
FT                   /product="mCG21089"
FT                   /note="gene_id=mCG21089.2 transcript_id=mCT19834.2
FT                   protein_id=mCP8529.2"
FT                   /protein_id="EDL07992.1"
FT                   /translation="YWKNQLLAFVAGHHTQIQNDTVGVDVTTCTALQEDSGHPVPLAGQ
FT                   SPPFSSLKLLPS"
FT   gene            6127607..6135580
FT                   /locus_tag="mCG_53658"
FT                   /note="gene_id=mCG53658.1"
FT   mRNA            join(6127607..6127740,6128392..6128500,6131524..6131802,
FT                   6135226..6135580)
FT                   /locus_tag="mCG_53658"
FT                   /product="mCG53658"
FT                   /note="gene_id=mCG53658.1 transcript_id=mCT53841.1 created
FT                   on 25-SEP-2002"
FT   CDS             6131644..6131793
FT                   /codon_start=1
FT                   /locus_tag="mCG_53658"
FT                   /product="mCG53658"
FT                   /note="gene_id=mCG53658.1 transcript_id=mCT53841.1
FT                   protein_id=mCP30895.2"
FT                   /protein_id="EDL07993.1"
FT                   /translation="MISIGGCCRPTNSRLCVIFETVISTRKHLPHYLLDCCFKKLEVIF
FT                   ERVG"
FT   gene            6290780..6386544
FT                   /locus_tag="mCG_1030043"
FT                   /note="gene_id=mCG1030043.1"
FT   mRNA            join(6290780..6290846,6348113..6348237,6362049..6362184,
FT                   6374104..6374237,6386212..6386544)
FT                   /locus_tag="mCG_1030043"
FT                   /product="mCG1030043"
FT                   /note="gene_id=mCG1030043.1 transcript_id=mCT147747.1
FT                   created on 10-SEP-2002"
FT   CDS             join(6290840..6290846,6348113..6348237,6362049..6362184,
FT                   6374104..6374216)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030043"
FT                   /product="mCG1030043"
FT                   /note="gene_id=mCG1030043.1 transcript_id=mCT147747.1
FT                   protein_id=mCP51030.1"
FT                   /protein_id="EDL07994.1"
FT                   /translation="MNWETRTTDQLWSLKVSSKGSAEIPFCCTNTMGKRSDLSKDQGQS
FT                   YPPAPYSALSFAYQIYRCRPAAHRHGLQTVADPLAHWRSRRAFVNLYLPLCSGNSLLST
FT                   KRVSCVPIEAVTCTANCPLTSH"
FT   gene            complement(6524974..>6531929)
FT                   /locus_tag="mCG_141244"
FT                   /note="gene_id=mCG141244.0"
FT   mRNA            complement(join(6524974..6525101,6531800..>6531929))
FT                   /locus_tag="mCG_141244"
FT                   /product="mCG141244"
FT                   /note="gene_id=mCG141244.0 transcript_id=mCT174037.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(6525040..6525101,6531800..>6531929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141244"
FT                   /product="mCG141244"
FT                   /note="gene_id=mCG141244.0 transcript_id=mCT174037.0
FT                   protein_id=mCP96956.0"
FT                   /protein_id="EDL07995.1"
FT                   /translation="LGGLDLVVSQENSSADESHRGWQEAEFLGSNSSSSESLLCDFLET
FT                   SMVSSTFYREAWDTARKK"
FT   gene            complement(6795338..6815972)
FT                   /gene="Gata3"
FT                   /locus_tag="mCG_5026"
FT                   /note="gene_id=mCG5026.2"
FT   mRNA            complement(join(6795338..6796118,6800559..6800684,
FT                   6806223..6806368,6811851..6812387,6814814..6815446,
FT                   6815867..6815972))
FT                   /gene="Gata3"
FT                   /locus_tag="mCG_5026"
FT                   /product="GATA binding protein 3"
FT                   /note="gene_id=mCG5026.2 transcript_id=mCT4268.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(6795834..6796118,6800559..6800684,
FT                   6806223..6806368,6811851..6812387,6814814..6815051))
FT                   /codon_start=1
FT                   /gene="Gata3"
FT                   /locus_tag="mCG_5026"
FT                   /product="GATA binding protein 3"
FT                   /note="gene_id=mCG5026.2 transcript_id=mCT4268.2
FT                   protein_id=mCP8534.1"
FT                   /db_xref="GOA:Q3U0R5"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR016374"
FT                   /db_xref="InterPro:IPR029521"
FT                   /db_xref="MGI:MGI:95663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U0R5"
FT                   /protein_id="EDL07996.1"
FT                   /translation="MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMEAQYPLTEE
FT                   VDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSS
FT                   HHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPD
FT                   PSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYP
FT                   PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGH
FT                   YLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNA
FT                   CGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSSFNPAALSRH
FT                   MSSLSHISPFSHSSHMLTTPTPMHPPSGLSFGPHHPSSMVTAMG"
FT   gene            6818711..6821383
FT                   /locus_tag="mCG_5020"
FT                   /note="gene_id=mCG5020.2"
FT   mRNA            join(6818711..6819141,6819228..6819403,6820005..6820326,
FT                   6820469..6820603,6821258..6821383)
FT                   /locus_tag="mCG_5020"
FT                   /product="mCG5020"
FT                   /note="gene_id=mCG5020.2 transcript_id=mCT4279.2 created on
FT                   10-SEP-2002"
FT   CDS             join(6820252..6820326,6820469..6820603,6821258..6821368)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5020"
FT                   /product="mCG5020"
FT                   /note="gene_id=mCG5020.2 transcript_id=mCT4279.2
FT                   protein_id=mCP8530.2"
FT                   /db_xref="GOA:Q9D5M9"
FT                   /db_xref="MGI:MGI:1921185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5M9"
FT                   /protein_id="EDL07997.1"
FT                   /translation="MRLINRKRSEKTVVAVRLGRKRRAEWPLLKQLARDNNHRDAFNSI
FT                   PCTLQSPPGLCDMQAWDNPEGLVVKLKYREESKIKPRWKTKQAAGPCWLRLPAPQRRHL
FT                   SN"
FT   gene            complement(6820503..6827003)
FT                   /locus_tag="mCG_141250"
FT                   /note="gene_id=mCG141250.0"
FT   mRNA            complement(join(6820503..6820788,6821213..6821257,
FT                   6825053..6825129,6826674..6827003))
FT                   /locus_tag="mCG_141250"
FT                   /product="mCG141250"
FT                   /note="gene_id=mCG141250.0 transcript_id=mCT174049.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(6821221..6821257,6825053..6825129,
FT                   6826674..6826808))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141250"
FT                   /product="mCG141250"
FT                   /note="gene_id=mCG141250.0 transcript_id=mCT174049.0
FT                   protein_id=mCP96968.0"
FT                   /protein_id="EDL07998.1"
FT                   /translation="MVLPGSPMDQKIPFFPFARLANGVLSLLHSWVHRTPEDAPPRRRR
FT                   ISSKAGGKKTKKQKPNQLAFRRELPCSCGEKREKRTW"
FT   gene            6843635..6852085
FT                   /locus_tag="mCG_147241"
FT                   /note="gene_id=mCG147241.0"
FT   mRNA            join(6843635..6843790,6850219..6852085)
FT                   /locus_tag="mCG_147241"
FT                   /product="mCG147241"
FT                   /note="gene_id=mCG147241.0 transcript_id=mCT187504.0
FT                   created on 13-JAN-2004"
FT   CDS             6851441..6851593
FT                   /codon_start=1
FT                   /locus_tag="mCG_147241"
FT                   /product="mCG147241"
FT                   /note="gene_id=mCG147241.0 transcript_id=mCT187504.0
FT                   protein_id=mCP109123.0"
FT                   /db_xref="MGI:MGI:3703165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UP46"
FT                   /protein_id="EDL07999.1"
FT                   /translation="MFYFLIPPATHSSFLNFIWLVSQSSSGDHNHRFILHRPLSSHKMV
FT                   TTLGL"
FT   gene            complement(6852147..6987798)
FT                   /gene="Taf3"
FT                   /locus_tag="mCG_5021"
FT                   /note="gene_id=mCG5021.2"
FT   mRNA            complement(join(6852147..6853873,6855510..6855616,
FT                   6858459..6858708,6878418..6878500,6888608..6890439,
FT                   6979956..6980198,6987440..6987798))
FT                   /gene="Taf3"
FT                   /locus_tag="mCG_5021"
FT                   /product="TAF3 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG5021.2 transcript_id=mCT4277.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(6853756..6853873,6855510..6855616,
FT                   6858459..6858708,6878418..6878500,6888608..6890439,
FT                   6979956..6980198,6987440..6987605))
FT                   /codon_start=1
FT                   /gene="Taf3"
FT                   /locus_tag="mCG_5021"
FT                   /product="TAF3 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG5021.2 transcript_id=mCT4277.2
FT                   protein_id=mCP8531.2"
FT                   /db_xref="GOA:A2ASY1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:2388097"
FT                   /db_xref="UniProtKB/TrEMBL:A2ASY1"
FT                   /protein_id="EDL08000.1"
FT                   /translation="MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQL
FT                   GRGCHRYSELYGRTDPILDDVGEAFQLMGVNLHELEDYIHNIEPVTFPHQIPSFPVSKN
FT                   NVLQFPQPGSKDAEERKDYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDE
FT                   MEEEEVINDENFLGKRPLDSPEVEEMPSMKRPRLLSTKGDSLDVVLLEAREPLSSINPQ
FT                   KTPPVLSPVRVQDRADLAPPSPQPPMLAPFAKSQLPIAKPLETKSFTPKTKTKASSPGQ
FT                   KTKSPKAALSPARLGSPIRSPKTIPKEKKSPGRSKSPKSPKSPKIVAHVPQTPVRPETP
FT                   NRTPSAMVVEKTVKETIPVMKPTQTPPEVVKLNIEMQPKKPVVTDKTIDDSIDAVIARA
FT                   CAEREPDPFEFSSGSESEGDTFTSPKRISGSECATPKASTSSNNFTKSLATPLPLSSGT
FT                   SSSDNSWTMDASIDEVVRKAKLGAPSNMPPTFPYISSPSISPPTPEPLHKGYEEKAKLP
FT                   SSVDVKKKLKKELKTKLKKKEKQRDRERERERNKERSKEKDKMREREKEKEAGKELKYP
FT                   WRELMKDEDSDPYKFKIKEFEDIDAAKVRLKDGIVRREREKHKDKKKDRERSKREKDKR
FT                   ERERLKEKNREDKIKAPPTQLVLPPKEMALPLFSPSAVRVPAMLPAFSPMLPEKLFEEK
FT                   EKPKEKERKKDKKEKKKKKEKEKEKEKKEREREKERREREKREKEKEKHKHEKIKVEPV
FT                   IPAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSLNRPKTPPPAPVPIPVRVSPT
FT                   PLQPPLLTQAAVCPALMPSPAPALSGIGSAKAPVRSVVTETVSTYVIRDEWGNQIWICP
FT                   GCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKHKKRKHR
FT                   AH"
FT   gene            complement(<6998539..7019585)
FT                   /gene="Atp5c1"
FT                   /locus_tag="mCG_141126"
FT                   /note="gene_id=mCG141126.0"
FT   mRNA            complement(join(<6998539..6998730,7002360..7002424,
FT                   7002517..7002660,7003185..7003389,7007683..7007814,
FT                   7008766..7008800,7019421..7019585))
FT                   /gene="Atp5c1"
FT                   /locus_tag="mCG_141126"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F1
FT                   complex, gamma polypeptide 1"
FT                   /note="gene_id=mCG141126.0 transcript_id=mCT173222.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(<6998539..6998730,7002360..7002424,
FT                   7002517..7002660,7003185..7003389,7007683..7007814,
FT                   7008766..7008800,7019421..7019476))
FT                   /codon_start=1
FT                   /gene="Atp5c1"
FT                   /locus_tag="mCG_141126"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F1
FT                   complex, gamma polypeptide 1"
FT                   /note="gene_id=mCG141126.0 transcript_id=mCT173222.0
FT                   protein_id=mCP96141.0"
FT                   /protein_id="EDL08001.1"
FT                   /translation="MFSRASVVGLSACAVQPQWIQVRNMATLKDITRRLKSIKNIQKIT
FT                   KSMKMVAAAKYARAERELKPARVYGTGSLALYEKADIKAPEDKKKHLIIGVSSDRGLCG
FT                   AIHSSVAKQMKNEVAALTAAGKEVMIVGVGEKIKGILYRTHSDQFLVSFKDVGRKPPTF
FT                   GDASVIALELLNSGYEFDEGSIIFNQFKSVISYKTEEKPIFSLNTIATAETMSIYDDID
FT                   ADVLQNYQEYNLANLIYYSLKESTTSEQSARMTAMDNASKNACKPRKLETGALR"
FT   gene            <7019656..7031774
FT                   /gene="Kin"
FT                   /locus_tag="mCG_5022"
FT                   /note="gene_id=mCG5022.1"
FT   mRNA            join(7019656..7019817,7024805..7024899,7029188..7029231,
FT                   7029316..7029438,7030793..7031774)
FT                   /gene="Kin"
FT                   /locus_tag="mCG_5022"
FT                   /product="antigenic determinant of rec-A protein,
FT                   transcript variant mCT4275"
FT                   /note="gene_id=mCG5022.1 transcript_id=mCT4275.2 created on
FT                   10-SEP-2002"
FT   mRNA            join(<7019656..7019817,7024805..7024899,7029188..7029231,
FT                   7029316..7031694)
FT                   /gene="Kin"
FT                   /locus_tag="mCG_5022"
FT                   /product="antigenic determinant of rec-A protein,
FT                   transcript variant mCT190169"
FT                   /note="gene_id=mCG5022.1 transcript_id=mCT190169.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(7019704..7019817,7024805..7024899,7029188..7029231,
FT                   7029316..7029438,7030793..7031592)
FT                   /codon_start=1
FT                   /gene="Kin"
FT                   /locus_tag="mCG_5022"
FT                   /product="antigenic determinant of rec-A protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5022.1 transcript_id=mCT4275.2
FT                   protein_id=mCP8532.2 isoform=CRA_b"
FT                   /protein_id="EDL08003.1"
FT                   /translation="MGKSDFLSPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHC
FT                   MSESHQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREH
FT                   IHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDL
FT                   DDEEKTAKFIEEQVRRGLEGKEQETPVFTELSRENEEEKVTFNLNKGAGGSAGATTSKS
FT                   SSLGPSALKLLGSAASGKRKESSQSSAQPAKKKKSALDEIMELEEEKKRTARTDAWLQP
FT                   GIVVKIITKKLGEKYHKKKGVVKEVIDRYTAVVKMTDSGDRLKLDQTHLETVIPAPGKR
FT                   VLVLNGGYRGNEGTLESINEKAFSATIVIETGPLKGRRVEGIQYEDISKLA"
FT   CDS             <7030792..7031592
FT                   /codon_start=1
FT                   /gene="Kin"
FT                   /locus_tag="mCG_5022"
FT                   /product="antigenic determinant of rec-A protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5022.1 transcript_id=mCT190169.0
FT                   protein_id=mCP111169.0 isoform=CRA_a"
FT                   /protein_id="EDL08002.1"
FT                   /translation="GLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTA
FT                   KFIEEQVRRGLEGKEQETPVFTELSRENEEEKVTFNLNKGAGGSAGATTSKSSSLGPSA
FT                   LKLLGSAASGKRKESSQSSAQPAKKKKSALDEIMELEEEKKRTARTDAWLQPGIVVKII
FT                   TKKLGEKYHKKKGVVKEVIDRYTAVVKMTDSGDRLKLDQTHLETVIPAPGKRVLVLNGG
FT                   YRGNEGTLESINEKAFSATIVIETGPLKGRRVEGIQYEDISKLA"
FT   gene            complement(7033646..7069816)
FT                   /gene="Itih2"
FT                   /locus_tag="mCG_5023"
FT                   /note="gene_id=mCG5023.1"
FT   mRNA            complement(join(7033646..7033956,7035506..7035617,
FT                   7036132..7036304,7036957..7037155,7037509..7037622,
FT                   7041132..7041269,7041842..7042011,7044219..7044358,
FT                   7044697..7044882,7045731..7045912,7048559..7048684,
FT                   7049473..7049641,7054307..7054423,7055682..7055810,
FT                   7056417..7056524,7058545..7058707,7062593..7062697,
FT                   7065334..7065503,7066925..7066957,7068379..7068453,
FT                   7069632..7069816))
FT                   /gene="Itih2"
FT                   /locus_tag="mCG_5023"
FT                   /product="inter-alpha trypsin inhibitor, heavy chain 2"
FT                   /note="gene_id=mCG5023.1 transcript_id=mCT4289.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(7033809..7033956,7035506..7035617,
FT                   7036132..7036304,7036957..7037155,7037509..7037622,
FT                   7041132..7041269,7041842..7042011,7044219..7044358,
FT                   7044697..7044882,7045731..7045912,7048559..7048684,
FT                   7049473..7049641,7054307..7054423,7055682..7055810,
FT                   7056417..7056524,7058545..7058707,7062593..7062697,
FT                   7065334..7065503,7066925..7066957,7068379..7068453,
FT                   7069632..7069727))
FT                   /codon_start=1
FT                   /gene="Itih2"
FT                   /locus_tag="mCG_5023"
FT                   /product="inter-alpha trypsin inhibitor, heavy chain 2"
FT                   /note="gene_id=mCG5023.1 transcript_id=mCT4289.2
FT                   protein_id=mCP8533.2"
FT                   /db_xref="GOA:G3X977"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010600"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="MGI:MGI:96619"
FT                   /db_xref="UniProtKB/TrEMBL:G3X977"
FT                   /protein_id="EDL08004.1"
FT                   /translation="MSSKMQRPVCLLIWLFLLEAQAFEIPINGNSEFAEYSDLVELAPD
FT                   KLPFVQENGRHQRSLPEESGEETDTVDPVTLYSYKVQSTITSRVATTTIQSKLVNNSPL
FT                   PQSVVFDVQIPKGAFISNFTMTVNGMTFTSSIKEKTVGRALYSQARAKGKTAGWVRSRT
FT                   LDMENFNTEVNIPPGAKVQFELHYQEVKWRKLGSYEHKIHLQPGKLAKHLEVNVWIIEP
FT                   QGMRFLHVPDTFEGHFQGVPVISKGQQKAHVSFKPTVAQQRKCPNCTETAVNGELVVMY
FT                   DVNREEKAGELEVFNGYFVHFFAPENLDPIPKNILFVIDVSGSMWGIKMKQTVEAMKTI
FT                   LDDLRTDDQFSVVDFNHNVRTWRNDLVSATKTQIADAKRYIEKIQPSGGTNINEALLRA
FT                   IFILNEASNMGLLNPDSVSLIILVSDGDPTVGELKLSKIQKNVKQSIQDNISLFSLGIG
FT                   FDVDYDFLKRLSNENRGIAQRIYGNQDTSSQLKKFYNQVSTPLLRNVQFNYPQASVTDV
FT                   TQNNFHNYFGGSEIVVAGKFDPSKLTEVQSIITATSANTELVLETLSQMDDLEEFLSKD
FT                   KHADPDFTKKLWAYLTINQLLAERSLAPTAAIKRKITKTILQMSLDHHIVTPLTAMVIE
FT                   NDAGDERMLADSPPQDHSCCSGALYYGTKVASGPIPSWANPSPTPMSAMLAVGAKPLES
FT                   TPPTHLNQVENDPHFIIYLPKSKRNICFNIDSEPGKILSLVSDPESGIVVNGQLIGAKR
FT                   AENGKLSTYFGKLGFYFQKEGMKIEISTETITLSSGSSTSRLSWSDTAHLGNSRVLISV
FT                   KKEKSVTLTLNKELFFSVLLHRVWRKHPVNVDFLGIYAPPIDKFSPRVHGLLGQFMQEP
FT                   AIHIFNERPGKEPGKPEASMEVKGHKLTVTRGLQKDYRTDIVFGTDVPCWFVHNSGKGF
FT                   IDGHYKDYFVPQLYSFLKRP"
FT   gene            7092689..7192530
FT                   /gene="Itih5"
FT                   /locus_tag="mCG_5024"
FT                   /note="gene_id=mCG5024.1"
FT   mRNA            join(7092689..7092825,7103732..7103776,7125098..7125261,
FT                   7126534..7126635,7129779..7130029,7146144..7146313,
FT                   7147146..7147262,7175267..7175435,7178826..7179135,
FT                   7180784..7181343,7182765..7182818,7185788..7185904,
FT                   7189353..7189730,7191516..7192530)
FT                   /gene="Itih5"
FT                   /locus_tag="mCG_5024"
FT                   /product="inter-alpha (globulin) inhibitor H5, transcript
FT                   variant mCT4276"
FT                   /note="gene_id=mCG5024.1 transcript_id=mCT4276.1 created on
FT                   10-SEP-2002"
FT   mRNA            join(<7092736..7092825,7103732..7103776,7125098..7125261,
FT                   7129779..7130029,7146144..7146313,7147146..7147262,
FT                   7175267..7175435,7178826..7179135,7180784..7181343,
FT                   7182765..7182818,7185788..7185904,7189353..7189730,
FT                   7191516..7191938)
FT                   /gene="Itih5"
FT                   /locus_tag="mCG_5024"
FT                   /product="inter-alpha (globulin) inhibitor H5, transcript
FT                   variant mCT173223"
FT                   /note="gene_id=mCG5024.1 transcript_id=mCT173223.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(7092736..7092825,7103732..7103776,7125098..7125261,
FT                   7126534..7126635,7129779..7130029,7146144..7146313,
FT                   7147146..7147262,7175267..7175435,7178826..7179135,
FT                   7180784..7181343,7182765..7182818,7185788..7185904,
FT                   7189353..7189730,7191516..7191847)
FT                   /codon_start=1
FT                   /gene="Itih5"
FT                   /locus_tag="mCG_5024"
FT                   /product="inter-alpha (globulin) inhibitor H5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5024.1 transcript_id=mCT4276.1
FT                   protein_id=mCP8535.2 isoform=CRA_b"
FT                   /protein_id="EDL08006.1"
FT                   /translation="MLLLLGLCLGLPLFSESQEEARSWDDTSEQVVLRVPRQLRLLQRL
FT                   KTKPLMAEFSVKSTIISRYAFTTVSCRMLNRASEDQEAEFQMQIPESAFITNFTMLIGD
FT                   SVYRGEITQKDKKSSESVKDKRNRTSDDNEENGSDMFKASLVIPSKDKAAFFLSYEELL
FT                   QRRLGKYEHSISVRPQQLVGRLTVEVDILERSGITSLEVLPLHNSRKKGSGKAEGDVGP
FT                   PPSTLINQNETFAKVIFKPTVVQQAKIAQNGILGDFIVRYDVEREQNIGDIQVLNGYFV
FT                   HYFAPKNLPPLPKNVVFVLDISASMVGAKLQQTREALVTILNDLRPQDRFNIIGFSNRI
FT                   KMWKDHLLPVTPDNIRNGKIYMYHLSPTGGTDINGALQAAIKLLNNYVAQNDIEDRSVS
FT                   LIIFLTDGKPTFGETNTLKILSNTKEATRGQICIFTVGIGDDVDFKLLEKLSLENCGLT
FT                   RRVHEEDKAGAQLIGFYDEIRTPLLSDIRIDYPPDVVEHATKTLFPNYFNGSEIVIAGK
FT                   MVDKKFDQLHVEVTASNSKKFVILKRDIPVEFRKMGNDVSVTPGSARDGGKDLNHIERL
FT                   WSYLTVKELLSSWRQSNSEQEKEQLRQKAQDLALNYHFLTPFTSMKLRKPGLRTNQLED
FT                   TYGMSAATGPATVVQNLREAGKQPEPDLKKTYDPRIKISKTSVDGDPHFVVDFPLSKLT
FT                   VCFNIDGEPGDILRLVSDHLNSGVTVNGELIGAPAPPNGHKKQRTYFRTITILINRPER
FT                   SYLEITPSRVILDGGDRLVLPCNQSVVVGSRGLEVSVSANANITVVIQGNIAFVILIHL
FT                   YKNPAPFQRDHLGFYIANSRGLSDNCHGLLGQFLNQDAKLVGAPEEYGKNLSNQPFPRA
FT                   EGMPEAILKVKGRRVPVVWKQRKIYNGQAQVDCWFDRNNAAKLIDGVYKDYLASHPFDT
FT                   ESALGLSTPRKPETDRPHEESV"
FT   CDS             join(7092736..7092825,7103732..7103776,7125098..7125261,
FT                   7129779..7130029,7146144..7146313,7147146..7147262,
FT                   7175267..7175435,7178826..7179135,7180784..7181343,
FT                   7182765..7182818,7185788..7185904,7189353..7189730,
FT                   7191516..7191847)
FT                   /codon_start=1
FT                   /gene="Itih5"
FT                   /locus_tag="mCG_5024"
FT                   /product="inter-alpha (globulin) inhibitor H5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5024.1 transcript_id=mCT173223.0
FT                   protein_id=mCP96142.0 isoform=CRA_a"
FT                   /protein_id="EDL08005.1"
FT                   /translation="MLLLLGLCLGLPLFSESQEEARSWDDTSEQVVLRVPRQLRLLQRL
FT                   KTKPLMAEFSVKSTIISRYAFTTVSCRMLNRASEDQEAEFQMQIPESAFITNFTIENGS
FT                   DMFKASLVIPSKDKAAFFLSYEELLQRRLGKYEHSISVRPQQLVGRLTVEVDILERSGI
FT                   TSLEVLPLHNSRKKGSGKAEGDVGPPPSTLINQNETFAKVIFKPTVVQQAKIAQNGILG
FT                   DFIVRYDVEREQNIGDIQVLNGYFVHYFAPKNLPPLPKNVVFVLDISASMVGAKLQQTR
FT                   EALVTILNDLRPQDRFNIIGFSNRIKMWKDHLLPVTPDNIRNGKIYMYHLSPTGGTDIN
FT                   GALQAAIKLLNNYVAQNDIEDRSVSLIIFLTDGKPTFGETNTLKILSNTKEATRGQICI
FT                   FTVGIGDDVDFKLLEKLSLENCGLTRRVHEEDKAGAQLIGFYDEIRTPLLSDIRIDYPP
FT                   DVVEHATKTLFPNYFNGSEIVIAGKMVDKKFDQLHVEVTASNSKKFVILKRDIPVEFRK
FT                   MGNDVSVTPGSARDGGKDLNHIERLWSYLTVKELLSSWRQSNSEQEKEQLRQKAQDLAL
FT                   NYHFLTPFTSMKLRKPGLRTNQLEDTYGMSAATGPATVVQNLREAGKQPEPDLKKTYDP
FT                   RIKISKTSVDGDPHFVVDFPLSKLTVCFNIDGEPGDILRLVSDHLNSGVTVNGELIGAP
FT                   APPNGHKKQRTYFRTITILINRPERSYLEITPSRVILDGGDRLVLPCNQSVVVGSRGLE
FT                   VSVSANANITVVIQGNIAFVILIHLYKNPAPFQRDHLGFYIANSRGLSDNCHGLLGQFL
FT                   NQDAKLVGAPEEYGKNLSNQPFPRAEGMPEAILKVKGRRVPVVWKQRKIYNGQAQVDCW
FT                   FDRNNAAKLIDGVYKDYLASHPFDTESALGLSTPRKPETDRPHEESV"
FT   gene            complement(7279502..7314075)
FT                   /locus_tag="mCG_1030052"
FT                   /note="gene_id=mCG1030052.1"
FT   mRNA            complement(join(7279502..7279691,7281740..7281947,
FT                   7285550..7285684,7313633..7314075))
FT                   /locus_tag="mCG_1030052"
FT                   /product="mCG1030052"
FT                   /note="gene_id=mCG1030052.1 transcript_id=mCT147756.1
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(7281884..7281947,7285550..7285656))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030052"
FT                   /product="mCG1030052"
FT                   /note="gene_id=mCG1030052.1 transcript_id=mCT147756.1
FT                   protein_id=mCP51083.1"
FT                   /protein_id="EDL08007.1"
FT                   /translation="MPYFLGPKNLTDGQIFSSNPAVAAQRKRQPLEQHILLRENSEDKY
FT                   SLQQTSQMTRK"
FT   gene            7320247..>7515463
FT                   /locus_tag="mCG_20492"
FT                   /note="gene_id=mCG20492.1"
FT   mRNA            join(7320247..7320301,7333329..7333470,7342062..7342156,
FT                   7344513..7344753,7378073..7378159,7380045..7380239,
FT                   7385811..7385908,7397031..7397132,7401419..7401566,
FT                   7449206..7449288,7455555..7455678,7468055..7468168,
FT                   7482608..7482750,7493374..7493483,7500339..7500514,
FT                   7502818..7502967,7504112..7504389,7505541..7505669,
FT                   7515323..>7515463)
FT                   /locus_tag="mCG_20492"
FT                   /product="mCG20492"
FT                   /note="gene_id=mCG20492.1 transcript_id=mCT21531.2 created
FT                   on 10-SEP-2002"
FT   CDS             join(7333374..7333470,7342062..7342156,7344513..7344753,
FT                   7378073..7378159,7380045..7380239,7385811..7385908,
FT                   7397031..7397132,7401419..7401566,7449206..7449288,
FT                   7455555..7455678,7468055..7468168,7482608..7482750,
FT                   7493374..7493483,7500339..7500514,7502818..7502967,
FT                   7504112..7504389,7505541..7505669,7515323..7515463)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20492"
FT                   /product="mCG20492"
FT                   /note="gene_id=mCG20492.1 transcript_id=mCT21531.2
FT                   protein_id=mCP2354.2"
FT                   /protein_id="EDL08008.1"
FT                   /translation="MERYLPVSKKRNSSSSLEKITGSANGNGTLYSEEDTNLEENDFSW
FT                   GDYLEETGTRAVPHVSFRHVEISIRSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLL
FT                   LRYCGYGEDRRADFWCDVIIADLHPVGWCTQNNKVLRPPDAIKDKYSDWTDFLIRELTG
FT                   SRTAPANLLEELQDSQNPFQYWIVSVTENVGGRLRLRYVGLEHTESYDRWLFYLDYRLR
FT                   PIGWCQENKYRMDPPSELYYLKLPFEWKCALEKALVLAAESPLPMEVFKDHADLQSHFF
FT                   TVGMRLETLHISDPFHIYPASVTKVFNSKFFQVAIDDLRPEADKPTMLCHADSLGILPV
FT                   QWCLKNGVNLAPPKGYSGQDFNWVDYHKQRQAEEAPHFCFKNAFSRGFSKNMKLEAVNP
FT                   VNPGEVCVATVVSVKGRLLWLHLEGLETPMPDIIVDMDSMDIFPVGWCEANSYPLTTPY
FT                   KASFGAINAKYCCPQLFVNHRCFSGPFLNKGRISELPQSVGPGMCVLVLKEILTLITNA
FT                   AYKPGRVLRELQLVEDPEWNSQEEILKAKYGGKTYRAVVKIVRTADQVMNFCRQVCAKL
FT                   ECCPNLLSPVLISETCPENCSVHTKTRYTYYYGKRRRVIQSSLRVSNIETPPKSTRRRK
FT                   RRKSVYVQKRRKSAIVVPAARPFASQKTEQEKRETLDTARKKTGYHGPAYQTDTSAAQV
FT                   PFARPRRAVTLRRNSEALKRPPVERARRVRTVPTTASSNNRVKGPLVRIVKPEDSSQSD
FT                   EEKLILESNPLEWSVTDVVRFIKLTDCAPLARIFQEQDIDGQALLLLTLPTVQECMELK
FT                   LGPAIKLCHQIERVKVAFYAQYAS"
FT   gene            7814517..7815340
FT                   /pseudo
FT                   /locus_tag="mCG_9565"
FT                   /note="gene_id=mCG9565.2"
FT   mRNA            7814517..7815340
FT                   /pseudo
FT                   /locus_tag="mCG_9565"
FT                   /note="gene_id=mCG9565.2 transcript_id=mCT9706.2 created on
FT                   04-OCT-2002"
FT   gene            complement(7819475..7819830)
FT                   /pseudo
FT                   /locus_tag="mCG_57354"
FT                   /note="gene_id=mCG57354.1"
FT   mRNA            complement(7819475..7819830)
FT                   /pseudo
FT                   /locus_tag="mCG_57354"
FT                   /note="gene_id=mCG57354.1 transcript_id=mCT57537.1 created
FT                   on 04-OCT-2002"
FT   gene            complement(7879748..7880383)
FT                   /pseudo
FT                   /locus_tag="mCG_49186"
FT                   /note="gene_id=mCG49186.2"
FT   mRNA            complement(7879748..7880383)
FT                   /pseudo
FT                   /locus_tag="mCG_49186"
FT                   /note="gene_id=mCG49186.2 transcript_id=mCT49369.2 created
FT                   on 04-OCT-2002"
FT   gene            8011782..8012411
FT                   /pseudo
FT                   /locus_tag="mCG_57355"
FT                   /note="gene_id=mCG57355.2"
FT   mRNA            8011782..8012411
FT                   /pseudo
FT                   /locus_tag="mCG_57355"
FT                   /note="gene_id=mCG57355.2 transcript_id=mCT57538.2 created
FT                   on 05-FEB-2003"
FT   gene            complement(8017351..8021143)
FT                   /pseudo
FT                   /locus_tag="mCG_9566"
FT                   /note="gene_id=mCG9566.2"
FT   mRNA            complement(join(8017351..8017415,8019833..8021143))
FT                   /pseudo
FT                   /locus_tag="mCG_9566"
FT                   /note="gene_id=mCG9566.2 transcript_id=mCT9708.2 created on
FT                   10-SEP-2002"
FT   gene            <8093682..8222740
FT                   /gene="Prkcq"
FT                   /locus_tag="mCG_9571"
FT                   /note="gene_id=mCG9571.2"
FT   mRNA            join(<8093682..8093832,8148313..8148439,8153984..8154183,
FT                   8157472..8157532,8166705..8166867,8168251..8168282,
FT                   8168380..8168465,8169653..8169782,8174609..8174718,
FT                   8175695..8175812,8177681..8177841,8182177..8182350,
FT                   8198542..8198633,8200992..8201054,8205257..8205880)
FT                   /gene="Prkcq"
FT                   /locus_tag="mCG_9571"
FT                   /product="protein kinase C, theta, transcript variant
FT                   mCT190070"
FT                   /note="gene_id=mCG9571.2 transcript_id=mCT190070.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8093683..8093832,8148313..8148439,8153984..8154183,
FT                   8157472..8157532,8166705..8166867,8168251..8168282,
FT                   8168380..8168465,8169653..8169782,8174609..8174718,
FT                   8175695..8175812,8177681..8177841,8182177..8182350,
FT                   8198542..8198633,8200992..8201054,8205257..8205464)
FT                   /codon_start=1
FT                   /gene="Prkcq"
FT                   /locus_tag="mCG_9571"
FT                   /product="protein kinase C, theta, isoform CRA_a"
FT                   /note="gene_id=mCG9571.2 transcript_id=mCT190070.0
FT                   protein_id=mCP111049.0 isoform=CRA_a"
FT                   /protein_id="EDL08009.1"
FT                   /translation="NATRRASLSRRGERPLAGAATGVPLGRQARASPRHPSNSGAALGP
FT                   RPRHQGTTMSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPT
FT                   MYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELK
FT                   PQGRMLMNARYFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQ
FT                   PTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKI
FT                   DMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKL
FT                   MAEALAMIESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISW
FT                   DSPLDGSNKSAGPPEPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTNQF
FT                   FAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGG
FT                   DLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADF
FT                   GMCKENMLGDAKTNTFCGTPDYIAPEVGTHCLGGPFSAWCAEAKCVLP"
FT   mRNA            join(8093754..8093832,8148313..8148439,8153984..8154183,
FT                   8157472..8157532,8166705..8166867,8168251..8168282,
FT                   8168380..8168465,8169653..8169782,8174609..8174718,
FT                   8175695..8175812,8177681..8177841,8182177..8182350,
FT                   8198542..8198633,8200992..8201054,8205257..8205395,
FT                   8211902..8212090,8220809..8220937,8221481..8222740)
FT                   /gene="Prkcq"
FT                   /locus_tag="mCG_9571"
FT                   /product="protein kinase C, theta, transcript variant
FT                   mCT9713"
FT                   /note="gene_id=mCG9571.2 transcript_id=mCT9713.1 created on
FT                   10-SEP-2002"
FT   CDS             join(8148322..8148439,8153984..8154183,8157472..8157532,
FT                   8166705..8166867,8168251..8168282,8168380..8168465,
FT                   8169653..8169782,8174609..8174718,8175695..8175812,
FT                   8177681..8177841,8182177..8182350,8198542..8198633,
FT                   8200992..8201054,8205257..8205395,8211902..8212090,
FT                   8220809..8220937,8221481..8221639)
FT                   /codon_start=1
FT                   /gene="Prkcq"
FT                   /locus_tag="mCG_9571"
FT                   /product="protein kinase C, theta, isoform CRA_b"
FT                   /note="gene_id=mCG9571.2 transcript_id=mCT9713.1
FT                   protein_id=mCP2341.1 isoform=CRA_b"
FT                   /db_xref="GOA:A6H667"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014376"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="InterPro:IPR027264"
FT                   /db_xref="MGI:MGI:97601"
FT                   /db_xref="UniProtKB/TrEMBL:A6H667"
FT                   /protein_id="EDL08010.1"
FT                   /translation="MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMY
FT                   IQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTE
FT                   IWLELKPQGRMLMNARYFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFT
FT                   ATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFH
FT                   KERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLC
FT                   GINQKLMAEALAMIESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKRE
FT                   PQGISWDSPLDGSNKSAGPPEPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEF
FT                   KRTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVM
FT                   EYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGH
FT                   IKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQ
FT                   SPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFR
FT                   EINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNF
FT                   SFINPGMETLICS"
FT   gene            complement(8259548..>8316313)
FT                   /locus_tag="mCG_144584"
FT                   /note="gene_id=mCG144584.0"
FT   mRNA            complement(join(8259548..8260325,8272712..8272859,
FT                   8316204..>8316313))
FT                   /locus_tag="mCG_144584"
FT                   /product="mCG144584"
FT                   /note="gene_id=mCG144584.0 transcript_id=mCT184008.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8260230..8260325,8272712..8272859,
FT                   8316204..>8316235))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144584"
FT                   /product="mCG144584"
FT                   /note="gene_id=mCG144584.0 transcript_id=mCT184008.0
FT                   protein_id=mCP105473.0"
FT                   /protein_id="EDL08011.1"
FT                   /translation="NSGRFQAFLRQMWPAPAASGSSCCLSHHDGLKDPRRETLTQASGQ
FT                   PRTQEDTETELKMLKASVVESLHGVGVHSFTQSEASSAVYLALTGG"
FT   gene            complement(8326660..8327915)
FT                   /pseudo
FT                   /locus_tag="mCG_115100"
FT                   /note="gene_id=mCG115100.1"
FT   mRNA            complement(8326660..8327915)
FT                   /pseudo
FT                   /locus_tag="mCG_115100"
FT                   /note="gene_id=mCG115100.1 transcript_id=mCT116200.1
FT                   created on 23-MAY-2003"
FT   gene            8338069..8339156
FT                   /pseudo
FT                   /locus_tag="mCG_49187"
FT                   /note="gene_id=mCG49187.2"
FT   mRNA            8338069..8339156
FT                   /pseudo
FT                   /locus_tag="mCG_49187"
FT                   /note="gene_id=mCG49187.2 transcript_id=mCT49370.2 created
FT                   on 23-SEP-2002"
FT   gene            complement(8390164..>8420478)
FT                   /locus_tag="mCG_9572"
FT                   /note="gene_id=mCG9572.3"
FT   mRNA            complement(join(8390164..8392961,8398618..8398791,
FT                   8400318..8400355,8400474..8400536,8400865..8400994,
FT                   8402349..8402453,8402625..8402771,8403075..8403282,
FT                   8404639..8404763,8407146..8407202,8408091..8408165,
FT                   8408710..8408776,8410980..8411076,8412323..8412448,
FT                   8420036..8420416))
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, transcript variant mCT9712"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT9712.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(8390242..8392961,8394172..8394224,
FT                   8396454..8396476,8398618..8398791,8400291..8400355,
FT                   8400474..8400536,8400865..8400994,8402349..8402453,
FT                   8402625..8402771,8403075..8403282,8404639..8404763,
FT                   8407146..8407202,8408091..8408165,8408710..8408776,
FT                   8410980..8411076,8412323..8412448,8420036..>8420478))
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, transcript variant mCT190072"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT190072.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(8390246..8390339,8392811..8392961,
FT                   8398618..8398791,8400291..8400355,8400474..8400536,
FT                   8400865..8400994,8402349..8402453,8402625..8402771,
FT                   8403075..8403282,8404639..8404763,8407146..8407202,
FT                   8408091..8408165,8408710..8408776,8410980..8411076,
FT                   8412323..8412448,8416754..>8416805))
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, transcript variant mCT190073"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT190073.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(8392914..8392961,8398618..8398791,
FT                   8400318..8400355,8400474..8400536,8400865..8400994,
FT                   8402349..8402453,8402625..8402771,8403075..8403282,
FT                   8404639..8404763,8407146..8407202,8408091..8408165,
FT                   8408710..8408776,8410980..8411076,8412323..8412448,
FT                   8420036..8420111))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, isoform CRA_c"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT9712.2
FT                   protein_id=mCP2355.2 isoform=CRA_c"
FT                   /protein_id="EDL08014.1"
FT                   /translation="MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPA
FT                   RGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMRVRKQCAL
FT                   AALRDVKSYLTKEGGQIAVFDATNTTRERRHMILNFAKENDFKAFFIESVCDDPTVVAS
FT                   NIMEVKISSPDYKDCNSAEAMDDFMKRINCYEASYQPLDPDKCDRDLSLIKVIDVGRRF
FT                   LVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEYNLQGKIGGDSGLSSRGKKFANA
FT                   LSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDT
FT                   YPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYF
FT                   LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESDAKKGPNPLMRRNSVTPLAS
FT                   PEPTKKPRINSFEERVASTSAALPSCLPPEVPTQLPGQNMKSSRSGADSSQKH"
FT   CDS             complement(join(8392914..8392961,8398618..8398791,
FT                   8400291..8400355,8400474..8400536,8400865..8400994,
FT                   8402349..8402453,8402625..8402771,8403075..8403282,
FT                   8404639..8404763,8407146..8407202,8408091..8408165,
FT                   8408710..8408776,8410980..8411076,8412323..8412448,
FT                   8416754..>8416805))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, isoform CRA_b"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT190073.0
FT                   protein_id=mCP111051.0 isoform=CRA_b"
FT                   /db_xref="GOA:V9GWY6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="MGI:MGI:2181202"
FT                   /db_xref="UniProtKB/TrEMBL:V9GWY6"
FT                   /protein_id="EDL08013.1"
FT                   /translation="ERKGRHEELKMSQIQGGACGPKLTNSPTVIVMVGLPARGKTYISK
FT                   KLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMRVRKQCALAALRDVKS
FT                   YLTKEGGQIAVFDATNTTRERRHMILNFAKENDFKAFFIESVCDDPTVVASNIMEVKIS
FT                   SPDYKDCNSAEAMDDFMKRINCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDH
FT                   IQSRIVYYLMNIHVQPRTIYLCRHGENEYNLQGKIGGDSGLSSRGKKFANALSKFVEEQ
FT                   NLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALR
FT                   EQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEM
FT                   PYLKCPLHTVLKLTPVAYGCRVESIYLNVESVSTHRERSEDAKKGPNPLMRRNSVTPLA
FT                   SPEPTKKPRINSFEERVASTSAALPSCLPPEVPTQLPGQNMKSSRSGADSSQKH"
FT   CDS             complement(join(8394182..8394224,8396454..8396476,
FT                   8398618..8398791,8400291..8400355,8400474..8400536,
FT                   8400865..8400994,8402349..8402453,8402625..8402771,
FT                   8403075..8403282,8404639..8404763,8407146..8407202,
FT                   8408091..8408165,8408710..8408776,8410980..8411076,
FT                   8412323..8412448,8420036..>8420375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9572"
FT                   /product="mCG9572, isoform CRA_a"
FT                   /note="gene_id=mCG9572.3 transcript_id=mCT190072.0
FT                   protein_id=mCP111050.0 isoform=CRA_a"
FT                   /protein_id="EDL08012.1"
FT                   /translation="AFEQSRLVSSAAAATPRRSHLSRVSAQAILPPRLRTKHIFQSSAR
FT                   ERPAACRRTHPSCPLFRGDLLLLFSPSRSLSSRGGGSPNTATKMPLELTQSRVQKIWVP
FT                   VDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR
FT                   REAVKQYSSYNFFRPDNEEAMRVRKQCALAALRDVKSYLTKEGGQIAVFDATNTTRERR
FT                   HMILNFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRINC
FT                   YEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLC
FT                   RHGENEYNLQGKIGGDSGLSSRGKKFANALSKFVEEQNLKDLRVWTSQLKSTIQTAEAL
FT                   RLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRL
FT                   EPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRV
FT                   ESIYLNVESVSTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEERVASTSA
FT                   ALPSCLPPEVPTQLPGQPLLGKACLRSVCHIFSKFSPY"
FT   gene            8423619..>8424081
FT                   /locus_tag="mCG_1030059"
FT                   /note="gene_id=mCG1030059.0"
FT   mRNA            join(8423619..8423666,8423713..>8424081)
FT                   /locus_tag="mCG_1030059"
FT                   /product="mCG1030059"
FT                   /note="gene_id=mCG1030059.0 transcript_id=mCT147763.0
FT                   created on 23-SEP-2002"
FT   CDS             8423890..>8424081
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030059"
FT                   /product="mCG1030059"
FT                   /note="gene_id=mCG1030059.0 transcript_id=mCT147763.0
FT                   protein_id=mCP50688.1"
FT                   /protein_id="EDL08015.1"
FT                   /translation="MCEFSEPGLTLAKRTWKCFSHHNLCFYSLASVTKSFPESPRCGYQ
FT                   QQQHVTPLPYSYTSSLDLN"
FT   gene            complement(8504039..>8522410)
FT                   /gene="Rbm17"
FT                   /locus_tag="mCG_9563"
FT                   /note="gene_id=mCG9563.2"
FT   mRNA            complement(join(8504039..8504887,8504993..8505065,
FT                   8506111..8506169,8506925..8506998,8508132..8508295,
FT                   8509893..8510034,8512612..8512668,8514535..8514632,
FT                   8515833..8515999,8517256..8517372,8519823..8519945,
FT                   8522244..8522409))
FT                   /gene="Rbm17"
FT                   /locus_tag="mCG_9563"
FT                   /product="RNA binding motif protein 17, transcript variant
FT                   mCT9704"
FT                   /note="gene_id=mCG9563.2 transcript_id=mCT9704.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(8506125..8506169,8506925..8506998,
FT                   8508132..8508295,8509893..8510034,8512612..8512668,
FT                   8514535..8514632,8515833..8515999,8517256..8517372,
FT                   8519823..8519945,8522244..8522315))
FT                   /codon_start=1
FT                   /gene="Rbm17"
FT                   /locus_tag="mCG_9563"
FT                   /product="RNA binding motif protein 17, isoform CRA_b"
FT                   /note="gene_id=mCG9563.2 transcript_id=mCT9704.2
FT                   protein_id=mCP2312.2 isoform=CRA_b"
FT                   /protein_id="EDL08017.1"
FT                   /translation="MGTIVSEGRVSGAAAALAGGLIRNMSLYDDLGVETSDSKTEGWSK
FT                   NFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIADTPPHVAAGLK
FT                   DPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRK
FT                   DRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDS
FT                   RPRSQSSKAAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKH
FT                   EQGLSTALSVEKTSKRGGKIIVGDATEKGEAQDASKKSDSNPLTEILKCPTKVVLLRNM
FT                   VGAGEVDEDLGS"
FT   mRNA            complement(join(<8506926..8506998,8508132..8508295,
FT                   8509893..8510034,8512612..8512668,8514535..8514632,
FT                   8515833..8515999,8517256..8517372,8519823..8519960,
FT                   8522289..>8522410))
FT                   /gene="Rbm17"
FT                   /locus_tag="mCG_9563"
FT                   /product="RNA binding motif protein 17, transcript variant
FT                   mCT190022"
FT                   /note="gene_id=mCG9563.2 transcript_id=mCT190022.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<8506926..8506998,8508132..8508295,
FT                   8509893..8510034,8512612..8512668,8514535..8514632,
FT                   8515833..8515999,8517256..8517372,8519823..>8519954))
FT                   /codon_start=1
FT                   /gene="Rbm17"
FT                   /locus_tag="mCG_9563"
FT                   /product="RNA binding motif protein 17, isoform CRA_a"
FT                   /note="gene_id=mCG9563.2 transcript_id=mCT190022.0
FT                   protein_id=mCP111037.0 isoform=CRA_a"
FT                   /protein_id="EDL08016.1"
FT                   /translation="TKKMSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKS
FT                   QRTKQSTVLAPVIDLKRGGSSDDRQIADTPPHVAAGLKDPVPSGFSAGEVLIPLADEYD
FT                   PMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDED
FT                   YERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEPDR
FT                   PRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKII
FT                   VGDATEKGEAQDASKKSDSNPLTEILKCPTKVVLL"
FT   gene            8560257..8610844
FT                   /gene="Il2ra"
FT                   /locus_tag="mCG_9569"
FT                   /note="gene_id=mCG9569.3"
FT   mRNA            join(8560257..8560472,8591445..8591621,8593977..8594090,
FT                   8597868..8598083,8599589..8599660,8600712..8600783,
FT                   8602035..8602101,8607411..8610844)
FT                   /gene="Il2ra"
FT                   /locus_tag="mCG_9569"
FT                   /product="interleukin 2 receptor, alpha chain, transcript
FT                   variant mCT9710"
FT                   /note="gene_id=mCG9569.3 transcript_id=mCT9710.2 created on
FT                   29-NOV-2004"
FT   mRNA            join(8560257..8560472,8565374..8566039)
FT                   /gene="Il2ra"
FT                   /locus_tag="mCG_9569"
FT                   /product="interleukin 2 receptor, alpha chain, transcript
FT                   variant mCT194677"
FT                   /note="gene_id=mCG9569.3 transcript_id=mCT194677.0 created
FT                   on 29-NOV-2004"
FT   CDS             join(8560409..8560472,8591445..8591621,8593977..8594090,
FT                   8597868..8598083,8599589..8599660,8600712..8600783,
FT                   8602035..8602101,8607411..8607435)
FT                   /codon_start=1
FT                   /gene="Il2ra"
FT                   /locus_tag="mCG_9569"
FT                   /product="interleukin 2 receptor, alpha chain, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9569.3 transcript_id=mCT9710.2
FT                   protein_id=mCP2319.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544I2"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR015486"
FT                   /db_xref="MGI:MGI:96549"
FT                   /db_xref="UniProtKB/TrEMBL:Q544I2"
FT                   /protein_id="EDL08019.1"
FT                   /translation="MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGT
FT                   ILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTD
FT                   MQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISI
FT                   CKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTET
FT                   TAMTETFVLTMEYKVAVASCLFLLISILLLSGLTWQHRWRKSRRTI"
FT   CDS             join(8560409..8560472,8565374..8565444)
FT                   /codon_start=1
FT                   /gene="Il2ra"
FT                   /locus_tag="mCG_9569"
FT                   /product="interleukin 2 receptor, alpha chain, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9569.3 transcript_id=mCT194677.0
FT                   protein_id=mCP115706.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3THW2"
FT                   /db_xref="MGI:MGI:96549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3THW2"
FT                   /protein_id="EDL08018.1"
FT                   /translation="MEPRLLMLGFLSLTIVPSCRAASHSCIRIIEVDKGTVLVLQHED"
FT   gene            8622939..8651692
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /note="gene_id=mCG9567.2"
FT   mRNA            join(8622939..8623162,8635905..8636099,8637654..8637746,
FT                   8641737..8641769,8648212..8648287,8650791..8651692)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT173228"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT173228.0 created
FT                   on 11-SEP-2002"
FT   mRNA            join(<8623026..8623162,8635905..8636099,8641054..8641251,
FT                   8641737..8641769,8645404..8645474,8648212..8648287,
FT                   8650791..8651623)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190033"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190033.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8623035..8623162,8635905..8636099,8641054..8641251,
FT                   8641737..8641769,8648212..8648287,8650791..8651575)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT173227"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT173227.0 created
FT                   on 11-SEP-2002"
FT   mRNA            join(<8623120..8623162,8635905..8636099,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8651602)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190034"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190034.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8623136..8623162,8635905..8636099,8641737..8641769,
FT                   8648212..8648287,8650791..8651042)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190037"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190037.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8623136..8623162,8635905..8635983,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8651042)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190036"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190036.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8623138..8623162,8635905..8636099,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190034.0
FT                   protein_id=mCP111041.0 isoform=CRA_d"
FT                   /protein_id="EDL08023.1"
FT                   /translation="KGRSPASTGTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRK
FT                   AGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAK
FT                   EPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTA
FT                   STSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVETMET
FT                   VPMTVRASSKEDEDTGA"
FT   CDS             join(<8623138..8623162,8635905..8636099,8641737..8641769,
FT                   8648212..8648287,8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190037.0
FT                   protein_id=mCP111044.0 isoform=CRA_g"
FT                   /protein_id="EDL08026.1"
FT                   /translation="KGRSPASTGTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRK
FT                   AGTSTLIECVINKNTNVAHWTTPSLKCIKISPHSSKMTKVAISTSVLLVGAGVVMAFLA
FT                   WYIKSRQPSQPCRVEVETMETVPMTVRASSKEDEDTGA"
FT   CDS             join(<8623138..8623162,8635905..8635983,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8650817)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190036.0
FT                   protein_id=mCP111043.0 isoform=CRA_f"
FT                   /protein_id="EDL08025.1"
FT                   /translation="KGRSPASTGTTCPPPVSIEHADIRVKNYSVNSRERRPLPSSLQSS
FT                   ANSSDTKGDLTAREPLPLCKRARSFLSQIRYRNDHRDSYYAWLQADTIPNNFCRNYRDR
FT                   QSQVLPSPISCSNNDLGAYSLHLPQDNRDFSPQFQNDESGHLYIGPLGWCRGCDGFPGL
FT                   VHQIKAAFSAVPC"
FT   CDS             join(<8623138..8623162,8635905..8636099,8641054..8641251,
FT                   8641737..8641769,8645404..8645474,8648212..8648256)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190033.0
FT                   protein_id=mCP111040.0 isoform=CRA_c"
FT                   /protein_id="EDL08022.1"
FT                   /translation="KGRSPASTGTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRK
FT                   AGTSTLIECVINKNTNVAHWTTPSLKCIKPEAFSPKSDTAMTTETAIMPGSRLTPSQTT
FT                   SAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKASQDLRVPCHRLH
FT                   TADAHWLLRQKWPSLHRSSWLVQGL"
FT   mRNA            join(<8623394..8623528,8635905..8636099,8637654..8637746,
FT                   8641737..8641769,8648212..8648287,8650791..8651042)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190035"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190035.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8623394..8623528,8635905..8636099,8641737..8641769,
FT                   8648212..8648287,8650791..8651042)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190039"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190039.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8623395..8623528,8635905..8636099,8637654..8637746,
FT                   8641153..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8651042)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT190038"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190038.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8623396..8623528,8635905..8636099,8637654..8637746,
FT                   8641153..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190038.0
FT                   protein_id=mCP111045.0 isoform=CRA_h"
FT                   /protein_id="EDL08027.1"
FT                   /translation="CVPLGHCWGQLAMASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPG
FT                   TTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTP
FT                   SLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKGTTGTGSHKSSRAPSLAATMTLE
FT                   PTASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVET
FT                   METVPMTVRASSKEDEDTGA"
FT   CDS             join(<8623396..8623528,8635905..8636099,8637654..8637746,
FT                   8641737..8641769,8648212..8648287,8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190035.0
FT                   protein_id=mCP111042.0 isoform=CRA_e"
FT                   /protein_id="EDL08024.1"
FT                   /translation="CVPLGHCWGQLAMASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPG
FT                   TTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTP
FT                   SLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEISPHSSKMTKVAISTSVLLVGA
FT                   GVVMAFLAWYIKSRQPSQPCRVEVETMETVPMTVRASSKEDEDTGA"
FT   CDS             join(<8623396..8623528,8635905..8636099,8641737..8641769,
FT                   8648212..8648287,8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_i"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT190039.0
FT                   protein_id=mCP111046.0 isoform=CRA_i"
FT                   /protein_id="EDL08028.1"
FT                   /translation="CVPLGHCWGQLAMASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPG
FT                   TTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTP
FT                   SLKCIKISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVETMETVP
FT                   MTVRASSKEDEDTGA"
FT   mRNA            join(8623402..8623528,8635905..8636099,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8651450)
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, transcript
FT                   variant mCT9707"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT9707.1 created on
FT                   11-SEP-2002"
FT   CDS             join(8623432..8623528,8635905..8636099,8637654..8637746,
FT                   8641054..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_j"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT9707.1
FT                   protein_id=mCP2299.1 isoform=CRA_j"
FT                   /protein_id="EDL08029.1"
FT                   /translation="MASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPGTTCPPPVSIEHA
FT                   DIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAH
FT                   YSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGT
FT                   TGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMA
FT                   FLAWYIKSRQPSQPCRVEVETMETVPMTVRASSKEDEDTGA"
FT   CDS             join(8641089..8641251,8641737..8641769,8648212..8648287,
FT                   8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT173227.0
FT                   protein_id=mCP96147.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q501M1"
FT                   /db_xref="MGI:MGI:104644"
FT                   /db_xref="UniProtKB/TrEMBL:Q501M1"
FT                   /protein_id="EDL08020.1"
FT                   /translation="MTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEP
FT                   TASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVETM
FT                   ETVPMTVRASSKEDEDTGA"
FT   CDS             join(8641760..8641769,8648212..8648287,8650791..8650890)
FT                   /codon_start=1
FT                   /gene="Il15ra"
FT                   /locus_tag="mCG_9567"
FT                   /product="interleukin 15 receptor, alpha chain, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9567.2 transcript_id=mCT173228.0
FT                   protein_id=mCP96146.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q80SW0"
FT                   /db_xref="MGI:MGI:104644"
FT                   /db_xref="UniProtKB/TrEMBL:Q80SW0"
FT                   /protein_id="EDL08021.1"
FT                   /translation="MTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVETMETV
FT                   PMTVRASSKEDEDTGA"
FT   gene            complement(8660215..>8695070)
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /note="gene_id=mCG9564.3"
FT   mRNA            complement(join(8660215..8660674,8661267..8661398,
FT                   8664701..8664807,8666005..8666130,8666578..8666775,
FT                   8667172..8667247,8669092..8669213,8669308..8669407,
FT                   8673282..8673418,8674058..8674144,8674243..8674330,
FT                   8675081..8675303,8675921..8676089,8677570..8677664,
FT                   8678122..8678214,8680472..8680662,8681511..8681646,
FT                   8681744..8681874,8684763..8685346,8687489..8687572,
FT                   8694960..>8695070))
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, transcript variant mCT190026"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT190026.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(8660217..8660674,8661267..8661398,
FT                   8664701..8664807,8666005..8666130,8666578..8666775,
FT                   8667172..8667247,8669092..8669213,8669308..8669407,
FT                   8673282..8673418,8674058..8674144,8674243..8674330,
FT                   8675081..8675303,8675921..8676089,8677570..8677664,
FT                   8678122..8678214,8680472..8680662,8681511..8681646,
FT                   8681744..8681874,8684763..8685352,8687417..8687572,
FT                   8694960..8695047))
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, transcript variant mCT9705"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT9705.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(8660504..8660674,8661267..8661398,
FT                   8664701..8664807,8666005..8666130,8666578..8666775,
FT                   8667172..8667247,8669092..8669213,8669308..8669407,
FT                   8673282..8673418,8674058..8674144,8674243..8674330,
FT                   8675081..8675303,8675921..8676089,8677570..8677664,
FT                   8678122..8678214,8680472..8680662,8681511..8681646,
FT                   8681744..8681874,8684763..8685346,8687489..8687572,
FT                   8694960..>8695068))
FT                   /codon_start=1
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, isoform CRA_a"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT190026.0
FT                   protein_id=mCP111038.0 isoform=CRA_a"
FT                   /protein_id="EDL08030.1"
FT                   /translation="CSLSGPKEGLAGRGKAECPAASPGWCRRRGPGPGRHMRRFKRKHL
FT                   TVVDCHHLARSHLAVTQPFRCQRYISEFFLAGHQHCTNDMAKSNSVGQDSCQDAEGDMI
FT                   LTAESSCTLPQVDNGEARLGSSGSAQPARKRAHCFEEATESGQWDGVTKKTPRHRLFPS
FT                   CSRLREARQGAEDSLSQCSPVPGEAGRDIEDIGPDPLPDSYYGLLGMLPCQEVPSHICR
FT                   LPSEVLRHIFAFLPVEDLYWNLSLVCHLWREIINDPLFIPWKKLYHRYLINEEQAVSKV
FT                   DGILSSHGIEKDSDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLLEAEACMRQQL
FT                   PDLYAAAGGINVWALVAAMVLLSSCVNDIQHLLFCLRRPSSTVTMPDVTETLYCIAVLL
FT                   YAMREKGINISNRIHYNIFYCLYLQENSCTQATKVTEEPSVWPGKKTSIQLTHEQQLIL
FT                   NHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTFNKSIAKQAELVFPSNVIC
FT                   KTFHSMAYSHVGRKYQLKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTLENFFASA
FT                   DEELTIDHVPIWCKNSHGQRVMVEQSEKLNGVLEASRLWDNMRKLGECKEEAYQMTHDG
FT                   YLKLWQLSKPLLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVN
FT                   ALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDIKGQV
FT                   ALLSRTNANVFDEAVRVTEGESPARIHLIGGIKSFGLDRIIDIWTLLQPEEERRKRDLI
FT                   IKDRFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRIPELVERIERCHIDDL
FT                   DFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLAQLPHFRVESFSEDEWNLLYVA
FT                   VTRAKKRLIMTKSLENILTLAGEYFLQAELTSNVLKTGVVHCCVGQCNNTIPVDTILTM
FT                   KKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTVEDIVLPRQEALL
FT                   FLVF"
FT   CDS             complement(join(8660504..8660674,8661267..8661398,
FT                   8664701..8664807,8666005..8666130,8666578..8666775,
FT                   8667172..8667247,8669092..8669213,8669308..8669407,
FT                   8673282..8673418,8674058..8674144,8674243..8674330,
FT                   8675081..8675303,8675921..8676089,8677570..8677664,
FT                   8678122..8678214,8680472..8680662,8681511..8681646,
FT                   8681744..8681874,8684763..8685352,8687417..8687572,
FT                   8694960))
FT                   /codon_start=1
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, isoform CRA_c"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT9705.2
FT                   protein_id=mCP2336.2 isoform=CRA_c"
FT                   /protein_id="EDL08032.1"
FT                   /translation="MRRFKRKHLTVVDCHHLARSHLAVTQPFSQRWTNRDPNHGLYPRP
FT                   RTKGRNRGRGCQRYISEFFLAGHQHCTNDMAKSNSVGQDSCQDAEGDMILTAESSCTLP
FT                   QVDNGEARLGSSGSAQPARKRAHCFEEATESGQWDGVTKKTPRHRLFPSCSRLREARQG
FT                   AEDSLSQCSPVPGEAGRDIEDIGPDPLPDSYYGLLGMLPCQEVPSHICRLPSEVLRHIF
FT                   AFLPVEDLYWNLSLVCHLWREIINDPLFIPWKKLYHRYLINEEQAVSKVDGILSSHGIE
FT                   KDSDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLLEAEACMRQQLPDLYAAAGGI
FT                   NVWALVAAMVLLSSCVNDIQHLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGINI
FT                   SNRIHYNIFYCLYLQENSCTQATKVTEEPSVWPGKKTSIQLTHEQQLILNHKMEPLQVV
FT                   KIMAFAGTGKTSTLVKYAEKWSQSRFLYVTFNKSIAKQAELVFPSNVICKTFHSMAYSH
FT                   VGRKYQLKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTLENFFASADEELTIDHVP
FT                   IWCKNSHGQRVMVEQSEKLNGVLEASRLWDNMRKLGECKEEAYQMTHDGYLKLWQLSKP
FT                   LLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHV
FT                   FYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDIKGQVALLSRTNANV
FT                   FDEAVRVTEGESPARIHLIGGIKSFGLDRIIDIWTLLQPEEERRKRDLIIKDRFIRRWV
FT                   HKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRIPELVERIERCHIDDLDFAEYILGTV
FT                   HKAKGLEFDTVHVLDDFVKVPCARHNLAQLPHFRVESFSEDEWNLLYVAVTRAKKRLIM
FT                   TKSLENILTLAGEYFLQAELTSNVLKTGVVHCCVGQCNNTIPVDTILTMKKLPITYSNR
FT                   KENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTVEDIVLPRQEALLFLVF"
FT   mRNA            complement(join(8665491..8666775,8667172..8667247,
FT                   8669092..8669213,8669308..8669407,8673282..8673418,
FT                   8674058..8674144,8674243..8674330,8675081..8675303,
FT                   8675921..8676089,8677570..8677664,8678122..8678214,
FT                   8680472..8680662,8681511..8681646,8681744..8681874,
FT                   8684763..8685352,8687417..8687572,8694597..>8695036))
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, transcript variant mCT190027"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT190027.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(8666483..8666775,8667172..8667247,
FT                   8669092..8669213,8669308..8669407,8673282..8673418,
FT                   8674058..8674144,8674243..8674330,8675081..8675303,
FT                   8675921..8676089,8677570..8677664,8678122..8678214,
FT                   8680472..8680662,8681511..8681646,8681744..8681874,
FT                   8684763..8685352,8687417..8687572,8694597..>8694600))
FT                   /codon_start=1
FT                   /gene="Fbxo18"
FT                   /locus_tag="mCG_9564"
FT                   /product="F-box protein 18, isoform CRA_b"
FT                   /note="gene_id=mCG9564.3 transcript_id=mCT190027.0
FT                   protein_id=mCP111039.0 isoform=CRA_b"
FT                   /protein_id="EDL08031.1"
FT                   /translation="TVRRFKRKHLTVVDCHHLARSHLAVTQPFSQRWTNRDPNHGLYPR
FT                   PRTKGRNRGRGCQRYISEFFLAGHQHCTNDMAKSNSVGQDSCQDAEGDMILTAESSCTL
FT                   PQVDNGEARLGSSGSAQPARKRAHCFEEATESGQWDGVTKKTPRHRLFPSCSRLREARQ
FT                   GAEDSLSQCSPVPGEAGRDIEDIGPDPLPDSYYGLLGMLPCQEVPSHICRLPSEVLRHI
FT                   FAFLPVEDLYWNLSLVCHLWREIINDPLFIPWKKLYHRYLINEEQAVSKVDGILSSHGI
FT                   EKDSDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLLEAEACMRQQLPDLYAAAGG
FT                   INVWALVAAMVLLSSCVNDIQHLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGIN
FT                   ISNRIHYNIFYCLYLQENSCTQATKVTEEPSVWPGKKTSIQLTHEQQLILNHKMEPLQV
FT                   VKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTFNKSIAKQAELVFPSNVICKTFHSMAYS
FT                   HVGRKYQLKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTLENFFASADEELTIDHV
FT                   PIWCKNSHGQRVMVEQSEKLNGVLEASRLWDNMRKLGECKEEAYQMTHDGYLKLWQLSK
FT                   PLLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTH
FT                   VFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDIKGQVALLSRTNAN
FT                   VFDEAVRVTEGESPARIHLIGGIKSFGLDRIIDIWTLLQPEEERRKRDLIIKDRFIRRW
FT                   VHKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRIPELVERIERCHIDDLDFAGKESGC
FT                   YLPSKRRSRWFLEVSLHLYLPEAVL"
FT   gene            <8696068..8707873
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /note="gene_id=mCG9568.2"
FT   mRNA            join(<8696068..8696446,8697221..8697367,8699021..8701300,
FT                   8701835..8701996,8703768..8703846,8707279..8707866)
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, transcript variant
FT                   mCT190040"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT190040.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8696069..8696446,8697221..8697441,8699021..8699063,
FT                   8701185..8701293,8701835..8701996,8703768..8703846,
FT                   8707279..8707873)
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, transcript variant
FT                   mCT9709"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT9709.2 created on
FT                   23-SEP-2002"
FT   mRNA            join(8696070..8696446,8697221..8697441,8699021..8699063,
FT                   8701185..8701293,8701835..8701996,8702667..8702804,
FT                   8703768..8703846,8707279..8707846)
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, transcript variant
FT                   mCT173787"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT173787.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(<8696070..8696446,8697221..8697367,8699021..8699060)
FT                   /codon_start=1
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, isoform CRA_b"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT190040.0
FT                   protein_id=mCP111047.0 isoform=CRA_b"
FT                   /protein_id="EDL08034.1"
FT                   /translation="QICSKTEPGSSSYFCPSWSRAMALPGDPRRLCRLVQEGRLRDLQE
FT                   ELAVARGCRGPAGDTLLHCAARHGRQDILAYLVEAWSMDIEATNRDYKRPLHEAASMGH
FT                   RDCVRYLLGRGAVVDSLKKADWTPLMMACTRKNLDVIQDLVEHGANPLLKNKDGWNSFH
FT                   IASREGHPVILRNARLFGSSPGAS"
FT   mRNA            join(<8696108..8696446,8697221..8697367,8699021..8699077,
FT                   8701185..8701293,8701835..8701996,8703768..8703846,
FT                   8707279..8707849)
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, transcript variant
FT                   mCT190041"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT190041.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8696109..8696446,8697221..8697367,8699021..8699060)
FT                   /codon_start=1
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, isoform CRA_c"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT190041.0
FT                   protein_id=mCP111048.0 isoform=CRA_c"
FT                   /protein_id="EDL08035.1"
FT                   /translation="FCPSWSRAMALPGDPRRLCRLVQEGRLRDLQEELAVARGCRGPAG
FT                   DTLLHCAARHGRQDILAYLVEAWSMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAV
FT                   VDSLKKADWTPLMMACTRKNLDVIQDLVEHGANPLLKNKDGWNSFHIASREGHPVILRN
FT                   ARLFGSSPGAS"
FT   CDS             join(8696133..8696446,8697221..8697441,8699021..8699063,
FT                   8701185..8701293,8701835..8701996,8703768..8703846,
FT                   8707279..8707436)
FT                   /codon_start=1
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, isoform CRA_d"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT9709.2
FT                   protein_id=mCP2342.2 isoform=CRA_d"
FT                   /protein_id="EDL08036.1"
FT                   /translation="MALPGDPRRLCRLVQEGRLRDLQEELAVARGCRGPAGDTLLHCAA
FT                   RHGRQDILAYLVEAWSMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAVVDSLKKAD
FT                   WTPLMMACTRKNLDVIQDLVEHGANPLLKNKDGWNSFHIASREGHPVILRYLLTVCPDA
FT                   WKTESNIRRTPLHTAAMHGCLEAVQVLLERCHYEPDCRDNCGVTPFMDAIQCGHVSIAK
FT                   LLLEQHKACSSAADSMGAQALHRAAVTGQDEAIRFLVCGLGIDVDVRAKSSQLTALHYA
FT                   AKEGQTNTVQTLLSLGADINSTDERNRSVLHLACAGQHVACTRLLLQSGLKDSEDLTGT
FT                   LAQQLTRSVDILQDFDHDVKS"
FT   CDS             join(8696133..8696446,8697221..8697441,8699021..8699063,
FT                   8701185..8701293,8701835..8701996,8702667..8702777)
FT                   /codon_start=1
FT                   /gene="Ankrd16"
FT                   /locus_tag="mCG_9568"
FT                   /product="ankyrin repeat domain 16, isoform CRA_a"
FT                   /note="gene_id=mCG9568.2 transcript_id=mCT173787.0
FT                   protein_id=mCP96706.0 isoform=CRA_a"
FT                   /protein_id="EDL08033.1"
FT                   /translation="MALPGDPRRLCRLVQEGRLRDLQEELAVARGCRGPAGDTLLHCAA
FT                   RHGRQDILAYLVEAWSMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAVVDSLKKAD
FT                   WTPLMMACTRKNLDVIQDLVEHGANPLLKNKDGWNSFHIASREGHPVILRYLLTVCPDA
FT                   WKTESNIRRTPLHTAAMHGCLEAVQVLLERCHYEPDCRDNCGVTPFMDAIQCGHVSIAK
FT                   LLLEQHKACSSAADSMGAQALHRAAVTGQDEAIRFLVCGLGIDVDVRAKSSQLTALHYA
FT                   AKSSNTHIRQLTTIYNSSSRGSVVSHPSWIHFSSATFA"
FT   gene            complement(8998106..8999776)
FT                   /pseudo
FT                   /locus_tag="mCG_9546"
FT                   /note="gene_id=mCG9546.2"
FT   mRNA            complement(8998106..8999776)
FT                   /pseudo
FT                   /locus_tag="mCG_9546"
FT                   /note="gene_id=mCG9546.2 transcript_id=mCT9291.2 created on
FT                   23-SEP-2002"
FT   gene            complement(9023700..9215576)
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /note="gene_id=mCG9547.1"
FT   mRNA            complement(join(9023700..9024974,9026748..9026870,
FT                   9035852..9035953,9069557..9069715,9074511..9074616,
FT                   9087613..9087693,9092104..9092183,9096119..9096211,
FT                   9102933..9103080,9104631..9104698,9105166..9105303,
FT                   9106872..9107026,9107839..9107894,9113535..9113642,
FT                   9118191..9118236,9143511..9143702,9146170..9146375,
FT                   9155906..9155958,9158642..9158698,9161006..9161049,
FT                   9163577..9163621,9166949..9167074,9169459..9169504,
FT                   9170665..9170726,9175554..9175677,9178731..9178831,
FT                   9214335..9214468,9215074..9215576))
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, transcript variant mCT9292"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT9292.2 created on
FT                   26-MAR-2003"
FT   mRNA            complement(join(9023700..9024974,9026748..9026870,
FT                   9035852..9035953,9054566..9054694,9069557..9069715,
FT                   9074511..9074616,9087613..9087693,9092104..9092183,
FT                   9096119..9096211,9102933..9103080,9104631..9104698,
FT                   9105166..9105303,9106872..9107026,9107839..9107894,
FT                   9113535..9113642,9118191..9118236,9143511..9143702,
FT                   9146170..9146375,9155906..9155958,9158642..9158698,
FT                   9161006..9161049,9163577..9163621,9166949..9167074,
FT                   9169459..9169504,9170665..9170726,9175554..9175677,
FT                   9178731..9178831,9214335..9214468,9215074..9215576))
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, transcript variant mCT114660"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT114660.1 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(9024338..9024974,9026748..9026870,
FT                   9035852..9035953,9046682..9046875,9069514..9069715,
FT                   9074511..9074616,9087613..9087693,9092104..9092183,
FT                   9096119..9096211,9102933..9103080,9104631..9104698,
FT                   9105166..9105303,9106872..9107026,9107839..9107894,
FT                   9113535..9113642,9118191..9118236,9143511..9143702,
FT                   9146170..9146375,9155906..9156008,9163577..9163621,
FT                   9166949..9167074,9169459..9169504,9170665..9170726,
FT                   9175554..9175677,9178731..9178831,9214335..9214468,
FT                   9215074..9215414))
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, transcript variant mCT181601"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT181601.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(9024888..9024974,9026748..9026870,
FT                   9035852..9035953,9046682..9046875,9069514..9069715,
FT                   9074511..9074616,9087613..9087693,9092104..9092183,
FT                   9096119..9096211,9102933..9103080,9104631..9104698,
FT                   9105166..9105303,9106872..9107026,9107839..9107894,
FT                   9113535..9113642,9118191..9118236,9143511..9143702,
FT                   9146170..9146375,9155906..9156008,9163577..9163621,
FT                   9166949..9167074,9169459..9169504,9170665..9170726,
FT                   9175554..9175677,9178731..9178831,9214335..9214468,
FT                   9215074..9215279))
FT                   /codon_start=1
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, isoform CRA_b"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT181601.0
FT                   protein_id=mCP104523.0 isoform=CRA_b"
FT                   /protein_id="EDL08038.1"
FT                   /translation="MSAGTHCGPPGNRAPPFARLCCVSAALGMLWSPACLAFNLDVDKL
FT                   TVYSGPEGSYFGYSLDFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQ
FT                   CKQIPFDTTNNRKIRVNGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPA
FT                   KDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFY
FT                   WQGQVITVSIADIIANYSFKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQ
FT                   GDYELGFLNTKSIIVLQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVG
FT                   QVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRG
FT                   KVLIYNGNPRGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGKG
FT                   KVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSVRVCASIAGQSISNT
FT                   IALLAEVQLDFLKQKGAIKRTLFLHNHQSHFTFPFVMKQQKSLHCQDFMVYLRDETEFR
FT                   DKLSPINISLNYSLDDSTFKDSLEVKPILNHYRDNVVTEQAHILVDCGEDNLCVPDLKL
FT                   SARPDKHQIIIGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERNNKGLRPLS
FT                   CEYKMENVTRMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPD
FT                   SNFERVQINITAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHKEEEVGPLVEHIYELHNI
FT                   GPSTISDSILDVGWPFSARDEFLLYIFHLQTLGPLQCQTNPEINPQDIKVGLQSKQWLD
FT                   LNCLESNVGFDSLLPFKALTLCLCLCLCVLQNCTNIDCLQISCAVGRLGGGESAVLKVR
FT                   SRLWAHTFLKRKNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFS
FT                   IPLWVIILAILLGLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA"
FT   CDS             complement(join(9024888..9024974,9026748..9026870,
FT                   9035852..9035953,9069557..9069715,9074511..9074616,
FT                   9087613..9087693,9092104..9092183,9096119..9096211,
FT                   9102933..9103080,9104631..9104698,9105166..9105303,
FT                   9106872..9107026,9107839..9107894,9113535..9113642,
FT                   9118191..9118236,9143511..9143702,9146170..9146375,
FT                   9155906..9155958,9158642..9158698,9161006..9161049,
FT                   9163577..9163621,9166949..9167074,9169459..9169504,
FT                   9170665..9170726,9175554..9175677,9178731..9178831,
FT                   9214335..9214468,9215074..9215279))
FT                   /codon_start=1
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, isoform CRA_c"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT9292.2
FT                   protein_id=mCP2343.2 isoform=CRA_c"
FT                   /protein_id="EDL08039.1"
FT                   /translation="MSAGTHCGPPGNRAPPFARLCCVSAALGMLWSPACLAFNLDVDKL
FT                   TVYSGPEGSYFGYSLDFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQ
FT                   CKQIPFDTTNNRKIRVNGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPA
FT                   KDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFY
FT                   WQGQVITVSIADIIANYSFKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQ
FT                   ELVAGIPRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVG
FT                   APLFMEREFESNPREVGQVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDG
FT                   YNDIAIGVPFAGKDQRGKVLIYNGNPRGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDAD
FT                   IDKNDYPDLLVGAFGKGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVAC
FT                   FSVRVCASIAGQSISNTIALLAEVQLDFLKQKGAIKRTLFLHNHQSHFTFPFVMKQQKS
FT                   LHCQDFMVYLRDETEFRDKLSPINISLNYSLDDSTFKDSLEVKPILNHYRDNVVTEQAH
FT                   ILVDCGEDNLCVPDLKLSARPDKHQIIIGDENHLMLIINARNEGEGAYEAELFVIIPEE
FT                   ADYVGIERNNKGLRPLSCEYKMENVTRMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNM
FT                   SINFDLQIRSSNKDNPDSNFERVQINITAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHK
FT                   EEEVGPLVEHIYELHNIGPSTISDSILDVGWPFSARDEFLLYIFHLQTLGPLQCQTNPE
FT                   INPQDIKRKNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFSIPL
FT                   WVIILAILLGLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA"
FT   CDS             complement(join(9024888..9024974,9026748..9026870,
FT                   9035852..9035953,9054566..9054694,9069557..9069715,
FT                   9074511..9074616,9087613..9087693,9092104..9092183,
FT                   9096119..9096211,9102933..9103080,9104631..9104698,
FT                   9105166..9105303,9106872..9107026,9107839..9107894,
FT                   9113535..9113642,9118191..9118236,9143511..9143702,
FT                   9146170..9146375,9155906..9155958,9158642..9158698,
FT                   9161006..9161049,9163577..9163621,9166949..9167074,
FT                   9169459..9169504,9170665..9170726,9175554..9175677,
FT                   9178731..9178831,9214335..9214468,9215074..9215279))
FT                   /codon_start=1
FT                   /gene="Itga8"
FT                   /locus_tag="mCG_9547"
FT                   /product="integrin alpha 8, isoform CRA_a"
FT                   /note="gene_id=mCG9547.1 transcript_id=mCT114660.1
FT                   protein_id=mCP50823.1 isoform=CRA_a"
FT                   /protein_id="EDL08037.1"
FT                   /translation="MSAGTHCGPPGNRAPPFARLCCVSAALGMLWSPACLAFNLDVDKL
FT                   TVYSGPEGSYFGYSLDFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQ
FT                   CKQIPFDTTNNRKIRVNGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPA
FT                   KDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFY
FT                   WQGQVITVSIADIIANYSFKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQ
FT                   ELVAGIPRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVG
FT                   APLFMEREFESNPREVGQVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDG
FT                   YNDIAIGVPFAGKDQRGKVLIYNGNPRGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDAD
FT                   IDKNDYPDLLVGAFGKGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVAC
FT                   FSVRVCASIAGQSISNTIALLAEVQLDFLKQKGAIKRTLFLHNHQSHFTFPFVMKQQKS
FT                   LHCQDFMVYLRDETEFRDKLSPINISLNYSLDDSTFKDSLEVKPILNHYRDNVVTEQAH
FT                   ILVDCGEDNLCVPDLKLSARPDKHQIIIGDENHLMLIINARNEGEGAYEAELFVIIPEE
FT                   ADYVGIERNNKGLRPLSCEYKMENVTRMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNM
FT                   SINFDLQIRSSNKDNPDSNFERVQINITAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHK
FT                   EEEVGPLVEHIYELHNIGPSTISDSILDVGWPFSARDEFLLYIFHLQTLGPLQCQTNPE
FT                   INPQDIKPAASPEDTPELSAFLRNATIPHLVRKRDVPVVQLHRQSPARILRKNDHYALA
FT                   SLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFSIPLWVIILAILLGLLVLAI
FT                   LTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA"
FT   gene            complement(9260745..>9332596)
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /note="gene_id=mCG55091.3"
FT   mRNA            complement(join(9260745..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9314569..9314620,
FT                   9317542..9317710,9319404..9319464,9323430..9323509,
FT                   9332302..>9332587))
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, transcript variant
FT                   mCT190082"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190082.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(9260747..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9317542..9317712,
FT                   9319404..9319464,9323430..9323509,9332302..>9332579))
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, transcript variant
FT                   mCT190083"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190083.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(9260754..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9314569..9314620,
FT                   9317542..9317712,9319404..9319464,9323430..9323509,
FT                   9332302..9332554))
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, transcript variant
FT                   mCT55274"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT55274.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(9261401..9261684,9268758..9268845,
FT                   9270386..9270458,9277928..9278000,9295647..9295727,
FT                   9300153..9300223,9309723..9309802,9311037..9311110,
FT                   9313567..9313681,9319404..9319464,9323430..9323509,
FT                   9332302..>9332596))
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, transcript variant
FT                   mCT190081"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190081.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(9261535..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9314569..9314620,
FT                   9317542..9317712,9319404..9319464,9323430..9323509,
FT                   9332302..9332395))
FT                   /codon_start=1
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, isoform CRA_d"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT55274.2
FT                   protein_id=mCP25341.2 isoform=CRA_d"
FT                   /protein_id="EDL08043.1"
FT                   /translation="MSEVTKELLELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQ
FT                   FEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDIVESAYDSSGSY
FT                   CLVSWLRGRTPEEAARISGSPAQSSCQVEHSSALAVEELGFERFHALIQKRSFRTVSEL
FT                   KDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINL
FT                   LLTGHAVSNVWDGDRECSGMQLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIV
FT                   GSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIADSLLEDVMKALDLVSDP
FT                   EYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYV
FT                   EGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRCPSLN"
FT   CDS             complement(join(9261535..9261684,9268758..9268845,
FT                   9270386..9270458,9277928..9278000,9295647..9295727,
FT                   9300153..9300223,9309723..9309802,9311037..9311110,
FT                   9313567..9313681,9319404..9319464,9323430..>9323463))
FT                   /codon_start=1
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, isoform CRA_a"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190081.0
FT                   protein_id=mCP111034.0 isoform=CRA_a"
FT                   /protein_id="EDL08040.1"
FT                   /translation="RWPLCCYCTCPGVSFEEASVLLREVVLAGLLRKRSFRTVSELKDA
FT                   VLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINLLLT
FT                   GHAVSNVWDGDRECSGMQLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSE
FT                   THLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIADSLLEDVMKALDLVSDPEYI
FT                   NLMKNKLDPEGLGIILLGPFLQEFFPDQVMYVEGTAVVMGFEDPMLQTDDTPIKRCLQT
FT                   KWPYIELLWTTDRCPSLN"
FT   CDS             complement(join(9261535..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9314569..9314620,
FT                   9317542..9317710,9319404..>9319451))
FT                   /codon_start=1
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, isoform CRA_b"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190082.0
FT                   protein_id=mCP111035.0 isoform=CRA_b"
FT                   /protein_id="EDL08041.1"
FT                   /translation="RSFCSPPRSRPGGIAQEEQKELLCHTLCDIVESAYDSSGSYCLVS
FT                   WLRGRTPEEAARISGSPAQSSCQVEHSSALAVEELGFERFHALIQKRSFRTVSELKDAV
FT                   LDQYSMWGNKFGVLLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINLLLTG
FT                   HAVSNVWDGDRECSGMQLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSET
FT                   HLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIADSLLEDVMKALDLVSDPEYIN
FT                   LMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTA
FT                   VVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRCPSLN"
FT   CDS             complement(join(9261535..9261684,9264410..9264481,
FT                   9268758..9268845,9270386..9270458,9277928..9278000,
FT                   9295647..9295727,9300153..9300223,9309723..9309802,
FT                   9311037..9311110,9313567..9313681,9317542..>9317561))
FT                   /codon_start=1
FT                   /gene="2310047O13Rik"
FT                   /locus_tag="mCG_55091"
FT                   /product="RIKEN cDNA 2310047O13, isoform CRA_c"
FT                   /note="gene_id=mCG55091.3 transcript_id=mCT190083.0
FT                   protein_id=mCP111036.0 isoform=CRA_c"
FT                   /protein_id="EDL08042.1"
FT                   /translation="LPSGTFLKRSFRTVSELKDAVLDQYSMWGNKFGVLLFLYSVLLTK
FT                   GIENIKNSIEDANEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMQLLGIHEQ
FT                   AAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARR
FT                   VFQTYDPEDNGFIADSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFF
FT                   PDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTPIKRCLQTK
FT                   WPYIELLWTTDRCPSLN"
FT   gene            <9835576..9913267
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /note="gene_id=mCG15701.3"
FT   mRNA            join(<9835576..9835674,9889886..9890343,9892019..9892284,
FT                   9906399..9906469,9912506..9913260)
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, transcript variant
FT                   mCT190058"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT190058.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(9835577..9835674,9886095..9886179,9889886..9890343,
FT                   9892019..9892284,9906399..9906539,9912506..9913267)
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, transcript variant
FT                   mCT173524"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT173524.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(9835600..9835674,9889886..9890343,9892019..9892284,
FT                   9906399..9906539,9912506..9913262)
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, transcript variant
FT                   mCT19409"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT19409.1 created
FT                   on 20-SEP-2002"
FT   CDS             join(<9835629..9835674,9889886..9890343,9892019..9892284,
FT                   9906399..9906469,9912506..9912519)
FT                   /codon_start=1
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, isoform CRA_b"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT190058.0
FT                   protein_id=mCP111073.0 isoform=CRA_b"
FT                   /protein_id="EDL08045.1"
FT                   /translation="RKPRSWLSSCGPGRKEKIPETLSGMSSLSGKVQTVLGLVEPSQLG
FT                   RTLTHEHLTMTFDSFYCPPPPCHEVTSKEPIMMKNLFWIQKNPYSHRENLQLNQEVGAI
FT                   REELLYFKAKGGGALVENTTTGLSRDVHTLKWLAEQTGVHIIAGAGFYVDATHSAATRA
FT                   MSVEQLTDVLINEILHGADGTSIKCGVIGEIGCSWPLTDSERKILEATAHAQAQLGCPV
FT                   IIHPGRNPGAPFQIIRILQEAGADISKTVMSHLDRTIFDKKELLEFAQLGCYLEYDLFG
FT                   SIF"
FT   CDS             join(9886170..9886179,9889886..9890343,9892019..9892284,
FT                   9906399..9906539,9912506..9912716)
FT                   /codon_start=1
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, isoform CRA_a"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT173524.0
FT                   protein_id=mCP96443.0 isoform=CRA_a"
FT                   /protein_id="EDL08044.1"
FT                   /translation="MSSKKIPETLSGMSSLSGKVQTVLGLVEPSQLGRTLTHEHLTMTF
FT                   DSFYCPPPPCHEVTSKEPIMMKNLFWIQKNPYSHRENLQLNQEVGAIREELLYFKAKGG
FT                   GALVENTTTGLSRDVHTLKWLAEQTGVHIIAGAGFYVDATHSAATRAMSVEQLTDVLIN
FT                   EILHGADGTSIKCGVIGEIGCSWPLTDSERKILEATAHAQAQLGCPVIIHPGRNPGAPF
FT                   QIIRILQEAGADISKTVMSHLDRTIFDKKELLEFAQLGCYLEYDLFGTELLNYQLSPDI
FT                   DMPDDNKRIRRVHFLVDEGYEDRILMAHDIHTKHRLMKYGGHGYSHILTNIVPKMLLRG
FT                   LTERVLDKILIENPKQWLTFK"
FT   CDS             join(9889912..9890343,9892019..9892284,9906399..9906539,
FT                   9912506..9912716)
FT                   /codon_start=1
FT                   /gene="Pter"
FT                   /locus_tag="mCG_15701"
FT                   /product="phosphotriesterase related, isoform CRA_c"
FT                   /note="gene_id=mCG15701.3 transcript_id=mCT19409.1
FT                   protein_id=mCP2331.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q60866"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="MGI:MGI:107372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60866"
FT                   /protein_id="EDL08046.1"
FT                   /translation="MSSLSGKVQTVLGLVEPSQLGRTLTHEHLTMTFDSFYCPPPPCHE
FT                   VTSKEPIMMKNLFWIQKNPYSHRENLQLNQEVGAIREELLYFKAKGGGALVENTTTGLS
FT                   RDVHTLKWLAEQTGVHIIAGAGFYVDATHSAATRAMSVEQLTDVLINEILHGADGTSIK
FT                   CGVIGEIGCSWPLTDSERKILEATAHAQAQLGCPVIIHPGRNPGAPFQIIRILQEAGAD
FT                   ISKTVMSHLDRTIFDKKELLEFAQLGCYLEYDLFGTELLNYQLSPDIDMPDDNKRIRRV
FT                   HFLVDEGYEDRILMAHDIHTKHRLMKYGGHGYSHILTNIVPKMLLRGLTERVLDKILIE
FT                   NPKQWLTFK"
FT   gene            complement(9913254..9923463)
FT                   /gene="C1ql3"
FT                   /locus_tag="mCG_50470"
FT                   /note="gene_id=mCG50470.1"
FT   mRNA            complement(join(9913254..9916093,9921909..9923463))
FT                   /gene="C1ql3"
FT                   /locus_tag="mCG_50470"
FT                   /product="C1q-like 3"
FT                   /note="gene_id=mCG50470.1 transcript_id=mCT50653.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(9915914..9916093,9921909..9922496))
FT                   /codon_start=1
FT                   /gene="C1ql3"
FT                   /locus_tag="mCG_50470"
FT                   /product="C1q-like 3"
FT                   /note="gene_id=mCG50470.1 transcript_id=mCT50653.2
FT                   protein_id=mCP25379.2"
FT                   /db_xref="GOA:Q9ESN4"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:2387350"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESN4"
FT                   /protein_id="EDL08047.1"
FT                   /translation="MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAA
FT                   TPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGP
FT                   PGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKF
FT                   TCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLE
FT                   PGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD"
FT   gene            complement(9987302..10181275)
FT                   /gene="Rsu1"
FT                   /locus_tag="mCG_15700"
FT                   /note="gene_id=mCG15700.3"
FT   mRNA            complement(join(9987302..9987941,10079675..10079807,
FT                   10126654..10126768,10127073..10127155,10128893..10129011,
FT                   10134189..10134309,10180792..10180903,10181081..10181275))
FT                   /gene="Rsu1"
FT                   /locus_tag="mCG_15700"
FT                   /product="Ras suppressor protein 1, transcript variant
FT                   mCT173770"
FT                   /note="gene_id=mCG15700.3 transcript_id=mCT173770.1 created
FT                   on 30-NOV-2004"
FT   mRNA            complement(join(9987302..9987941,10079675..10079807,
FT                   10126654..10126768,10127073..10127155,10128893..10129011,
FT                   10134189..10134309,10151625..10151675,10180792..10180903,
FT                   10181081..10181275))
FT                   /gene="Rsu1"
FT                   /locus_tag="mCG_15700"
FT                   /product="Ras suppressor protein 1, transcript variant
FT                   mCT19408"
FT                   /note="gene_id=mCG15700.3 transcript_id=mCT19408.3 created
FT                   on 30-NOV-2004"
FT   CDS             complement(join(9987839..9987941,10079675..10079807,
FT                   10126654..10126768,10127073..10127155,10128893..10129011,
FT                   10134189..10134309,10180792..10180900))
FT                   /codon_start=1
FT                   /gene="Rsu1"
FT                   /locus_tag="mCG_15700"
FT                   /product="Ras suppressor protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG15700.3 transcript_id=mCT173770.1
FT                   protein_id=mCP96689.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AUR7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="MGI:MGI:103040"
FT                   /db_xref="UniProtKB/TrEMBL:A2AUR7"
FT                   /protein_id="EDL08048.1"
FT                   /translation="MSKSLKKLVEESREKNQPEVDMSDRGISSMLDVNGLSVPPNVAEL
FT                   KNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNL
FT                   NEHSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
FT                   QLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRS
FT                   ETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNK"
FT   CDS             complement(join(9987839..9987941,10079675..10079807,
FT                   10126654..10126768,10127073..10127155,10128893..10129011,
FT                   10134189..10134309,10151625..10151675,10180792..10180900))
FT                   /codon_start=1
FT                   /gene="Rsu1"
FT                   /locus_tag="mCG_15700"
FT                   /product="Ras suppressor protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG15700.3 transcript_id=mCT19408.3
FT                   protein_id=mCP2307.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D031"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="MGI:MGI:103040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D031"
FT                   /protein_id="EDL08049.1"
FT                   /translation="MSKSLKKLVEESREKNQPEVDMSDRGISSMLDVNGLFSLAHITQL
FT                   VLSHNKLTTVPPNVAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRG
FT                   FGSLPALEVLDLTYNNLNEHSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILS
FT                   LRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPI
FT                   ADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNK"
FT   gene            <10181481..10235720
FT                   /locus_tag="mCG_146087"
FT                   /note="gene_id=mCG146087.0"
FT   mRNA            join(<10181481..10181593,10218666..10218754,
FT                   10229748..10230049,10234538..10235720)
FT                   /locus_tag="mCG_146087"
FT                   /product="mCG146087"
FT                   /note="gene_id=mCG146087.0 transcript_id=mCT186190.0
FT                   created on 14-JUL-2003"
FT   gene            complement(10186216..10402177)
FT                   /locus_tag="mCG_113993"
FT                   /note="gene_id=mCG113993.0"
FT   mRNA            complement(join(10186216..10186488,10186692..10186716,
FT                   10188243..10188478,10189957..10190122,10192796..10192977,
FT                   10193872..10194019,10196872..10197077,10197436..10197598,
FT                   10204091..10204299,10216152..10216369,10218415..10218544,
FT                   10220408..10220608,10223875..10224024,10224546..10224702,
FT                   10228050..10228237,10229683..10229908,10231062..10231183,
FT                   10232844..10232993,10235050..10235256,10236549..10236720,
FT                   10241374..10241555,10242206..10242346,10243238..10243447,
FT                   10244667..10244845,10245980..10246154,10249715..10249898,
FT                   10250034..10250224,10252327..10252473,10257415..10257612,
FT                   10257892..10258084,10259743..10259927,10260764..10260969,
FT                   10265463..10265595,10266479..10266607,10268014..10268124,
FT                   10270152..10270265,10291987..10292156,10294099..10294273,
FT                   10299004..10299185,10314122..10314272,10334817..10335004,
FT                   10337097..10337253,10337982..10338163,10338753..10338913,
FT                   10340960..10341149,10350560..10350690,10354393..10354609,
FT                   10355059..10355224,10356106..10356284,10357084..10357228,
FT                   10365487..10365677,10366743..10366905,10369084..10369265,
FT                   10375986..10376220,10377781..10377893,10378885..10379071,
FT                   10379933..10380054,10383569..10383670,10386208..10386339,
FT                   10388231..10388393,10389241..10389367,10396297..10396400,
FT                   10397005..10397106,10399573..10399611,10400152..10400247,
FT                   10401435..10401564,10401955..10402177))
FT                   /locus_tag="mCG_113993"
FT                   /product="mCG113993"
FT                   /note="gene_id=mCG113993.0 transcript_id=mCT115083.1
FT                   created on 23-SEP-2002"
FT   CDS             join(<10229864..10230049,10234538..10234567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146087"
FT                   /product="mCG146087"
FT                   /note="gene_id=mCG146087.0 transcript_id=mCT186190.0
FT                   protein_id=mCP107422.0"
FT                   /protein_id="EDL08050.1"
FT                   /translation="RASWMVLHTKVTKCELQKRKGMMSPHELKRSHPKRSHPKRSHPKR
FT                   SHPASRQQVFYRRFDFLEKLGSSVMP"
FT   CDS             complement(join(10270170..10270265,10291987..10292156,
FT                   10294099..10294273,10299004..10299185,10314122..10314272,
FT                   10334817..10335004,10337097..10337253,10337982..10338163,
FT                   10338753..10338913,10340960..10341149,10350560..10350690,
FT                   10354393..10354609,10355059..10355224,10356106..10356284,
FT                   10357084..10357228,10365487..10365677,10366743..10366905,
FT                   10369084..10369265,10375986..10376220,10377781..10377893,
FT                   10378885..10379071,10379933..10380054,10383569..10383670,
FT                   10386208..10386339,10388231..10388393,10389241..10389367,
FT                   10396297..10396400,10397005..10397106,10399573..10399611,
FT                   10400152..10400247,10401435..10401564,10401955..10402067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113993"
FT                   /product="mCG113993"
FT                   /note="gene_id=mCG113993.0 transcript_id=mCT115083.1
FT                   protein_id=mCP51133.1"
FT                   /protein_id="EDL08051.1"
FT                   /translation="MASHFLWGFVTLLMVPGLDGETGTPEQKLQKRIADLHQPRMTTEE
FT                   GNLVFLTSSAQNIEFRTGSLGKIKLNDDDLGECLHQIQRNKDDIIDLKRNTTGLPQNIL
FT                   SQVHQLNSKLVDLERDFQSLQQNVERKVCSSNPCHNGGTCVNLHDSFICICPSQWKGLF
FT                   CSEDVNECVLYAGTPFGCQSGSTCVNTMGSFRCDCTPDTYGPQCASKYNDCEQGSQQLC
FT                   KHGICEDLQRVYHGQLRFNCICDAGWTTLPNGISCTEDKDECSLQPSPCSEHAQCFNTQ
FT                   GSFYCGACPKGWQGNGYQCQDINECEINNGGCSQAPLVPCLNTPGSFTCGNCPAGFSGD
FT                   GRVCTPLDICSIHNGGCHPDATCSSSSVLGSLLPVCTCPPGYTGNGYGSNGCVRLSNMC
FT                   SRHPCVNGQCIETVSSYFCKCDSGWFGQNCTENINECVSNPCLNGGTCIDGVNGFTCDC
FT                   TSSWTGYYCQTPQAACGGILSGTQGTFAYQSPNDTYVHNVNCFWVVRTDEEKVLHITFT
FT                   FFDLESASNCPREYLQIHDGDSSADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRG
FT                   RGFTARWEAKLPECGGILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTL
FT                   SLESHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKG
FT                   FHITYLTTPSDLYCGGNYTDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHV
FT                   ELESQRGCSHTFIEVGDHESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRAD
FT                   YQVACGGELRGEGVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDT
FT                   DYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSEKL
FT                   ECGKVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDY
FT                   LEVYDTIAQTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAINASSVC
FT                   LYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCVDFV
FT                   EIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFSAYWDASSTGCG
FT                   GNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAV
FT                   FDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQTCDNVVIV
FT                   NKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVENYVNCSTDYLELYDG
FT                   PQRIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEKGFKMHWFIHGCGGEMSGTMGSF
FT                   SSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVEYHASCKYDTLEIYTGLDFHSPR
FT                   IAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASWRAVPGGCGGIFQVSRGE
FT                   IHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDLEATDSCLMSAEPTSLLTLQIAS
FT                   PLHCTQPTIQTTRTVPG"
FT   gene            complement(10421223..10454776)
FT                   /gene="Dnmt2"
FT                   /locus_tag="mCG_15707"
FT                   /note="gene_id=mCG15707.1"
FT   mRNA            complement(join(10421223..10421819,10426142..10426271,
FT                   10426786..10426843,10429883..10430226,10431390..10431473,
FT                   10432205..10432274,10432951..10433016,10433553..10433624,
FT                   10435745..10435821,10443511..10443620,10454694..10454776))
FT                   /gene="Dnmt2"
FT                   /locus_tag="mCG_15707"
FT                   /product="DNA methyltransferase 2"
FT                   /note="gene_id=mCG15707.1 transcript_id=mCT19441.0 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(10421647..10421819,10426142..10426271,
FT                   10426786..10426843,10429883..10430226,10431390..10431473,
FT                   10432205..10432274,10432951..10433016,10433553..10433624,
FT                   10435745..10435821,10443511..10443620,10454694..10454757))
FT                   /codon_start=1
FT                   /gene="Dnmt2"
FT                   /locus_tag="mCG_15707"
FT                   /product="DNA methyltransferase 2"
FT                   /note="gene_id=mCG15707.1 transcript_id=mCT19441.0
FT                   protein_id=mCP2357.1"
FT                   /db_xref="GOA:Q5I0V6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1274787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5I0V6"
FT                   /protein_id="EDL08052.1"
FT                   /translation="MEPLRVLELYSGIGGMHHALRESHIPAHVVAAIDVNTVANEVYKH
FT                   NFPHTHLLSKTIEGISLEDFDKLSFNMILMSPPCQPFTRIGLQGDMTDPRTTSFLYILD
FT                   ILPRLQKLPKYILLENVKGFEVSSTRGLLIQTIEACGFQYQEFLLSPSSLGIPNSRLRY
FT                   FLIAKLQSEPFPFQAPGQILMEFPKIVTVEPQKYAVVEESQPRVQRTGPRICAESSSTQ
FT                   SSGKDTILFKLETVEERDRKHQQDSDLSVQMLKDFLEDGDTDEYLLPPKLLLRYALLLD
FT                   IVKPTSRRSMCFTKGYGSYIEGTGSVLQAAEDAQIENIYKSLPDLPPEEKIAKLSMLKL
FT                   RYFTPKEIANLQGFPPEFGFPEKTTVKQRYRLLGNSLNVHVVAKLLTVLCEGFGNASES
FT                   CHKMPLILDSNSKILS"
FT   gene            10484840..10493270
FT                   /gene="Vim"
FT                   /locus_tag="mCG_15706"
FT                   /note="gene_id=mCG15706.1"
FT   mRNA            join(10484840..10485486,10486033..10486093,
FT                   10488905..10489000,10489081..10489242,10489915..10490040,
FT                   10490512..10490732,10491134..10491177,10492107..10492192,
FT                   10492967..10493270)
FT                   /gene="Vim"
FT                   /locus_tag="mCG_15706"
FT                   /product="vimentin, transcript variant mCT19440"
FT                   /note="gene_id=mCG15706.1 transcript_id=mCT19440.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(10484876..10485486,10486033..10486093,
FT                   10488905..10489000,10489081..10489242,10489915..10490040,
FT                   10490512..10490549,10491134..10491177,10492107..10492192,
FT                   10492967..10493246)
FT                   /gene="Vim"
FT                   /locus_tag="mCG_15706"
FT                   /product="vimentin, transcript variant mCT173525"
FT                   /note="gene_id=mCG15706.1 transcript_id=mCT173525.0 created
FT                   on 20-SEP-2002"
FT   CDS             join(10484924..10485486,10486033..10486093,
FT                   10488905..10489000,10489081..10489242,10489915..10490040,
FT                   10490512..10490732,10491134..10491177,10492107..10492192,
FT                   10492967..10493008)
FT                   /codon_start=1
FT                   /gene="Vim"
FT                   /locus_tag="mCG_15706"
FT                   /product="vimentin, isoform CRA_b"
FT                   /note="gene_id=mCG15706.1 transcript_id=mCT19440.0
FT                   protein_id=mCP2334.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5FWJ3"
FT                   /db_xref="InterPro:IPR001664"
FT                   /db_xref="InterPro:IPR006821"
FT                   /db_xref="InterPro:IPR018039"
FT                   /db_xref="InterPro:IPR027699"
FT                   /db_xref="MGI:MGI:98932"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FWJ3"
FT                   /protein_id="EDL08054.1"
FT                   /translation="MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALR
FT                   PSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEK
FT                   VELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQ
FT                   LTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLER
FT                   KVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAA
FT                   KNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESL
FT                   ERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIAT
FT                   YRKLLEGEESRISLPLPTFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINET
FT                   SQHHDDLE"
FT   CDS             join(10484924..10485486,10486033..10486093,
FT                   10488905..10489000,10489081..10489242,10489915..10490040,
FT                   10490512..10490549,10491134..10491177,10492107..10492192,
FT                   10492967..10493008)
FT                   /codon_start=1
FT                   /gene="Vim"
FT                   /locus_tag="mCG_15706"
FT                   /product="vimentin, isoform CRA_a"
FT                   /note="gene_id=mCG15706.1 transcript_id=mCT173525.0
FT                   protein_id=mCP96444.0 isoform=CRA_a"
FT                   /protein_id="EDL08053.1"
FT                   /translation="MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALR
FT                   PSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEK
FT                   VELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQ
FT                   LTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLER
FT                   KVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAA
FT                   KNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESL
FT                   ERQMREMEEISLPLPTFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQ
FT                   HHDDLE"
FT   gene            complement(10564431..10699691)
FT                   /gene="St8sia6"
FT                   /locus_tag="mCG_113994"
FT                   /note="gene_id=mCG113994.0"
FT   mRNA            complement(join(10564431..10565875,10573250..10573342,
FT                   10575123..10575235,10578821..10578965,10603076..10603162,
FT                   10629683..10629772,10698483..10698581,10699073..10699691))
FT                   /gene="St8sia6"
FT                   /locus_tag="mCG_113994"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 6, transcript variant
FT                   mCT115084"
FT                   /note="gene_id=mCG113994.0 transcript_id=mCT115084.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(10565407..10565875,10573250..10573342,
FT                   10575123..10575235,10578821..10578965,10603076..10603162,
FT                   10629683..10629772,10698483..10698581,10699073..10699173))
FT                   /codon_start=1
FT                   /gene="St8sia6"
FT                   /locus_tag="mCG_113994"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 6, isoform CRA_b"
FT                   /note="gene_id=mCG113994.0 transcript_id=mCT115084.1
FT                   protein_id=mCP51248.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q148N5"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:2386797"
FT                   /db_xref="UniProtKB/TrEMBL:Q148N5"
FT                   /protein_id="EDL08056.1"
FT                   /translation="MRSGGTLFALIGSLMLLLLLRMLWCPADAPARSRLLMEGSREDTS
FT                   GTSAALKTLWSPTTPVPRTRNSTYLDEKTTQITEKCKDLQYSLNSLSNKTRRYSEDDYL
FT                   QTITNIQRCPWNRQAEEYDNFRAKLASCCDAIQDFVVSQNNTPVGTNMSYEVESKKHIP
FT                   IRENIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGAEIDKSDFVFRCNLPPITGSA
FT                   SKDVGSKTNLVTVNPSIITLKYQNLKEKKAQFLEDISTYGDAFLLLPAFSYRANTGISF
FT                   KVYQTLKESKMRQKVLFFHPRYLRHLALFWRTKGVTAYRLSTGLMIASVAVELCENVKL
FT                   YGFWPFSKTIEDTPLSHHYYDNMLPKHGFHQMPKEYSQMLQLHMRGILKLQFSKCETA"
FT   mRNA            complement(join(<10565738..10565875,10573250..10573342,
FT                   10575123..10575235,10578821..10578965,10603076..10603162,
FT                   10629683..10629772,10698483..10698581,10698977..>10699022))
FT                   /gene="St8sia6"
FT                   /locus_tag="mCG_113994"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 6, transcript variant
FT                   mCT190157"
FT                   /note="gene_id=mCG113994.0 transcript_id=mCT190157.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<10565738..10565875,10573250..10573342,
FT                   10575123..10575235,10578821..10578965,10603076..10603162,
FT                   10629683..10629772,10698483..10698581,10698977..>10699020))
FT                   /codon_start=1
FT                   /gene="St8sia6"
FT                   /locus_tag="mCG_113994"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 6, isoform CRA_a"
FT                   /note="gene_id=mCG113994.0 transcript_id=mCT190157.0
FT                   protein_id=mCP111136.0 isoform=CRA_a"
FT                   /protein_id="EDL08055.1"
FT                   /translation="CALGVASRGRPERSGLLMEGSREDTSGTSAALKTLWSPTTPVPRT
FT                   RNSTYLDEKTTQITEKCKDLQYSLNSLSNKTRRYSEDDYLQTITNIQRCPWNRQAEEYD
FT                   NFRAKLASCCDAIQDFVVSQNNTPVGTNMSYEVESKKHIPIRENIFHMFPVSQPFVDYP
FT                   YNQCAVVGNGGILNKSLCGAEIDKSDFVFRCNLPPITGSASKDVGSKTNLVTVNPSIIT
FT                   LKYQNLKEKKAQFLEDISTYGDAFLLLPAFSYRANTGISFKVYQTLK"
FT   gene            complement(10931648..10960710)
FT                   /locus_tag="mCG_14195"
FT                   /note="gene_id=mCG14195.3"
FT   mRNA            complement(join(10931648..10931748,10940589..10940767,
FT                   10949436..10949524,10949601..10949619,10949791..10949908,
FT                   10960384..10960604,10960625..10960710))
FT                   /locus_tag="mCG_14195"
FT                   /product="mCG14195, transcript variant mCT173768"
FT                   /note="gene_id=mCG14195.3 transcript_id=mCT173768.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(10931648..10931748,10940589..10940767,
FT                   10945687..10945808,10949436..10949524,10949601..10949619,
FT                   10949791..10949908,10960384..10960604,10960625..10960710))
FT                   /locus_tag="mCG_14195"
FT                   /product="mCG14195, transcript variant mCT14335"
FT                   /note="gene_id=mCG14195.3 transcript_id=mCT14335.3 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(10931666..10931748,10940589..10940767,
FT                   10945687..10945808,10949436..10949524,10949601..10949619,
FT                   10949791..10949908,10960384..10960520))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14195"
FT                   /product="mCG14195, isoform CRA_b"
FT                   /note="gene_id=mCG14195.3 transcript_id=mCT14335.3
FT                   protein_id=mCP2366.2 isoform=CRA_b"
FT                   /db_xref="GOA:B9EHK9"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="MGI:MGI:1353592"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHK9"
FT                   /protein_id="EDL08058.1"
FT                   /translation="MASSEEDGTNGASEASDEKEAAGKRRRLGLLATAWLTFYNIAMTA
FT                   GWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQ
FT                   VSSRIFMVWLITHSIKPIQNEESVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARY
FT                   NLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPL
FT                   FPQLYFHMLRQRRKVLHGEVIAEKDD"
FT   CDS             complement(join(10940633..10940767,10949436..10949524,
FT                   10949601..10949619,10949791..10949908,10960384..10960520))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14195"
FT                   /product="mCG14195, isoform CRA_a"
FT                   /note="gene_id=mCG14195.3 transcript_id=mCT173768.1
FT                   protein_id=mCP96687.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AQ81"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="MGI:MGI:1353592"
FT                   /db_xref="UniProtKB/TrEMBL:A2AQ81"
FT                   /protein_id="EDL08057.1"
FT                   /translation="MASSEEDGTNGASEASDEKEAAGKRRRLGLLATAWLTFYNIAMTA
FT                   GWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQ
FT                   VSSRIFMVWLITHSIKPIQFVYHLISRWSCWGTSHNIRRLALRKEVRNVLSTASQQVQC
FT                   FF"
FT   gene            <10961536..10962071
FT                   /locus_tag="mCG_1030069"
FT                   /note="gene_id=mCG1030069.1"
FT   mRNA            <10961536..10962071
FT                   /locus_tag="mCG_1030069"
FT                   /product="mCG1030069"
FT                   /note="gene_id=mCG1030069.1 transcript_id=mCT147773.1
FT                   created on 04-OCT-2002"
FT   CDS             <10961536..10961685
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030069"
FT                   /product="mCG1030069"
FT                   /note="gene_id=mCG1030069.1 transcript_id=mCT147773.1
FT                   protein_id=mCP51082.1"
FT                   /protein_id="EDL08059.1"
FT                   /translation="RKTFCKGQHCQRGEMTIGLSMNSPGCAHCCGCEMGGLPVQFQKCQ
FT                   GKWG"
FT   gene            complement(10975003..>10978319)
FT                   /locus_tag="mCG_1029975"
FT                   /note="gene_id=mCG1029975.0"
FT   mRNA            complement(join(10975003..10975451,10978254..>10978319))
FT                   /locus_tag="mCG_1029975"
FT                   /product="mCG1029975"
FT                   /note="gene_id=mCG1029975.0 transcript_id=mCT147679.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(10975095..10975451,10978254..>10978319))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029975"
FT                   /product="mCG1029975"
FT                   /note="gene_id=mCG1029975.0 transcript_id=mCT147679.0
FT                   protein_id=mCP50904.0"
FT                   /protein_id="EDL08060.1"
FT                   /translation="AGGAGLNPLEGVSRRTASREAEHQQDYYSDWDHYSSFSIFNKVAQ
FT                   SLSGNGCWKLAESLGLSAAPTAQNMLCIGLASPSILNGHKSERFKRQENASHSLNCGPG
FT                   SGERVTSIILYCSHNDFQQIGVEGMFKSYHNIGPNV"
FT   gene            10978516..11050719
FT                   /gene="Stam"
FT                   /locus_tag="mCG_141172"
FT                   /note="gene_id=mCG141172.0"
FT   mRNA            join(10978516..10979007,11005375..11005459,
FT                   11018791..11018866,11018952..11019047,11020363..11020509,
FT                   11031703..11031793,11032136..11032328,11034181..11034275,
FT                   11037510..11037598,11040644..11040731,11041293..11041347,
FT                   11042113..11042266,11044883..11045058,11049400..11050719)
FT                   /gene="Stam"
FT                   /locus_tag="mCG_141172"
FT                   /product="signal transducing adaptor molecule (SH3 domain
FT                   and ITAM motif) 1, transcript variant mCT173523"
FT                   /note="gene_id=mCG141172.0 transcript_id=mCT173523.0
FT                   created on 20-SEP-2002"
FT   mRNA            join(<10978859..10979007,11005375..11005459,
FT                   11018791..11018866,11018952..11019047,11020363..11020509,
FT                   11031703..11031793,11032136..11032328,11034181..11034275,
FT                   11037510..11037598,11040644..11040731,11041293..11041347,
FT                   11042113..11042266,11044883..11045882)
FT                   /gene="Stam"
FT                   /locus_tag="mCG_141172"
FT                   /product="signal transducing adaptor molecule (SH3 domain
FT                   and ITAM motif) 1, transcript variant mCT190133"
FT                   /note="gene_id=mCG141172.0 transcript_id=mCT190133.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<10978860..10979007,11005375..11005459,
FT                   11018791..11018866,11018952..11019047,11020363..11020509,
FT                   11031703..11031793,11032136..11032328,11034181..11034275,
FT                   11037510..11037598,11040644..11040731,11041293..11041347,
FT                   11042113..11042266,11044883..11045062)
FT                   /codon_start=1
FT                   /gene="Stam"
FT                   /locus_tag="mCG_141172"
FT                   /product="signal transducing adaptor molecule (SH3 domain
FT                   and ITAM motif) 1, isoform CRA_a"
FT                   /note="gene_id=mCG141172.0 transcript_id=mCT190133.0
FT                   protein_id=mCP111092.0 isoform=CRA_a"
FT                   /protein_id="EDL08061.1"
FT                   /translation="QAPLLCLYLRGLLSPSPLECRGVEGQSPGTPRHAADMPLFATNPF
FT                   DQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTL
FT                   LGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSL
FT                   ISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIELSLKE
FT                   QRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLDDSDP
FT                   NWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPAFIDE
FT                   DKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVK
FT                   VMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSAQM
FT                   THLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPK"
FT   CDS             join(10978968..10979007,11005375..11005459,
FT                   11018791..11018866,11018952..11019047,11020363..11020509,
FT                   11031703..11031793,11032136..11032328,11034181..11034275,
FT                   11037510..11037598,11040644..11040731,11041293..11041347,
FT                   11042113..11042266,11044883..11045058,11049400..11049661)
FT                   /codon_start=1
FT                   /gene="Stam"
FT                   /locus_tag="mCG_141172"
FT                   /product="signal transducing adaptor molecule (SH3 domain
FT                   and ITAM motif) 1, isoform CRA_b"
FT                   /note="gene_id=mCG141172.0 transcript_id=mCT173523.0
FT                   protein_id=mCP96442.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TQ49"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR018205"
FT                   /db_xref="MGI:MGI:1329014"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ49"
FT                   /protein_id="EDL08062.1"
FT                   /translation="MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKD
FT                   CLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKV
FT                   CEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKD
FT                   PGTVATKKEEEDLAKAIELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFE
FT                   AAEDNELTFKAGEIITVLDDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKT
FT                   VQFNDDVQIETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMG
FT                   PLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAV
FT                   SASQVYPGPAQSGTYLVAGSAQMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQA
FT                   SYPNAMVSSVQGNSYPSQASIYSPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVP
FT                   NYTLTSSTLPQTGGSQQPPQPQQAYSQKALL"
FT   gene            <11077767..>11099209
FT                   /locus_tag="mCG_141176"
FT                   /note="gene_id=mCG141176.0"
FT   mRNA            join(<11077767..11078017,11095371..11095443,
FT                   11099068..>11099209)
FT                   /locus_tag="mCG_141176"
FT                   /product="mCG141176"
FT                   /note="gene_id=mCG141176.0 transcript_id=mCT173539.0
FT                   created on 20-SEP-2002"
FT   CDS             join(11077767..11078017,11095371..11095443,
FT                   11099068..>11099209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141176"
FT                   /product="mCG141176"
FT                   /note="gene_id=mCG141176.0 transcript_id=mCT173539.0
FT                   protein_id=mCP96458.0"
FT                   /protein_id="EDL08063.1"
FT                   /translation="MASGKIIKLVVFELLEFAAFSIPTLVIMEQFATANQRTKSERTHY
FT                   WLIVSCSIAYVAVVSLLIWVPVKVVLYKKRHLYKKIIGWRPVLVMCVVLTTLPSFSFSI
FT                   AVTEVQKNINGSANSLPESLPDLPVSLVLLSLIVVDIIEKLRQYPLRGSQK"
FT   gene            complement(11092726..11093010)
FT                   /pseudo
FT                   /locus_tag="mCG_49088"
FT                   /note="gene_id=mCG49088.0"
FT   mRNA            complement(11092726..11093010)
FT                   /pseudo
FT                   /locus_tag="mCG_49088"
FT                   /note="gene_id=mCG49088.0 transcript_id=mCT49271.0 created
FT                   on 23-SEP-2002"
FT   gene            11132507..11233984
FT                   /gene="Mrc1"
FT                   /locus_tag="mCG_14198"
FT                   /note="gene_id=mCG14198.1"
FT   mRNA            join(11132507..11132666,11141219..11141620,
FT                   11147211..11147384,11151900..11152064,11160087..11160200,
FT                   11164272..11164418,11169503..11169688,11173292..11173449,
FT                   11174417..11174527,11179442..11179557,11182991..11183139,
FT                   11192194..11192393,11195726..11195853,11196653..11196740,
FT                   11198007..11198151,11207127..11207168,11208332..11208495,
FT                   11209480..11209547,11210903..11211003,11211695..11211837,
FT                   11212984..11213098,11218255..11218421,11219863..11219965,
FT                   11222122..11222354,11224794..11224959,11228249..11228400,
FT                   11229982..11230095,11230615..11230779,11232078..11232119,
FT                   11233117..11233984)
FT                   /gene="Mrc1"
FT                   /locus_tag="mCG_14198"
FT                   /product="mannose receptor, C type 1"
FT                   /note="gene_id=mCG14198.1 transcript_id=mCT14338.1 created
FT                   on 20-SEP-2002"
FT   CDS             join(11132606..11132666,11141219..11141620,
FT                   11147211..11147384,11151900..11152064,11160087..11160200,
FT                   11164272..11164418,11169503..11169688,11173292..11173449,
FT                   11174417..11174527,11179442..11179557,11182991..11183139,
FT                   11192194..11192393,11195726..11195853,11196653..11196740,
FT                   11198007..11198151,11207127..11207168,11208332..11208495,
FT                   11209480..11209547,11210903..11211003,11211695..11211837,
FT                   11212984..11213098,11218255..11218421,11219863..11219965,
FT                   11222122..11222354,11224794..11224959,11228249..11228400,
FT                   11229982..11230074)
FT                   /codon_start=1
FT                   /gene="Mrc1"
FT                   /locus_tag="mCG_14198"
FT                   /product="mannose receptor, C type 1"
FT                   /note="gene_id=mCG14198.1 transcript_id=mCT14338.1
FT                   protein_id=mCP2323.2"
FT                   /protein_id="EDL08064.1"
FT                   /translation="MRLLLLLAFISVIPVSVQLLDARQFLIYNEDHKRCVDALSAISVQ
FT                   TATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKN
FT                   DTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNA
FT                   NGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFEGSERLWNK
FT                   DPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGLWIGL
FT                   NSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYIC
FT                   KKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLA
FT                   SIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENN
FT                   RQEDCVVMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYL
FT                   IGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTF
FT                   RWTVDEQVQFTHWNADMPGRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRP
FT                   PEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKD
FT                   EQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYC
FT                   GELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQY
FT                   YFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKK
FT                   FIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSIN
FT                   ATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENA
FT                   QEQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYED
FT                   ADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYS
FT                   LMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYT
FT                   WTDRWRVRYTNWGADEPKLKSACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQL
FT                   PGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLAMPSNGVPPWFPSRLLLSPVFCHT
FT                   VLNLLKVKPIFG"
FT   gene            11289520..>11290674
FT                   /locus_tag="mCG_1029977"
FT                   /note="gene_id=mCG1029977.0"
FT   mRNA            join(11289520..11289601,11290347..>11290674)
FT                   /locus_tag="mCG_1029977"
FT                   /product="mCG1029977"
FT                   /note="gene_id=mCG1029977.0 transcript_id=mCT147681.0
FT                   created on 04-OCT-2002"
FT   CDS             11290376..>11290674
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029977"
FT                   /product="mCG1029977"
FT                   /note="gene_id=mCG1029977.0 transcript_id=mCT147681.0
FT                   protein_id=mCP51150.1"
FT                   /protein_id="EDL08065.1"
FT                   /translation="MKPPIHPQHNPSPRVDMCFWTNLSVWMILLSHSLSLVSSTETGKT
FT                   LTQNNSRAGSQGLLEVLRVLSAGDHWSLNHPQSLIKILLERTGCPQRTDWTQGD"
FT   gene            11297175..11395928
FT                   /locus_tag="mCG_114951"
FT                   /note="gene_id=mCG114951.0"
FT   mRNA            join(11297175..11297456,11301242..11301449,
FT                   11306046..11306218,11308541..11308715,11321158..11321330,
FT                   11335308..11335457,11336761..11336868,11345114..11345180,
FT                   11350869..11351027,11353058..11353245,11395395..11395928)
FT                   /locus_tag="mCG_114951"
FT                   /product="mCG114951"
FT                   /note="gene_id=mCG114951.0 transcript_id=mCT116049.1
FT                   created on 23-SEP-2002"
FT   CDS             join(11297316..11297456,11301242..11301449,
FT                   11306046..11306218,11308541..11308715,11321158..11321330,
FT                   11335308..11335457,11336761..11336868,11345114..11345180,
FT                   11350869..11351027,11353058..11353245,11395395..11395523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114951"
FT                   /product="mCG114951"
FT                   /note="gene_id=mCG114951.0 transcript_id=mCT116049.1
FT                   protein_id=mCP50629.1"
FT                   /protein_id="EDL08066.1"
FT                   /translation="MSNREYEFYLHSLLGLRQDEDSYFLSEKETDDILAFTRKYFGTSS
FT                   SQCMETKILQRESGIQGSNGADEKTLPQLAATIIALSLQGVCLGRKALPSPDDFTEYIF
FT                   SFLNSTNTLHLSEIEQLLNMLTTRRTCAKEDKYLHQYQRKQNTEEHSLRDPKTSTAMDK
FT                   ESDDHSPSWDQACFSARQLVEIFLQNHSSLSISKEDFKQLSPGIIQQLLSCSCQMPKDQ
FT                   QAKPPPTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYSLILQLFVGLAVGTLSG
FT                   DALLHLIPQVLGLHKQEAEFGHFHESQSPIWKLLGLLGGIHGFFLIEKCFILLVSPNTK
FT                   GLPLVNEHVGHTHHLGLNPELNDQSSGGKSISTIQLKGPEDSQTTVLPIGNVPASNRNG
FT                   KTISLLAIMILVGDSLHNFADGLVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLL
FT                   SSGLSVRTAILMNFLSALTAFAGLYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPE
FT                   MTHVQTQRPWMTFLLQNVGLVLGWFSLLLLAVYEQNIKI"
FT   gene            <11505144..11890184
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /note="gene_id=mCG141212.1"
FT   mRNA            join(11505144..11505398,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11861822,
FT                   11864937..11865013,11868973..11869106,11872593..11872673,
FT                   11873093..11873151,11876161..11876270,11882723..11882874,
FT                   11884205..11884300,11885671..11885856,11887007..11890184)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT173786"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT173786.1
FT                   created on 03-JUL-2003"
FT   mRNA            join(<11505144..11505398,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11861822,
FT                   11864937..11865013,11868973..11869106,11872593..11872673,
FT                   11873093..11873151,11876161..11876270,11882723..11882874,
FT                   11884205..11884300,11885668..11885856,11887007..11888354)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT190160"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT190160.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<11505144..11505398,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11861822,
FT                   11864937..11865013,11868973..11869106,11872593..11872673,
FT                   11873093..11873151,11876161..11876270,11882723..11882874,
FT                   11884205..11884300,11885668..11885856,11887007..11887495)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_g"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT190160.0
FT                   protein_id=mCP111140.0 isoform=CRA_g"
FT                   /protein_id="EDL08073.1"
FT                   /translation="VPAPPPSLGFATCFSGVARTESLRSWGEEERGTRVVEEGTRSLGV
FT                   DFLPMVQSDTSKSPPVAAVAQESQMELLESAAPAGALGAQSYGKGARRKNRFKGSDGST
FT                   SSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFA
FT                   VRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPV
FT                   KLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEE
FT                   NDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYE
FT                   VTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEV
FT                   QSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGK
FT                   SQAKHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSGNL
FT                   PNPLLSRTLASSTLPLSPTLASNSQGSQGDQRPDRSAPRSASQAEEEPCLEPVKKSQHR
FT                   SSSATHQNHRSGTGRGLSRQETFDSETQESRDSAYVEPKEDYSHEHVDRYVPHREHNHR
FT                   EETHSSNGHRHRESRHRSRDMGRDQDHNECIKQRSRHKSKDRYCDKEGEVISKRRNEAG
FT                   EWNRDVYIRQ"
FT   CDS             join(11505291..11505398,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11861822,
FT                   11864937..11865013,11868973..11869106,11872593..11872673,
FT                   11873093..11873151,11876161..11876270,11882723..11882874,
FT                   11884205..11884300,11885671..11885856,11887007..11887495)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT173786.1
FT                   protein_id=mCP96705.1 isoform=CRA_a"
FT                   /protein_id="EDL08067.1"
FT                   /translation="MVQSDTSKSPPVAAVAQESQMELLESAAPAGALGAQSYGKGARRK
FT                   NRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLE
FT                   KAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEG
FT                   CEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAID
FT                   IDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVV
FT                   LVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIER
FT                   SNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKV
FT                   LQRLIKSRGKSQAKHLNVQMVAADKLAQCPPESFDVILDENQLEDACEHLADYLEAYWK
FT                   ATHPPSGNLPNPLLSRTLASSTLPLSPTLASNSQGSQGDQRPDRSAPRSASQAEEEPCL
FT                   EPVKKSQHRSSSATHQNHRSGTGRGLSRQETFDSETQESRDSAYVEPKEDYSHEHVDRY
FT                   VPHREHNHREETHSSNGHRHRESRHRSRDMGRDQDHNECIKQRSRHKSKDRYCDKEGEV
FT                   ISKRRNEAGEWNRDVYIRQ"
FT   mRNA            join(<11505771..11506091,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11864698)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT186488"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186488.0
FT                   created on 03-JUL-2003"
FT   CDS             join(11505771..11506091,11515104..11515196,
FT                   11776012..11776131,11859797..11859919,11861686..11861931)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186488.0
FT                   protein_id=mCP107193.0 isoform=CRA_b"
FT                   /protein_id="EDL08068.1"
FT                   /translation="MESHGPGEWTGPAQDRESGRAGKGSASCIAVSAAASGGLYWELGR
FT                   EVRCYAGVKVGVDPLAFSPESSPNPPQHLGRCATQTVQLAVLFPGFAWTLVSLLEEESR
FT                   VLWSYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVR
FT                   REAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFN
FT                   NDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSRYEQQQQQQITVYIKMQ
FT                   TLSSLLSCCLLSAVILSVY"
FT   gene            complement(11527749..11528265)
FT                   /pseudo
FT                   /locus_tag="mCG_14197"
FT                   /note="gene_id=mCG14197.1"
FT   mRNA            complement(11527749..11528265)
FT                   /pseudo
FT                   /locus_tag="mCG_14197"
FT                   /note="gene_id=mCG14197.1 transcript_id=mCT14337.1 created
FT                   on 27-SEP-2002"
FT   gene            11573299..11573782
FT                   /pseudo
FT                   /locus_tag="mCG_50560"
FT                   /note="gene_id=mCG50560.2"
FT   mRNA            11573299..11573782
FT                   /pseudo
FT                   /locus_tag="mCG_50560"
FT                   /note="gene_id=mCG50560.2 transcript_id=mCT50743.2 created
FT                   on 27-SEP-2002"
FT   gene            complement(11593136..11594309)
FT                   /pseudo
FT                   /locus_tag="mCG_1029915"
FT                   /note="gene_id=mCG1029915.1"
FT   mRNA            complement(11593136..11594309)
FT                   /pseudo
FT                   /locus_tag="mCG_1029915"
FT                   /note="gene_id=mCG1029915.1 transcript_id=mCT147619.1
FT                   created on 27-SEP-2002"
FT   gene            complement(11609037..>11640587)
FT                   /locus_tag="mCG_141246"
FT                   /note="gene_id=mCG141246.0"
FT   mRNA            complement(join(11609037..11609492,11617052..11617148,
FT                   11640479..>11640587))
FT                   /locus_tag="mCG_141246"
FT                   /product="mCG141246"
FT                   /note="gene_id=mCG141246.0 transcript_id=mCT174039.0
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(11609475..11609492,11617052..11617148,
FT                   11640479..>11640585))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141246"
FT                   /product="mCG141246"
FT                   /note="gene_id=mCG141246.0 transcript_id=mCT174039.0
FT                   protein_id=mCP96958.0"
FT                   /protein_id="EDL08074.1"
FT                   /translation="HEEVAERSQSVASPSGTVPRLLVTATVHFFPPSTPSDTMLCLVDN
FT                   KIELGHRYTSGQWKTLCSCGAMQSWNAL"
FT   gene            11622179..11623265
FT                   /pseudo
FT                   /locus_tag="mCG_52142"
FT                   /note="gene_id=mCG52142.2"
FT   mRNA            11622179..11623265
FT                   /pseudo
FT                   /locus_tag="mCG_52142"
FT                   /note="gene_id=mCG52142.2 transcript_id=mCT52325.2 created
FT                   on 27-SEP-2002"
FT   mRNA            join(11640560..11640630,11776012..11776131,
FT                   11859797..11859919,11861686..11861822,11864937..11865013,
FT                   11868973..11869106,11872593..11872673,11873093..11873151,
FT                   11876161..11876270,11882723..11882874,11884205..11884300,
FT                   11885668..11885856,11887007..11890184)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT186489"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186489.0
FT                   created on 03-JUL-2003"
FT   CDS             join(11640583..11640630,11776012..11776131,
FT                   11859797..11859919,11861686..11861822,11864937..11865013,
FT                   11868973..11869106,11872593..11872673,11873093..11873151,
FT                   11876161..11876270,11882723..11882874,11884205..11884300,
FT                   11885668..11885856,11887007..11887495)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_c"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186489.0
FT                   protein_id=mCP107195.0 isoform=CRA_c"
FT                   /protein_id="EDL08069.1"
FT                   /translation="MQCCGLVHRRRVRVSYGSADSYTSRPSDSDVSLEEDREAVRREAE
FT                   RQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWW
FT                   IGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKS
FT                   TPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDV
FT                   VPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNP
FT                   SKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVY
FT                   VKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHL
FT                   ADYLEAYWKATHPPSGNLPNPLLSRTLASSTLPLSPTLASNSQGSQGDQRPDRSAPRSA
FT                   SQAEEEPCLEPVKKSQHRSSSATHQNHRSGTGRGLSRQETFDSETQESRDSAYVEPKED
FT                   YSHEHVDRYVPHREHNHREETHSSNGHRHRESRHRSRDMGRDQDHNECIKQRSRHKSKD
FT                   RYCDKEGEVISKRRNEAGEWNRDVYIRQ"
FT   gene            complement(11641258..11667988)
FT                   /locus_tag="mCG_141245"
FT                   /note="gene_id=mCG141245.0"
FT   mRNA            complement(join(11641258..11641527,11646820..11646947,
FT                   11667860..11667988))
FT                   /locus_tag="mCG_141245"
FT                   /product="mCG141245"
FT                   /note="gene_id=mCG141245.0 transcript_id=mCT174038.0
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(11641300..11641527,11646820..11646822))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141245"
FT                   /product="mCG141245"
FT                   /note="gene_id=mCG141245.0 transcript_id=mCT174038.0
FT                   protein_id=mCP96957.0"
FT                   /protein_id="EDL08075.1"
FT                   /translation="MESQGSVKPFSTAVWPACINRLLSFTAFPENKATAHRRRRRMKIK
FT                   PGLPPSLSACIAVQCISINIQPSPTVLLQYL"
FT   mRNA            join(11664095..11664959,11776012..11776131,
FT                   11859797..11859919,11861686..11864698)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT186490"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186490.0
FT                   created on 03-JUL-2003"
FT   CDS             join(11664876..11664959,11776012..11776131,
FT                   11859797..11859919,11861686..11861931)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_d"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186490.0
FT                   protein_id=mCP107192.0 isoform=CRA_d"
FT                   /protein_id="EDL08070.1"
FT                   /translation="MLVKLLLVTSTVLNVAMLKTPKSKNVSWGSADSYTSRPSDSDVSL
FT                   EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDF
FT                   LHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSRYEQQQQQQ
FT                   ITVYIKMQTLSSLLSCCLLSAVILSVY"
FT   gene            complement(11712868..11713651)
FT                   /pseudo
FT                   /locus_tag="mCG_1029878"
FT                   /note="gene_id=mCG1029878.1"
FT   mRNA            complement(11712868..11713651)
FT                   /pseudo
FT                   /locus_tag="mCG_1029878"
FT                   /note="gene_id=mCG1029878.1 transcript_id=mCT147582.1
FT                   created on 25-NOV-2002"
FT   mRNA            join(11774896..11775187,11776012..11776131,
FT                   11859797..11859919,11861686..11861822,11864937..11865013,
FT                   11869249..11869268,11872593..11872673,11873093..11873151,
FT                   11876161..11876270,11882723..11882874,11884205..11884300,
FT                   11885668..11885856,11887007..11890184)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT186491"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186491.0
FT                   created on 03-JUL-2003"
FT   CDS             join(11775119..11775187,11776012..11776131,
FT                   11859797..11859919,11861686..11861822,11864937..11865013,
FT                   11869249..11869268,11872593..11872673,11873093..11873151,
FT                   11876161..11876270,11882723..11882874,11884205..11884300,
FT                   11885668..11885856,11887007..11887495)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_e"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186491.0
FT                   protein_id=mCP107194.0 isoform=CRA_e"
FT                   /protein_id="EDL08071.1"
FT                   /translation="MKATWIRLLKRAKGGRLKSSDICGSADSYTSRPSDSDVSLEEDRE
FT                   AVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKE
FT                   KFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDI
FT                   VPSSRKSTPPSSAKQKQKSTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFL
FT                   KHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELART
FT                   LQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAA
FT                   DKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSGNLPNPLLSRTLASST
FT                   LPLSPTLASNSQGSQGDQRPDRSAPRSASQAEEEPCLEPVKKSQHRSSSATHQNHRSGT
FT                   GRGLSRQETFDSETQESRDSAYVEPKEDYSHEHVDRYVPHREHNHREETHSSNGHRHRE
FT                   SRHRSRDMGRDQDHNECIKQRSRHKSKDRYCDKEGEVISKRRNEAGEWNRDVYIRQ"
FT   mRNA            join(11775232..11775433,11776012..11776131,
FT                   11859797..11859919,11861686..11864698)
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, transcript variant mCT186492"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186492.0
FT                   created on 03-JUL-2003"
FT   CDS             join(11859875..11859919,11861686..11861931)
FT                   /codon_start=1
FT                   /gene="Cacnb2"
FT                   /locus_tag="mCG_141212"
FT                   /product="calcium channel, voltage-dependent, beta 2
FT                   subunit, isoform CRA_f"
FT                   /note="gene_id=mCG141212.1 transcript_id=mCT186492.0
FT                   protein_id=mCP107196.0 isoform=CRA_f"
FT                   /protein_id="EDL08072.1"
FT                   /translation="MAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENM
FT                   RLQHEQRAKQGKFYSRYEQQQQQQITVYIKMQTLSSLLSCCLLSAVILSVY"
FT   gene            complement(11896555..11956725)
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /note="gene_id=mCG21342.3"
FT   mRNA            complement(join(11896555..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11950567..>11950925))
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, transcript variant
FT                   mCT190113"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT190113.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(11896800..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11950567..11950862,
FT                   11956310..11956725))
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, transcript variant
FT                   mCT21832"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT21832.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(11897718..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11956310..>11956519))
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, transcript variant
FT                   mCT190112"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT190112.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(11897735..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11956310..>11956321))
FT                   /codon_start=1
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, isoform CRA_a"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT190112.0
FT                   protein_id=mCP111129.0 isoform=CRA_a"
FT                   /protein_id="EDL08076.1"
FT                   /translation="PCNKAVSASSRQEAERKFETLLLRLSHPPSMTTVRVNTHLGSVQH
FT                   VRGLLLEELQKQFGESSIPVVQHPALPDVLLIPMTGPRKNIERQQGEVIVGAQCGNAVL
FT                   RGAHVYVPGIVSASKFMKAGDVISVYSDINGKCKKGAKEFDGTKVFLGNGISELSRKDI
FT                   FNGLPDLKGIGIRMTEPIYLSPSFDNVLPSYIFLQNLPSTVVAHVLDPQPGEKILDMCA
FT                   APGGKTTHTAALMQDKGEVIALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDT
FT                   TDGIEGGPPFLPESFDRIILDAPCSGMGQRPNMACTWTLKEVTSYQPLQRKLLHVAVQL
FT                   LKPGGVLVYSTCTITLAENEEQVAWALRTFPCLQLQPQEPQIGGEGMVGAGLTLEQLKQ
FT                   LQRFDPSVVPLQNMDTDSLGEARREDMIWLANKDCIGFFIAKFLKCQSTKAKVSQK"
FT   CDS             complement(join(11897735..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11950567..>11950695))
FT                   /codon_start=1
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, isoform CRA_b"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT190113.0
FT                   protein_id=mCP111130.0 isoform=CRA_b"
FT                   /protein_id="EDL08077.1"
FT                   /translation="RLLPNIFLDNLKQKKIKRMYVFPKISLRPEVENYLKESFLNEEAV
FT                   SASSRQEAERKFETLLLRLSHPPSMTTVRVNTHLGSVQHVRGLLLEELQKQFGESSIPV
FT                   VQHPALPDVLLIPMTGPRKNIERQQGEVIVGAQCGNAVLRGAHVYVPGIVSASKFMKAG
FT                   DVISVYSDINGKCKKGAKEFDGTKVFLGNGISELSRKDIFNGLPDLKGIGIRMTEPIYL
FT                   SPSFDNVLPSYIFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVI
FT                   ALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDTTDGIEGGPPFLPESFDRIIL
FT                   DAPCSGMGQRPNMACTWTLKEVTSYQPLQRKLLHVAVQLLKPGGVLVYSTCTITLAENE
FT                   EQVAWALRTFPCLQLQPQEPQIGGEGMVGAGLTLEQLKQLQRFDPSVVPLQNMDTDSLG
FT                   EARREDMIWLANKDCIGFFIAKFLKCQSTKAKVSQK"
FT   CDS             complement(join(11897735..11897968,11899589..11899714,
FT                   11911046..11911194,11914776..11914920,11931666..11931785,
FT                   11937920..11938001,11939719..11939872,11941378..11941487,
FT                   11943872..11943951,11948793..11948948,11950567..11950641))
FT                   /codon_start=1
FT                   /gene="Nsun6"
FT                   /locus_tag="mCG_21342"
FT                   /product="NOL1/NOP2/Sun domain family 6, isoform CRA_c"
FT                   /note="gene_id=mCG21342.3 transcript_id=mCT21832.2
FT                   protein_id=mCP2332.2 isoform=CRA_c"
FT                   /protein_id="EDL08078.1"
FT                   /translation="MYVFPKISLRPEVENYLKESFLNEEAVSASSRQEAERKFETLLLR
FT                   LSHPPSMTTVRVNTHLGSVQHVRGLLLEELQKQFGESSIPVVQHPALPDVLLIPMTGPR
FT                   KNIERQQGEVIVGAQCGNAVLRGAHVYVPGIVSASKFMKAGDVISVYSDINGKCKKGAK
FT                   EFDGTKVFLGNGISELSRKDIFNGLPDLKGIGIRMTEPIYLSPSFDNVLPSYIFLQNLP
FT                   STVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVIALDKILTKVNKLKQNASL
FT                   LGLHSIRAFCFDATKALKLDTTDGIEGGPPFLPESFDRIILDAPCSGMGQRPNMACTWT
FT                   LKEVTSYQPLQRKLLHVAVQLLKPGGVLVYSTCTITLAENEEQVAWALRTFPCLQLQPQ
FT                   EPQIGGEGMVGAGLTLEQLKQLQRFDPSVVPLQNMDTDSLGEARREDMIWLANKDCIGF
FT                   FIAKFLKCQSTKAKVSQK"
FT   gene            11956967..11978239
FT                   /gene="Arl5b"
FT                   /locus_tag="mCG_21343"
FT                   /note="gene_id=mCG21343.1"
FT   mRNA            join(11956967..11957220,11969786..11969846,
FT                   11971467..11971614,11974771..11974854,11976609..11976760,
FT                   11977903..11978239)
FT                   /gene="Arl5b"
FT                   /locus_tag="mCG_21343"
FT                   /product="ADP-ribosylation factor-like 5B"
FT                   /note="gene_id=mCG21343.1 transcript_id=mCT21834.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(11957172..11957220,11969786..11969846,
FT                   11971467..11971614,11974771..11974854,11976609..11976760,
FT                   11977903..11977951)
FT                   /codon_start=1
FT                   /gene="Arl5b"
FT                   /locus_tag="mCG_21343"
FT                   /product="ADP-ribosylation factor-like 5B"
FT                   /note="gene_id=mCG21343.1 transcript_id=mCT21834.2
FT                   protein_id=mCP2356.1"
FT                   /db_xref="GOA:Q6NXZ5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR024156"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1923119"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NXZ5"
FT                   /protein_id="EDL08079.1"
FT                   /translation="MMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHT
FT                   SPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITK
FT                   EELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTG
FT                   EGLCQGLEWMTSRIGVR"
FT   gene            complement(11983344..11984091)
FT                   /locus_tag="mCG_1030072"
FT                   /note="gene_id=mCG1030072.1"
FT   mRNA            complement(11983344..11984091)
FT                   /locus_tag="mCG_1030072"
FT                   /product="mCG1030072"
FT                   /note="gene_id=mCG1030072.1 transcript_id=mCT147776.1
FT                   created on 04-OCT-2002"
FT   CDS             complement(11983726..11983866)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030072"
FT                   /product="mCG1030072"
FT                   /note="gene_id=mCG1030072.1 transcript_id=mCT147776.1
FT                   protein_id=mCP51103.1"
FT                   /protein_id="EDL08080.1"
FT                   /translation="MIVENVKIQKTFSFNNLIIKQVWKHVWGVRVRNAFGICFDSFLVS
FT                   T"
FT   gene            12028940..12030111
FT                   /pseudo
FT                   /locus_tag="mCG_21346"
FT                   /note="gene_id=mCG21346.2"
FT   mRNA            12028940..12030111
FT                   /pseudo
FT                   /locus_tag="mCG_21346"
FT                   /note="gene_id=mCG21346.2 transcript_id=mCT21836.2 created
FT                   on 27-SEP-2002"
FT   gene            12288666..12289312
FT                   /pseudo
FT                   /locus_tag="mCG_1029916"
FT                   /note="gene_id=mCG1029916.1"
FT   mRNA            12288666..12289312
FT                   /pseudo
FT                   /locus_tag="mCG_1029916"
FT                   /note="gene_id=mCG1029916.1 transcript_id=mCT147620.1
FT                   created on 27-SEP-2002"
FT   gene            12299772..12300627
FT                   /pseudo
FT                   /locus_tag="mCG_21345"
FT                   /note="gene_id=mCG21345.2"
FT   mRNA            12299772..12300627
FT                   /pseudo
FT                   /locus_tag="mCG_21345"
FT                   /note="gene_id=mCG21345.2 transcript_id=mCT21833.2 created
FT                   on 27-SEP-2002"
FT   gene            12355557..12356073
FT                   /locus_tag="mCG_1029980"
FT                   /note="gene_id=mCG1029980.1"
FT   mRNA            12355557..12356073
FT                   /locus_tag="mCG_1029980"
FT                   /product="mCG1029980, transcript variant mCT174035"
FT                   /note="gene_id=mCG1029980.1 transcript_id=mCT174035.0
FT                   created on 04-OCT-2002"
FT   mRNA            join(12355567..12355791,12355835..12356073)
FT                   /locus_tag="mCG_1029980"
FT                   /product="mCG1029980, transcript variant mCT147684"
FT                   /note="gene_id=mCG1029980.1 transcript_id=mCT147684.1
FT                   created on 04-OCT-2002"
FT   CDS             12355618..12355935
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029980"
FT                   /product="mCG1029980, isoform CRA_b"
FT                   /note="gene_id=mCG1029980.1 transcript_id=mCT174035.0
FT                   protein_id=mCP96954.0 isoform=CRA_b"
FT                   /protein_id="EDL08082.1"
FT                   /translation="MGGRERRGSCMNNDTETVLKLYQDPNVLRKVQGLNAQAKGEVQIL
FT                   ISGRGRAIQAKGEVIISGRGRAMQAKGEVLMGRGAIEILSFDSYTGKQELGGIRVWSGH
FT                   Q"
FT   CDS             join(12355618..12355791,12355835..12355861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029980"
FT                   /product="mCG1029980, isoform CRA_a"
FT                   /note="gene_id=mCG1029980.1 transcript_id=mCT147684.1
FT                   protein_id=mCP51172.1 isoform=CRA_a"
FT                   /protein_id="EDL08081.1"
FT                   /translation="MGGRERRGSCMNNDTETVLKLYQDPNVLRKVQGLNAQAKGEVQIL
FT                   ISGRGRAIQAKGEKYLWEGGQ"
FT   gene            12384743..12385170
FT                   /pseudo
FT                   /locus_tag="mCG_49420"
FT                   /note="gene_id=mCG49420.1"
FT   mRNA            12384743..12385170
FT                   /pseudo
FT                   /locus_tag="mCG_49420"
FT                   /note="gene_id=mCG49420.1 transcript_id=mCT49603.1 created
FT                   on 04-OCT-2002"
FT   gene            <12606062..>12606483
FT                   /locus_tag="mCG_53528"
FT                   /note="gene_id=mCG53528.2"
FT   mRNA            <12606062..>12606483
FT                   /locus_tag="mCG_53528"
FT                   /product="mCG53528"
FT                   /note="gene_id=mCG53528.2 transcript_id=mCT53711.2 created
FT                   on 04-OCT-2002"
FT   CDS             <12606064..12606483
FT                   /codon_start=1
FT                   /locus_tag="mCG_53528"
FT                   /product="mCG53528"
FT                   /note="gene_id=mCG53528.2 transcript_id=mCT53711.2
FT                   protein_id=mCP25397.2"
FT                   /protein_id="EDL08083.1"
FT                   /translation="PGLQCNFENGICNWEQSTKDDFNWTRYQGPTSTMNTGPMKDHTLG
FT                   TAKGHYLYIETSGPQGFQDKAVLLSPILNATEAKVCTFRLYYHMFGKHIYRLAIYQRIW
FT                   SNTKGQLLWQIFGDQGNRWIRKDLSITSRKPFQVR"
FT   gene            13173315..13174415
FT                   /locus_tag="mCG_55760"
FT                   /note="gene_id=mCG55760.1"
FT   mRNA            join(13173315..13173567,13174084..13174415)
FT                   /locus_tag="mCG_55760"
FT                   /product="mCG55760"
FT                   /note="gene_id=mCG55760.1 transcript_id=mCT55943.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(13173499..13173567,13174084..13174386)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55760"
FT                   /product="mCG55760"
FT                   /note="gene_id=mCG55760.1 transcript_id=mCT55943.1
FT                   protein_id=mCP25354.2"
FT                   /protein_id="EDL08084.1"
FT                   /translation="MFPIYNKTSCTARTLHFSWIDKLLHMNYFIDKKLLIFLPKFKHFG
FT                   RDGYIGIPFQCNKATRKSEPYKGVCGILPCVFPLPFFIAVADTAAASEGQNSRRGKFWP
FT                   FSSVKFSLELQAQFYHYLL"
FT   gene            13260852..13656298
FT                   /gene="Plxdc2"
FT                   /locus_tag="mCG_19758"
FT                   /note="gene_id=mCG19758.2"
FT   mRNA            join(13260852..13260984,13415431..13415642,
FT                   13451128..13451274,13468396..13468465,13542041..13542163,
FT                   13553562..13553680,13564198..13564297,13572916..13573011,
FT                   13573245..13573326,13606745..13606811,13615702..13615849,
FT                   13617290..13617328,13632873..13633033,13655188..13656298)
FT                   /gene="Plxdc2"
FT                   /locus_tag="mCG_19758"
FT                   /product="plexin domain containing 2"
FT                   /note="gene_id=mCG19758.2 transcript_id=mCT21691.2 created
FT                   on 24-SEP-2002"
FT   CDS             join(13260873..13260984,13415431..13415642,
FT                   13451128..13451274,13468396..13468465,13542041..13542163,
FT                   13553562..13553680,13564198..13564297,13572916..13573011,
FT                   13573245..13573326,13606745..13606811,13615702..13615849,
FT                   13617290..13617328,13632873..13633033,13655188..13655304)
FT                   /codon_start=1
FT                   /gene="Plxdc2"
FT                   /locus_tag="mCG_19758"
FT                   /product="plexin domain containing 2"
FT                   /note="gene_id=mCG19758.2 transcript_id=mCT21691.2
FT                   protein_id=mCP2290.2"
FT                   /protein_id="EDL08085.1"
FT                   /translation="MARFRRADLAAAGVMLLCHFLTDRFQFAHGEPGHHTNDWIYEVTN
FT                   AFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNN
FT                   TQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSF
FT                   DFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNG
FT                   TALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLS
FT                   DAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSS
FT                   QIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHT
FT                   TTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHAGLI
FT                   VGILILVLIIAAAILVTVYMYHHPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEP
FT                   VGEKEGFIVSEQC"
FT   gene            complement(<13278165..13285698)
FT                   /locus_tag="mCG_1030081"
FT                   /note="gene_id=mCG1030081.0"
FT   mRNA            complement(join(<13278165..13278966,13285610..13285698))
FT                   /locus_tag="mCG_1030081"
FT                   /product="mCG1030081"
FT                   /note="gene_id=mCG1030081.0 transcript_id=mCT147785.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(13278165..13278671)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030081"
FT                   /product="mCG1030081"
FT                   /note="gene_id=mCG1030081.0 transcript_id=mCT147785.0
FT                   protein_id=mCP50708.1"
FT                   /protein_id="EDL08086.1"
FT                   /translation="MKQHSLILHGVVLVFAKVYTGKIVPIIYENRCNPLMVIHKYYGTI
FT                   RTWSAPCSFHFTFFSTHSFLYTPIHTCIHHTHYTHTHTHTHPPSNQQNTHTYSHRYTDT
FT                   HPPSHNTHTHTHPLTSHTHTHTHTDTHTHPPSHKTHTHTHTHIHTHTHTPQMHILIYRG
FT                   HQAMT"
FT   gene            complement(13821136..13916610)
FT                   /locus_tag="mCG_141209"
FT                   /note="gene_id=mCG141209.0"
FT   mRNA            complement(join(13821136..13821413,13829066..13829115,
FT                   13900867..13900963,13916547..13916610))
FT                   /locus_tag="mCG_141209"
FT                   /product="mCG141209"
FT                   /note="gene_id=mCG141209.0 transcript_id=mCT173778.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(13821303..13821413,13829066..13829086))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141209"
FT                   /product="mCG141209"
FT                   /note="gene_id=mCG141209.0 transcript_id=mCT173778.0
FT                   protein_id=mCP96697.0"
FT                   /protein_id="EDL08087.1"
FT                   /translation="MTLPLTQARSLCTIEINEEQNHLSIFSLVQVVSTTYLSLKESS"
FT   gene            complement(13881614..13882677)
FT                   /pseudo
FT                   /locus_tag="mCG_19759"
FT                   /note="gene_id=mCG19759.2"
FT   mRNA            complement(13881614..13882677)
FT                   /pseudo
FT                   /locus_tag="mCG_19759"
FT                   /note="gene_id=mCG19759.2 transcript_id=mCT21692.2 created
FT                   on 25-SEP-2002"
FT   gene            complement(14245443..14628585)
FT                   /gene="Nebl"
FT                   /locus_tag="mCG_18450"
FT                   /note="gene_id=mCG18450.2"
FT   mRNA            complement(join(14245443..14247579,14249414..14249520,
FT                   14272926..14273097,14429184..14429291,14489241..14489325,
FT                   14626885..14626979,14628309..14628585))
FT                   /gene="Nebl"
FT                   /locus_tag="mCG_18450"
FT                   /product="nebulette, transcript variant mCT173771"
FT                   /note="gene_id=mCG18450.2 transcript_id=mCT173771.0 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(14245544..14247579,14249414..14249520,
FT                   14268270..14268419,14269200..14269292,14272926..14273097,
FT                   14275360..14275452,14278487..14278579,14287429..14287521,
FT                   14289549..14289653,14291655..14291765,14291903..14292013,
FT                   14295794..14295904,14299211..14299321,14302901..14303011,
FT                   14309938..14310045,14312522..14312626,14323453..14323566,
FT                   14332848..14332949,14333811..14333912,14342643..14342753,
FT                   14349128..14349238,14351409..14351513,14359204..14359275,
FT                   14359377..14359517))
FT                   /gene="Nebl"
FT                   /locus_tag="mCG_18450"
FT                   /product="nebulette, transcript variant mCT14274"
FT                   /note="gene_id=mCG18450.2 transcript_id=mCT14274.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(14247403..14247579,14249414..14249520,
FT                   14272926..14273097,14429184..14429291,14489241..14489325,
FT                   14626885..14626979,14628309..14628377))
FT                   /codon_start=1
FT                   /gene="Nebl"
FT                   /locus_tag="mCG_18450"
FT                   /product="nebulette, isoform CRA_a"
FT                   /note="gene_id=mCG18450.2 transcript_id=mCT173771.0
FT                   protein_id=mCP96690.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DC07"
FT                   /db_xref="InterPro:IPR000900"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921353"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DC07"
FT                   /protein_id="EDL08088.1"
FT                   /translation="MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYK
FT                   GYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDT
FT                   PELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDDPVTERVRKSTQVVSDAAYKGVQP
FT                   HVVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQPPAHLRTYRAMYDYS
FT                   AQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN"
FT   CDS             complement(join(14247403..14247579,14249414..14249520,
FT                   14268270..14268419,14269200..14269292,14272926..14273097,
FT                   14275360..14275452,14278487..14278579,14287429..14287521,
FT                   14289549..14289653,14291655..14291765,14291903..14292013,
FT                   14295794..14295904,14299211..14299321,14302901..14303011,
FT                   14309938..14310045,14312522..14312626,14323453..14323566,
FT                   14332848..14332949,14333811..14333912,14342643..14342753,
FT                   14349128..14349238,14351409..14351513,14359204..14359275,
FT                   14359377..14359457))
FT                   /codon_start=1
FT                   /gene="Nebl"
FT                   /locus_tag="mCG_18450"
FT                   /product="nebulette, isoform CRA_b"
FT                   /note="gene_id=mCG18450.2 transcript_id=mCT14274.2
FT                   protein_id=mCP2301.2 isoform=CRA_b"
FT                   /protein_id="EDL08089.1"
FT                   /translation="MKVPVSGDVKEETEEENVEQEENQEAKVSLKPVIEDLSMELARKC
FT                   TELISDIHYKEEYKKSKDKCTFVTDTPMLNHVKNIGAFISEAKYKGTIKADLSNCLYKD
FT                   MPATIDSVFAREVSQLQSEVAYKQKHEAEKGFSDYTHMKEPPEVRRAMEVNRHQSNISY
FT                   RKDMQGTHTYTAELDRPDIKKATQISKIISDAEYKKGQGIVNKEPSVIGRPDFEHAVGA
FT                   SKLSSQVKYKEKFDNEMKEKSHHYNPLGSAFFRQHQFAAVLASDWEYKRDFEENKGLYH
FT                   FDAEAPEHLHHKGNATLQSQVKYREEYEKNKGKSMLEFVETPSYQSSKEAQKMQSEKVY
FT                   KEDFEKEIKGRSSLDLDKTPAFLHVKHITNLMREKEYKKDLENEIKGKGMELSSEVLDI
FT                   QRAKRASEMASEKEYKKDLELEIKGKGMQIDTDTLEIQRAKRAAKIASAKDYKRDLETE
FT                   IKGKGMQVSTDTLDVQRAKRASEMASQKQYKKDLENEIKGRGMQVNMDIPDMLRAKRAS
FT                   EIYSQRKYKDEAEKMLSNYSTVAVTPEIQRIKTTQQNISNVSYKEEVGAGTAVRNTPEI
FT                   ERVKKNQHNISSFQYKEQTYKATPVTMTPEIERVKRNQEQLSAVYYKGQLGRATALSVT
FT                   PEMERVKKNQENISSVKYHEDFEKTKGRGFTPVVDDPVTERVRKSTQVVSDAAYKGVQP
FT                   HVVEMDRRPGIIVDLKVWRTDPGSIFDIDPLEDNIQSRSLHMLSEKASQYRRRLSRSHS
FT                   GSTFGTGLGDDKSEISELYPSFSCYSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSV
FT                   SSMRSMQPPAHLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTG
FT                   MLPANYIEFVN"
FT   gene            complement(14545272..14548253)
FT                   /locus_tag="mCG_147239"
FT                   /note="gene_id=mCG147239.0"
FT   mRNA            complement(join(14545272..14545433,14547321..14548253))
FT                   /locus_tag="mCG_147239"
FT                   /product="mCG147239"
FT                   /note="gene_id=mCG147239.0 transcript_id=mCT187502.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14547736..14547882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147239"
FT                   /product="mCG147239"
FT                   /note="gene_id=mCG147239.0 transcript_id=mCT187502.0
FT                   protein_id=mCP109112.0"
FT                   /protein_id="EDL08090.1"
FT                   /translation="MKVDGCSVIQHPDNKPLYFTDVVICGSIKDAKKNKEGSRRLLTQE
FT                   CRI"
FT   gene            complement(14893378..14893902)
FT                   /gene="1700113O17Rik"
FT                   /locus_tag="mCG_18447"
FT                   /note="gene_id=mCG18447.0"
FT   mRNA            complement(14893378..14893902)
FT                   /gene="1700113O17Rik"
FT                   /locus_tag="mCG_18447"
FT                   /product="RIKEN cDNA 1700113O17"
FT                   /note="gene_id=mCG18447.0 transcript_id=mCT14270.0 created
FT                   on 24-SEP-2002"
FT   CDS             complement(14893494..14893829)
FT                   /codon_start=1
FT                   /gene="1700113O17Rik"
FT                   /locus_tag="mCG_18447"
FT                   /product="RIKEN cDNA 1700113O17"
FT                   /note="gene_id=mCG18447.0 transcript_id=mCT14270.0
FT                   protein_id=mCP2361.1"
FT                   /db_xref="GOA:Q9CQ70"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:1915481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQ70"
FT                   /protein_id="EDL08091.1"
FT                   /translation="MARKRQRRRRRKVTRSQRAELQFPVSRVDRFLREGNYSRRLSSSA
FT                   PVFLAGVLEYLTSNILELAGEVAHTTGRKRIAPEHVCRVVQNNEQLHQLFKQGGTSVFE
FT                   PPEPDDN"
FT   gene            complement(14921993..14934540)
FT                   /locus_tag="mCG_147224"
FT                   /note="gene_id=mCG147224.0"
FT   mRNA            complement(join(14921993..14925040,14934369..14934540))
FT                   /locus_tag="mCG_147224"
FT                   /product="mCG147224"
FT                   /note="gene_id=mCG147224.0 transcript_id=mCT187487.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14923634..14924107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147224"
FT                   /product="mCG147224"
FT                   /note="gene_id=mCG147224.0 transcript_id=mCT187487.0
FT                   protein_id=mCP109106.0"
FT                   /db_xref="GOA:Q8C8W7"
FT                   /db_xref="MGI:MGI:1925190"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8W7"
FT                   /protein_id="EDL08092.1"
FT                   /translation="MDRQVTLIFPSSVRGCLNLASRPFYNWKANFYFSLLYVSDCEHGM
FT                   RLANLGIFSLPANSWTGARTIGLDHASSLCGIYVSHLQRPLLGVILYFFFLLSFLNRLI
FT                   NMKTLESVLHELQLLGGNPMNEQVEFREVSVYSLSVGAWEHGAADCPWTMAHP"
FT   gene            complement(14940921..14942837)
FT                   /locus_tag="mCG_147226"
FT                   /note="gene_id=mCG147226.0"
FT   mRNA            complement(14940921..14942837)
FT                   /locus_tag="mCG_147226"
FT                   /product="mCG147226"
FT                   /note="gene_id=mCG147226.0 transcript_id=mCT187489.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14942442..14942630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147226"
FT                   /product="mCG147226"
FT                   /note="gene_id=mCG147226.0 transcript_id=mCT187489.0
FT                   protein_id=mCP109108.0"
FT                   /protein_id="EDL08093.1"
FT                   /translation="MANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPPHKAHPIWKWQLG
FT                   GSAIPLPPSHKFRKFNS"
FT   gene            complement(<14944611..14945660)
FT                   /locus_tag="mCG_9553"
FT                   /note="gene_id=mCG9553.2"
FT   mRNA            complement(join(<14944611..14945329,14945564..14945660))
FT                   /locus_tag="mCG_9553"
FT                   /product="mCG9553"
FT                   /note="gene_id=mCG9553.2 transcript_id=mCT9640.2 created on
FT                   25-SEP-2002"
FT   CDS             complement(<14944611..14945216)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9553"
FT                   /product="mCG9553"
FT                   /note="gene_id=mCG9553.2 transcript_id=mCT9640.2
FT                   protein_id=mCP2315.2"
FT                   /protein_id="EDL08094.1"
FT                   /translation="MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTV
FT                   HKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERVLKTK
FT                   RRRVGRALATKAPPPERAAAASPRPAFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAA
FT                   RPAAHLPQIFSKYPGSHYPEIVRSPCKSSLNYETAQLQG"
FT   gene            complement(14951219..>14953618)
FT                   /locus_tag="mCG_146089"
FT                   /note="gene_id=mCG146089.0"
FT   mRNA            complement(join(14951219..14951502,14952739..14952848,
FT                   14953548..>14953618))
FT                   /locus_tag="mCG_146089"
FT                   /product="mCG146089"
FT                   /note="gene_id=mCG146089.0 transcript_id=mCT186192.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(14952752..14952848,14953548..>14953618))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146089"
FT                   /product="mCG146089"
FT                   /note="gene_id=mCG146089.0 transcript_id=mCT186192.0
FT                   protein_id=mCP107420.0"
FT                   /protein_id="EDL08095.1"
FT                   /translation="RGPRGASWVKSGRAAPGSSREEPRIAIEINFRPKSNTTLFPWNST
FT                   YYTVCAQRLL"
FT   gene            14961512..15108395
FT                   /locus_tag="mCG_141206"
FT                   /note="gene_id=mCG141206.0"
FT   mRNA            join(14961512..14961615,14962155..14962314,
FT                   14968256..14968335,14998568..14998622,15006929..15007038,
FT                   15019380..15019483,15020854..15020947,15023269..15023364,
FT                   15043766..15043861,15056449..15056704,15059310..15059879,
FT                   15067247..15067291,15068036..15068068,15083612..15083790,
FT                   15094010..15094127,15095352..15095424,15101028..15101182,
FT                   15103428..15103616,15103978..15104066,15104207..15104571,
FT                   15105210..15105306,15106175..15106372,15108193..15108395)
FT                   /locus_tag="mCG_141206"
FT                   /product="mCG141206, transcript variant mCT173766"
FT                   /note="gene_id=mCG141206.0 transcript_id=mCT173766.0
FT                   created on 14-NOV-2002"
FT   mRNA            join(14961807..14961984,14962155..14962314,
FT                   14968256..14968335,14998568..14998622,15006929..15007038,
FT                   15019380..15019483,15020854..15020947,15023269..15023364,
FT                   15043766..15043861,15056449..15056704,15059310..15059879,
FT                   15067247..15067291,15068036..15068068,15083612..15083790,
FT                   15094010..15094127,15095352..15095424,15101028..15101182,
FT                   15103428..15103616,15103978..15104066,15104207..15104571,
FT                   15105210..15105306,15106175..15106372,15108193..15108395)
FT                   /locus_tag="mCG_141206"
FT                   /product="mCG141206, transcript variant mCT175861"
FT                   /note="gene_id=mCG141206.0 transcript_id=mCT175861.0
FT                   created on 14-NOV-2002"
FT   CDS             join(14962155..14962314,14968256..14968335,
FT                   14998568..14998622,15006929..15007038,15019380..15019483,
FT                   15020854..15020947,15023269..15023364,15043766..15043861,
FT                   15056449..15056704,15059310..15059879,15067247..15067291,
FT                   15068036..15068068,15083612..15083790,15094010..15094127,
FT                   15095352..15095424,15101028..15101182,15103428..15103616,
FT                   15103978..15104066,15104207..15104571,15105210..15105306,
FT                   15106175..15106372,15108193..15108237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141206"
FT                   /product="mCG141206, isoform CRA_a"
FT                   /note="gene_id=mCG141206.0 transcript_id=mCT173766.0
FT                   protein_id=mCP96685.0 isoform=CRA_a"
FT                   /db_xref="GOA:O54826"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:1329038"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54826"
FT                   /protein_id="EDL08096.1"
FT                   /translation="MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGH
FT                   GCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVV
FT                   CALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCR
FT                   QAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYEQSLSDSSSH
FT                   SQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLKR
FT                   LEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGT
FT                   AVSASSPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDV
FT                   HKGESGSQEAAVNSFSSLVGHPVTSTVISQPKSFDNSPGELGSSSLPTAGYKRAQTSGI
FT                   EEEAVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSVTSSSLQ
FT                   KSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSELLNAIHNGIYNSNDVAV
FT                   SFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQANTVSGSSL
FT                   SQAPAHMYGSRLNQNPSMAVLIAQSESSQTDQDLGDNARSLGGRGSSPRGSLSPRSPVS
FT                   NLQLRYDQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDILGMLKSLHQLQ
FT                   VENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQTAPPPDSLN
FT                   SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQ
FT                   VNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQ
FT                   NPAPLTHTSVPPNAAHPMPAAALTNSASGLGLLSDQQRQMFIQQQQFQQLLNSQQLTPE
FT                   QHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIHGDS
FT                   TSQKVTRLSDKTGPVAQEKS"
FT   CDS             join(14962155..14962314,14968256..14968335,
FT                   14998568..14998622,15006929..15007038,15019380..15019483,
FT                   15020854..15020947,15023269..15023364,15043766..15043861,
FT                   15056449..15056704,15059310..15059879,15067247..15067291,
FT                   15068036..15068068,15083612..15083790,15094010..15094127,
FT                   15095352..15095424,15101028..15101182,15103428..15103616,
FT                   15103978..15104066,15104207..15104571,15105210..15105306,
FT                   15106175..15106372,15108193..15108237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141206"
FT                   /product="mCG141206, isoform CRA_a"
FT                   /note="gene_id=mCG141206.0 transcript_id=mCT175861.0
FT                   protein_id=mCP98783.0 isoform=CRA_a"
FT                   /db_xref="GOA:O54826"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:1329038"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54826"
FT                   /protein_id="EDL08097.1"
FT                   /translation="MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGH
FT                   GCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVV
FT                   CALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCR
FT                   QAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYEQSLSDSSSH
FT                   SQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLKR
FT                   LEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGT
FT                   AVSASSPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDV
FT                   HKGESGSQEAAVNSFSSLVGHPVTSTVISQPKSFDNSPGELGSSSLPTAGYKRAQTSGI
FT                   EEEAVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSVTSSSLQ
FT                   KSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSELLNAIHNGIYNSNDVAV
FT                   SFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQANTVSGSSL
FT                   SQAPAHMYGSRLNQNPSMAVLIAQSESSQTDQDLGDNARSLGGRGSSPRGSLSPRSPVS
FT                   NLQLRYDQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDILGMLKSLHQLQ
FT                   VENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQTAPPPDSLN
FT                   SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQ
FT                   VNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQ
FT                   NPAPLTHTSVPPNAAHPMPAAALTNSASGLGLLSDQQRQMFIQQQQFQQLLNSQQLTPE
FT                   QHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIHGDS
FT                   TSQKVTRLSDKTGPVAQEKS"
FT   gene            15012529..15014814
FT                   /locus_tag="mCG_147233"
FT                   /note="gene_id=mCG147233.0"
FT   mRNA            15012529..15014814
FT                   /locus_tag="mCG_147233"
FT                   /product="mCG147233"
FT                   /note="gene_id=mCG147233.0 transcript_id=mCT187496.0
FT                   created on 13-JAN-2004"
FT   CDS             15014590..15014772
FT                   /codon_start=1
FT                   /locus_tag="mCG_147233"
FT                   /product="mCG147233"
FT                   /note="gene_id=mCG147233.0 transcript_id=mCT187496.0
FT                   protein_id=mCP109116.0"
FT                   /protein_id="EDL08098.1"
FT                   /translation="MGWALPHQSLIKNMLYRGWRDGSVVKSTGCSSEGHEFKSQQPHGG
FT                   SQPSVMRSDALFWCI"
FT   gene            complement(15114560..15289780)
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /note="gene_id=mCG9549.3"
FT   mRNA            complement(join(15114560..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15191361..15191451,
FT                   15204380..15204473,15205322..15205419,15206191..15206356,
FT                   15214306..15214407,15289241..>15289370))
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   transcript variant mCT190107"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT190107.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(15114568..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15182038..15182201,
FT                   15191361..15191451,15204380..15204473,15205322..15205419,
FT                   15206191..15206356,15213765..15213811,15214306..15214407,
FT                   15289241..15289780))
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   transcript variant mCT9636"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT9636.2 created on
FT                   24-SEP-2002"
FT   mRNA            complement(join(15114580..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15182038..15182201,
FT                   15191361..15191451,15289241..>15289371))
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   transcript variant mCT190108"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT190108.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(15114682..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15182038..15182201,
FT                   15191361..15191451,15204380..15204473,15205322..15205419,
FT                   15206191..15206356,15213765..15213811,15214306..15214407,
FT                   15289241..15289450))
FT                   /codon_start=1
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT9636.2
FT                   protein_id=mCP2347.2 isoform=CRA_c"
FT                   /protein_id="EDL08101.1"
FT                   /translation="MWVPGFGSARLPQRRRSGLESSSVRPLWLLLLFLLAAVRPVRAWE
FT                   SGDLELFDLVEEVQLNFYEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQ
FT                   LVAIYEVLKDDERRQRYDDVLINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHY
FT                   AVVWSIYLEKQLDELLGRKKRERKKKTGSKSVDAAKLGASEKNERLLIKPQWHDLLPCK
FT                   LGIWFCLTLKALPHLIQDAGQFYAKYKETKLKEKEDALARIEIETLQKQKKVKVKKPKP
FT                   EFPVYMPLENTYIQSYDHGTSIEEIEEQMDDWLENRKRTQKRQAPEWTEEDLSQLTRSM
FT                   VKFPGGTPGRWDKIAHELGRSVTDVTTKAKELKDSVTSSPGMTRLSELKSNGQNSRPIK
FT                   IATALPDDIITQREDSAGAMEDEEHEAAEGEQESATTEARPRRRKSARAAEAVTRVEPE
FT                   EKLRGKRQKDFDISEQNDSSDEEKQRKERTRAAEEAWTQSQQKLLELALQQYPKGASDR
FT                   WDKIAKCVPSKSKEDCIARYKLLVELVQKKKQAKS"
FT   CDS             complement(join(15114682..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15182038..15182201,
FT                   15191361..15191451,15289241..>15289369))
FT                   /codon_start=1
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT190108.0
FT                   protein_id=mCP111132.0 isoform=CRA_b"
FT                   /protein_id="EDL08100.1"
FT                   /translation="WLLLLFLLAAVRPVRAWESGDLELFDLVEEVQLNFYEFLGVQQDA
FT                   GQFYAKYKETKLKEKEDALARIEIETLQKQKKVKVKKPKPEFPVYMPLENTYIQSYDHG
FT                   TSIEEIEEQMDDWLENRKRTQKRQAPEWTEEDLSQLTRSMVKFPGGTPGRWDKIAHELG
FT                   RSVTDVTTKAKELKDSVTSSPGMTRLSELKSNGQNSRPIKIATALPDDIITQREDSAGA
FT                   MEDEEHEAAEGEQESATTEARPRRRKSARAAEAVTRVEPEEKLRGKRQKDFDISEQNDS
FT                   SDEEKQRKERTRAAEEAWTQSQQKLLELALQQYPKGASDRWDKIAKCVPSKSKEDCIAR
FT                   YKLLVELVQKKKQAKS"
FT   CDS             complement(join(15114682..15114750,15116876..15117324,
FT                   15120141..15120189,15129133..15129252,15191361..>15191408))
FT                   /codon_start=1
FT                   /gene="Dnajc1"
FT                   /locus_tag="mCG_9549"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9549.3 transcript_id=mCT190107.0
FT                   protein_id=mCP111131.0 isoform=CRA_a"
FT                   /protein_id="EDL08099.1"
FT                   /translation="RKKKTHWLELKLKPFKAPEWTEEDLSQLTRSMVKFPGGTPGRWDK
FT                   IAHELGRSVTDVTTKAKELKDSVTSSPGMTRLSELKSNGQNSRPIKIATALPDDIITQR
FT                   EDSAGAMEDEEHEAAEGEQESATTEARPRRRKSARAAEAVTRVEPEEKLRGKRQKDFDI
FT                   SEQNDSSDEEKQRKERTRAAEEAWTQSQQKLLELALQQYPKGASDRWDKIAKCVPSKSK
FT                   EDCIARYKLLVELVQKKKQAKS"
FT   gene            15385936..15386265
FT                   /pseudo
FT                   /locus_tag="mCG_1030095"
FT                   /note="gene_id=mCG1030095.1"
FT   mRNA            15385936..15386265
FT                   /pseudo
FT                   /locus_tag="mCG_1030095"
FT                   /note="gene_id=mCG1030095.1 transcript_id=mCT147799.1
FT                   created on 08-OCT-2002"
FT   gene            complement(15531599..15532430)
FT                   /pseudo
FT                   /locus_tag="mCG_1029987"
FT                   /note="gene_id=mCG1029987.1"
FT   mRNA            complement(join(15531599..15531760,15532047..15532430))
FT                   /pseudo
FT                   /locus_tag="mCG_1029987"
FT                   /note="gene_id=mCG1029987.1 transcript_id=mCT147691.1
FT                   created on 12-FEB-2003"
FT   gene            complement(15540966..15541274)
FT                   /pseudo
FT                   /locus_tag="mCG_49188"
FT                   /note="gene_id=mCG49188.2"
FT   mRNA            complement(15540966..15541274)
FT                   /pseudo
FT                   /locus_tag="mCG_49188"
FT                   /note="gene_id=mCG49188.2 transcript_id=mCT49371.2 created
FT                   on 05-FEB-2003"
FT   gene            <15564347..15568101
FT                   /gene="Commd3"
FT                   /locus_tag="mCG_142308"
FT                   /note="gene_id=mCG142308.0"
FT   mRNA            join(<15564347..15564478,15565777..15565888,
FT                   15566007..15566070,15566163..15566197,15566538..15566598,
FT                   15566690..15566746,15566831..15566890,15567748..15568101)
FT                   /gene="Commd3"
FT                   /locus_tag="mCG_142308"
FT                   /product="COMM domain containing 3"
FT                   /note="gene_id=mCG142308.0 transcript_id=mCT179830.0
FT                   created on 05-FEB-2003"
FT   CDS             join(<15564349..15564478,15565777..15565888,
FT                   15566007..15566070,15566163..15566197,15566538..15566598,
FT                   15566690..15566746,15566831..15566890,15567748..15567807)
FT                   /codon_start=1
FT                   /gene="Commd3"
FT                   /locus_tag="mCG_142308"
FT                   /product="COMM domain containing 3"
FT                   /note="gene_id=mCG142308.0 transcript_id=mCT179830.0
FT                   protein_id=mCP102752.0"
FT                   /protein_id="EDL08102.1"
FT                   /translation="SESVQRGIQTLADPGSFDSNAFALLLRAAFQSLLDARADEAALDH
FT                   PYLKQIDPVVLKHCHAAAATCILEAGKHQVDKSTLSTYLEDCKFDRERIELFCTEYQNN
FT                   KNSLETLLGSIGRSLPHITDVSWRLEYQIKTNQLHKMYRPGYLVTLNVENNDSQSYPEI
FT                   NFSCNMEQLQDLVGKLKDASKSLERATQL"
FT   gene            15569673..15578495
FT                   /locus_tag="mCG_9550"
FT                   /note="gene_id=mCG9550.2"
FT   mRNA            join(15569673..15569697,15573659..15573789,
FT                   15574089..15574185,15574705..15574760,15574847..15574897,
FT                   15575041..15575149,15575235..15575274,15575531..15575629,
FT                   15575852..15575932,15576018..15578495)
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, transcript variant mCT9637"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT9637.2 created on
FT                   23-NOV-2004"
FT   mRNA            join(15572236..15572341,15573659..15573789,
FT                   15574089..15574185,15574705..15574760,15574847..15574897,
FT                   15575041..15575149,15575235..15575274,15575531..15575629,
FT                   15575852..15575932,15576018..15578495)
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, transcript variant mCT194595"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194595.0 created
FT                   on 23-NOV-2004"
FT   CDS             join(15572331..15572341,15573659..15573789,
FT                   15574089..15574185,15574705..15574760,15574847..15574897,
FT                   15575041..15575149,15575235..15575274,15575531..15575629,
FT                   15575852..15575932,15576018..15576347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, isoform CRA_b"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194595.0
FT                   protein_id=mCP115626.0 isoform=CRA_b"
FT                   /protein_id="EDL08105.1"
FT                   /translation="MGVRIFYQAEMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECL
FT                   HSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRR
FT                   RDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPK
FT                   EEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYT
FT                   WRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLP
FT                   SPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG"
FT   mRNA            join(15572884..15572951,15573659..15573789,
FT                   15574089..15574185,15574705..15574760,15574847..15574897,
FT                   15575041..15575149,15575235..15575274,15575531..15575629,
FT                   15575852..15575932,15576018..15578495)
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, transcript variant mCT194596"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194596.0 created
FT                   on 23-NOV-2004"
FT   mRNA            join(15572972..15573085,15573659..15573789,
FT                   15574089..15574185,15574705..15574760,15574847..15574897,
FT                   15575041..15575149,15575235..15575274,15575531..15575629,
FT                   15575852..15575932,15576018..15578495)
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, transcript variant mCT194597"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194597.0 created
FT                   on 23-NOV-2004"
FT   CDS             join(15573678..15573789,15574089..15574185,
FT                   15574705..15574760,15574847..15574897,15575041..15575149,
FT                   15575235..15575274,15575531..15575629,15575852..15575932,
FT                   15576018..15576347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, isoform CRA_a"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194597.0
FT                   protein_id=mCP115624.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q2LC58"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="MGI:MGI:88174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC58"
FT                   /protein_id="EDL08103.1"
FT                   /translation="MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVR
FT                   YLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSA
FT                   DAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLR
FT                   CPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLK
FT                   YRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPH
FT                   PQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG"
FT   CDS             join(15573678..15573789,15574089..15574185,
FT                   15574705..15574760,15574847..15574897,15575041..15575149,
FT                   15575235..15575274,15575531..15575629,15575852..15575932,
FT                   15576018..15576347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, isoform CRA_a"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT194596.0
FT                   protein_id=mCP115625.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q2LC58"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="MGI:MGI:88174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC58"
FT                   /protein_id="EDL08104.1"
FT                   /translation="MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVR
FT                   YLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSA
FT                   DAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLR
FT                   CPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLK
FT                   YRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPH
FT                   PQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG"
FT   CDS             join(15573678..15573789,15574089..15574185,
FT                   15574705..15574760,15574847..15574897,15575041..15575149,
FT                   15575235..15575274,15575531..15575629,15575852..15575932,
FT                   15576018..15576347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9550"
FT                   /product="mCG9550, isoform CRA_a"
FT                   /note="gene_id=mCG9550.2 transcript_id=mCT9637.2
FT                   protein_id=mCP2324.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q2LC58"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="MGI:MGI:88174"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC58"
FT                   /protein_id="EDL08106.1"
FT                   /translation="MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVR
FT                   YLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSA
FT                   DAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLR
FT                   CPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLK
FT                   YRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPH
FT                   PQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG"
FT   gene            <15590980..15641966
FT                   /gene="BC061194"
FT                   /locus_tag="mCG_9552"
FT                   /note="gene_id=mCG9552.1"
FT   mRNA            join(<15590980..15591004,15591078..15591173,
FT                   15602521..15602687,15607696..15607879,15624012..15624217,
FT                   15625071..15625244,15626217..15626369,15629429..15629620,
FT                   15634979..15635095,15637675..15637820,15641682..15641966)
FT                   /gene="BC061194"
FT                   /locus_tag="mCG_9552"
FT                   /product="cDNA sequence BC061194"
FT                   /note="gene_id=mCG9552.1 transcript_id=mCT9639.1 created on
FT                   25-SEP-2002"
FT   CDS             join(15590980..15591004,15591078..15591173,
FT                   15602521..15602687,15607696..15607879,15624012..15624217,
FT                   15625071..15625244,15626217..15626369,15629429..15629620,
FT                   15634979..15635095,15637675..15637820,15641682..15641751)
FT                   /codon_start=1
FT                   /gene="BC061194"
FT                   /locus_tag="mCG_9552"
FT                   /product="cDNA sequence BC061194"
FT                   /note="gene_id=mCG9552.1 transcript_id=mCT9639.1
FT                   protein_id=mCP2352.1"
FT                   /db_xref="GOA:Q3V0U9"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:3040687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0U9"
FT                   /protein_id="EDL08107.1"
FT                   /translation="MSQRQVLQVFELYQNARTRFVQMVAEQATKPQNIETLQNAGIMSL
FT                   LRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAA
FT                   FVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWALAYIARHNAELSQAV
FT                   VDAGAVPLLVLCIQEPETALKRIAASALSDISKHSPELAQTVVDVGAIAHLAQMILNPD
FT                   EKLKQQVLSALSHIAKHSVDLAEMVVEAEIFPVVLTCLKDKDDFVKKNACTLIREIAKH
FT                   TPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYMAAHSENLAMAVIISKGVPQL
FT                   SDCLSEEPEDHIKAAAAWALGQVGRHTPEHARAVAITNTLPVLLALYMSPESSEDLQVK
FT                   SKKAIKNIIQKCTYLPALEPFLYDAPPNILKYVAGQFSKVLPHDSKARRLFVTSGGLKK
FT                   IQEIKAEPGSILQEYINNINSCYPEEIVRYYSPGYSDILLQRIDSYQPLIN"
FT   gene            15651181..15652003
FT                   /pseudo
FT                   /locus_tag="mCG_1029880"
FT                   /note="gene_id=mCG1029880.1"
FT   mRNA            15651181..15652003
FT                   /pseudo
FT                   /locus_tag="mCG_1029880"
FT                   /note="gene_id=mCG1029880.1 transcript_id=mCT147584.1
FT                   created on 25-NOV-2002"
FT   gene            complement(15734115..15892638)
FT                   /gene="Pip5k2a"
FT                   /locus_tag="mCG_9555"
FT                   /note="gene_id=mCG9555.2"
FT   mRNA            complement(join(15734115..15736368,15737783..15737886,
FT                   15739342..15739585,15744702..15744815,15758208..15758246,
FT                   15764385..15764531,15781163..15781315,15798346..15798442,
FT                   15800172..15800269,15892481..15892638))
FT                   /gene="Pip5k2a"
FT                   /locus_tag="mCG_9555"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type
FT                   II, alpha"
FT                   /note="gene_id=mCG9555.2 transcript_id=mCT9641.2 created on
FT                   25-SEP-2002"
FT   CDS             complement(join(15736291..15736368,15737783..15737886,
FT                   15739342..15739585,15744702..15744815,15758208..15758246,
FT                   15764385..15764531,15781163..15781315,15798346..15798442,
FT                   15800172..15800269,15892481..15892624))
FT                   /codon_start=1
FT                   /gene="Pip5k2a"
FT                   /locus_tag="mCG_9555"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type
FT                   II, alpha"
FT                   /note="gene_id=mCG9555.2 transcript_id=mCT9641.2
FT                   protein_id=mCP2302.2"
FT                   /db_xref="GOA:Q544E3"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR016034"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="MGI:MGI:1298206"
FT                   /db_xref="UniProtKB/TrEMBL:Q544E3"
FT                   /protein_id="EDL08108.1"
FT                   /translation="MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGV
FT                   NHSINELSHVQIPVMLMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRER
FT                   FGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYVIKTITSEDVAEMHNILKKYH
FT                   QYIVECHGVTLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREAS
FT                   DKEKAKELPTLKDNDFINEGQKIYIDDNNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIH
FT                   DVERAEQEEVECEENDGEEEGESDSTHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYA
FT                   IKCHENAPRKEVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLD
FT                   FIGHIL"
FT   gene            complement(15864942..15868910)
FT                   /locus_tag="mCG_147242"
FT                   /note="gene_id=mCG147242.0"
FT   mRNA            complement(join(15864942..15865575,15866008..15868910))
FT                   /locus_tag="mCG_147242"
FT                   /product="mCG147242"
FT                   /note="gene_id=mCG147242.0 transcript_id=mCT187505.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15867870..15868214)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147242"
FT                   /product="mCG147242"
FT                   /note="gene_id=mCG147242.0 transcript_id=mCT187505.0
FT                   protein_id=mCP109124.0"
FT                   /protein_id="EDL08109.1"
FT                   /translation="MLEQDSSCGLTTPPPNPFSVDEIMDRHFGTALNSGSRAGLYAYSG
FT                   PCLCVCCILLWVVWLITVQLTSGLCWSLTSCRLVSFSHLLSQCLCIQTNVLDITYLVLF
FT                   FPFSSFLSET"
FT   gene            15892971..15894430
FT                   /locus_tag="mCG_147225"
FT                   /note="gene_id=mCG147225.0"
FT   mRNA            15892971..15894430
FT                   /locus_tag="mCG_147225"
FT                   /product="mCG147225"
FT                   /note="gene_id=mCG147225.0 transcript_id=mCT187488.0
FT                   created on 13-JAN-2004"
FT   CDS             15893096..15893542
FT                   /codon_start=1
FT                   /locus_tag="mCG_147225"
FT                   /product="mCG147225"
FT                   /note="gene_id=mCG147225.0 transcript_id=mCT187488.0
FT                   protein_id=mCP109107.0"
FT                   /protein_id="EDL08110.1"
FT                   /translation="MPFSLLGRSKERIRSQGSSEEGAPRCMGQPGMSGNLRFPCQGPGE
FT                   FVGPRALLRGPGLPQHLGKGPWLLFVNCLPGSPRLELPNLLYPGWAFPCYRILECHSQP
FT                   TLGFFTETPALVKTAMPQSGPFAWNPSFCRPPLPSLILDMHLLI"
FT   gene            <16104973..16208372
FT                   /locus_tag="mCG_10198"
FT                   /note="gene_id=mCG10198.2"
FT   mRNA            join(<16104973..16105036,16107450..16107498,
FT                   16131823..16131940,16134988..16135113,16140309..16140377,
FT                   16140936..16141111,16145070..16145264,16150377..16150560,
FT                   16167141..16167293,16168093..16168198,16184019..16184268,
FT                   16186960..16187096,16191117..16191285,16193528..16193625,
FT                   16194462..16194563,16194943..16195058)
FT                   /locus_tag="mCG_10198"
FT                   /product="mCG10198, transcript variant mCT190089"
FT                   /note="gene_id=mCG10198.2 transcript_id=mCT190089.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(16104979..16105036,16107450..16107498,
FT                   16131823..16131940,16134988..16135113,16140309..16140377,
FT                   16140936..16141111,16145070..16145264,16150377..16150560,
FT                   16167141..16167293,16168093..16168198,16184019..16184268,
FT                   16186960..16187096,16191117..16191285,16193528..16193625,
FT                   16194462..16194563,16194955..16195050,16196045..16196092,
FT                   16198612..16198809,16201938..16202100,16208058..16208372)
FT                   /locus_tag="mCG_10198"
FT                   /product="mCG10198, transcript variant mCT10157"
FT                   /note="gene_id=mCG10198.2 transcript_id=mCT10157.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(<16105020..16105036,16107450..16107498,
FT                   16131823..16131940,16134988..16135113,16140309..16140377,
FT                   16140936..16141111,16145070..16145264,16150377..16150560,
FT                   16167141..16167293,16168093..16168198,16184019..16184268,
FT                   16186960..16187096,16191117..16191285,16193528..16193625,
FT                   16194462..16194563,16194943..16195054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10198"
FT                   /product="mCG10198, isoform CRA_a"
FT                   /note="gene_id=mCG10198.2 transcript_id=mCT190089.0
FT                   protein_id=mCP111078.0 isoform=CRA_a"
FT                   /protein_id="EDL08111.1"
FT                   /translation="DLTPRRMGKKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEE
FT                   DILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNS
FT                   DVKKLLRELEVMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIR
FT                   LLSSSDPDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLALKTLG
FT                   VITCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLMQQTGS
FT                   LKKVLSFAESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGTKI
FT                   AASQAISALCENLSCKEFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANA
FT                   AAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTN
FT                   TLVQSTAALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDE
FT                   PMAVELCRLGALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISD
FT                   GFYDYGRINPGTKLLSLKELCLQELNDQRAILLVNNKSDTSPPPSMEDKSSDVGYGRSI
FT                   SSSSSLRRGSKEKANFRFSAIFGSPTEEKSEPASVRNTILSRAFTKEKGVR"
FT   CDS             join(16107451..16107498,16131823..16131940,
FT                   16134988..16135113,16140309..16140377,16140936..16141111,
FT                   16145070..16145264,16150377..16150560,16167141..16167293,
FT                   16168093..16168198,16184019..16184268,16186960..16187096,
FT                   16191117..16191285,16193528..16193625,16194462..16194563,
FT                   16194955..16195050,16196045..16196092,16198612..16198809,
FT                   16201938..16202100,16208058..16208267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10198"
FT                   /product="mCG10198, isoform CRA_b"
FT                   /note="gene_id=mCG10198.2 transcript_id=mCT10157.2
FT                   protein_id=mCP2296.2 isoform=CRA_b"
FT                   /protein_id="EDL08112.1"
FT                   /translation="MGKKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEEDILAKA
FT                   CEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKLL
FT                   RELEVMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSD
FT                   PDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDK
FT                   EARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLS
FT                   FAESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAI
FT                   SALCENLSCKEFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANAAAEADA
FT                   IDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQST
FT                   AALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVEL
FT                   CRLGALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYG
FT                   RINPGTKLLSLKELCLQELNDQRAILLVNNKSDTSPPPSMEDKSSDVGYGRSISSSSSL
FT                   RRGSKEKANAIFGSPTEEKSEPASVRNTILSRAFTKEKGVSKKKSRLQLICSSYLLWKG
FT                   KGKKEEEKVKEEEEILALPKFTEGSPEKEWNPPPDPEFCVYVLEVTKSILPIVNLKEQI
FT                   EVLAKYVADKMGGKIPKEKLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFK
FT                   ALADKIGVGCSLVRGEYSRGWNEVKLVNEARKGMIGNLPPPEEYIVDLMFHPGNLLKLR
FT                   SKEADLYRFL"
FT   gene            16242578..16247465
FT                   /locus_tag="mCG_141211"
FT                   /note="gene_id=mCG141211.0"
FT   mRNA            join(16242578..16243382,16245828..16245950,
FT                   16246777..16246874,16247007..16247465)
FT                   /locus_tag="mCG_141211"
FT                   /product="mCG141211"
FT                   /note="gene_id=mCG141211.0 transcript_id=mCT173785.0
FT                   created on 25-SEP-2002"
FT   CDS             join(16243237..16243382,16245828..16245927)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141211"
FT                   /product="mCG141211"
FT                   /note="gene_id=mCG141211.0 transcript_id=mCT173785.0
FT                   protein_id=mCP96704.0"
FT                   /protein_id="EDL08113.1"
FT                   /translation="MKPLCTKPPRFTAMFTWPMKISGHKTRQQNQDATRWRGKAQKRSG
FT                   PCRRMVMSPILCMSRTQKSCKLRNKTATSCTEDSAP"
FT   gene            16270464..16293742
FT                   /gene="Msrb2"
FT                   /locus_tag="mCG_10197"
FT                   /note="gene_id=mCG10197.1"
FT   mRNA            join(16270464..16270599,16277013..16277113,
FT                   16282053..16282129,16291976..16292123,16293019..16293742)
FT                   /gene="Msrb2"
FT                   /locus_tag="mCG_10197"
FT                   /product="methionine sulfoxide reductase B2"
FT                   /note="gene_id=mCG10197.1 transcript_id=mCT10155.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(16270503..16270599,16277013..16277113,
FT                   16282053..16282129,16291976..16292123,16293019..16293123)
FT                   /codon_start=1
FT                   /gene="Msrb2"
FT                   /locus_tag="mCG_10197"
FT                   /product="methionine sulfoxide reductase B2"
FT                   /note="gene_id=mCG10197.1 transcript_id=mCT10155.1
FT                   protein_id=mCP2360.2"
FT                   /protein_id="EDL08114.1"
FT                   /translation="MARLLRALRGLPLLQAPGRLARGCAGSGSKDTGSLTKSKRSLSEA
FT                   DWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGMYHCVCCDSPLFSSEKKYCSGTGWP
FT                   SFSEAYGSKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPKPTGQRFCI
FT                   NSVALKFKPSKP"
FT   gene            complement(16340582..16345743)
FT                   /locus_tag="mCG_1030102"
FT                   /note="gene_id=mCG1030102.1"
FT   mRNA            complement(join(16340582..16340760,16340858..16340949,
FT                   16344852..16345051,16345295..16345743))
FT                   /locus_tag="mCG_1030102"
FT                   /product="mCG1030102"
FT                   /note="gene_id=mCG1030102.1 transcript_id=mCT147806.1
FT                   created on 25-SEP-2002"
FT   gene            16344731..16346560
FT                   /gene="Ptf1a"
FT                   /locus_tag="mCG_10195"
FT                   /note="gene_id=mCG10195.1"
FT   mRNA            join(16344731..16345703,16346035..16346560)
FT                   /gene="Ptf1a"
FT                   /locus_tag="mCG_10195"
FT                   /product="pancreas specific transcription factor, 1a"
FT                   /note="gene_id=mCG10195.1 transcript_id=mCT10153.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(16344929..16345703,16346035..16346234)
FT                   /codon_start=1
FT                   /gene="Ptf1a"
FT                   /locus_tag="mCG_10195"
FT                   /product="pancreas specific transcription factor, 1a"
FT                   /note="gene_id=mCG10195.1 transcript_id=mCT10153.1
FT                   protein_id=mCP2327.2"
FT                   /db_xref="GOA:A2ATA7"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:1328312"
FT                   /db_xref="UniProtKB/TrEMBL:A2ATA7"
FT                   /protein_id="EDL08116.1"
FT                   /translation="MDAVLLEHFPGGLDTFPSPYFDEEDFFTDQSSRDPLEDSDELLGD
FT                   EQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDNVSYCCDAGA
FT                   PLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAELQQLRQ
FT                   AANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPL
FT                   RGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWT
FT                   DEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS"
FT   CDS             complement(join(16344985..16345051,16345295..16345488))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030102"
FT                   /product="mCG1030102"
FT                   /note="gene_id=mCG1030102.1 transcript_id=mCT147806.1
FT                   protein_id=mCP50918.1"
FT                   /protein_id="EDL08115.1"
FT                   /translation="MCERSPSKASLMDCMRRRSRTLAACRSCCSSASERTRRRRLAAAA
FT                   AAAPFKPPSRAPGDSTAAHGSSLSSSGSREDWSVKKSSSSK"
FT   gene            16351530..16354055
FT                   /locus_tag="mCG_1029925"
FT                   /note="gene_id=mCG1029925.0"
FT   mRNA            join(16351530..16351772,16353091..16354055)
FT                   /locus_tag="mCG_1029925"
FT                   /product="mCG1029925"
FT                   /note="gene_id=mCG1029925.0 transcript_id=mCT147629.0
FT                   created on 25-SEP-2002"
FT   CDS             16353320..16353583
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029925"
FT                   /product="mCG1029925"
FT                   /note="gene_id=mCG1029925.0 transcript_id=mCT147629.0
FT                   protein_id=mCP50656.1"
FT                   /protein_id="EDL08117.1"
FT                   /translation="MKNTVHSFSVPLKKYYSADLLAPFSRNGWTQGGVEGWDVGMGQGG
FT                   GVGKLNCLLLFPSSLCAAANLSIFSPDNTLKYIIVIPSCLID"
FT   gene            complement(16361898..16453087)
FT                   /gene="4921504E06Rik"
FT                   /locus_tag="mCG_10196"
FT                   /note="gene_id=mCG10196.2"
FT   mRNA            complement(join(16361898..16362248,16374627..16374675,
FT                   16374760..16374840,16376855..16376942,16379443..16379508,
FT                   16379584..16379663,16379990..16380052,16393072..16393320,
FT                   16394159..16394230,16410898..16410963,16415369..16415427,
FT                   16416657..16416804,16423103..16423258,16432841..16432915,
FT                   16439329..16439472,16441435..16441555,16452946..16453086))
FT                   /gene="4921504E06Rik"
FT                   /locus_tag="mCG_10196"
FT                   /product="RIKEN cDNA 4921504E06, transcript variant
FT                   mCT10154"
FT                   /note="gene_id=mCG10196.2 transcript_id=mCT10154.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(16362190..16362248,16374627..16374675,
FT                   16374760..16374840,16376855..16376942,16379443..16379508,
FT                   16379584..16379663,16379990..16380052,16393072..16393320,
FT                   16394159..16394230,16410898..16410963,16415369..16415427,
FT                   16416657..16416804,16423103..16423258,16432841..16432915,
FT                   16439329..16439472,16441435..16441555,16452946..16453052))
FT                   /codon_start=1
FT                   /gene="4921504E06Rik"
FT                   /locus_tag="mCG_10196"
FT                   /product="RIKEN cDNA 4921504E06, isoform CRA_a"
FT                   /note="gene_id=mCG10196.2 transcript_id=mCT10154.2
FT                   protein_id=mCP2329.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CET2"
FT                   /db_xref="MGI:MGI:1918087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CET2"
FT                   /protein_id="EDL08118.1"
FT                   /translation="MAEAETETEEWTKTRGCRKILQTLEGAIEQFKFHSRLAISDDLKV
FT                   GFFTSDHATQTDCSEVFPLKDLTQSTEKLMRIITSLHVDFGFLKDLVQLKFEERLKEES
FT                   WKIVGMLCDKMLEMKRHYQQGEDIMRKSFQQQLCDAIAIIKGMYQKYFEIEDEKAALQD
FT                   ADDVKLNVLRRKLKEKEEIIKNLKNELELYEEFGFKKVDSFAKESSSPKPISEKELLDC
FT                   RAENERLIQIIAELEEESRTAINENAMLEDEVMYLKEISDQDQRTIQKLMDSRERLRYE
FT                   LDCEKLAIQDMISRQKDDIEIKRKFASISTYHGGKRGTMSKGREVSIYATHQTREGTHF
FT                   LRPPLASFSVSPKMKRKFSSKKYINTAAAPATTATETTVTVPATAEIFTHLLEKPSEKH
FT                   VTFLLPSMVPEELFLKYQLVKEEEKKVLENQVEILKNALEDEGKRLERFKKDADQANKN
FT                   WEKKFLILKNSFHVLKNEMFTRQTLYRQYAMTGDTSFNYIKVKPLYVHSTVNMAEPSSP
FT                   PNVPHPPMVDPSNENTRSDQVFPGVTSDSRDNTDSWNREDHFR"
FT   mRNA            complement(join(16392787..16393320,16394159..16394230,
FT                   16410898..16410963,16415369..16415427,16416657..16416804,
FT                   16423103..16423258,16432841..16432915,16439329..16439472,
FT                   16441435..16441555,16452946..16453087))
FT                   /gene="4921504E06Rik"
FT                   /locus_tag="mCG_10196"
FT                   /product="RIKEN cDNA 4921504E06, transcript variant
FT                   mCT173765"
FT                   /note="gene_id=mCG10196.2 transcript_id=mCT173765.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(16392886..16393320,16394159..16394230,
FT                   16410898..16410963,16415369..16415427,16416657..16416804,
FT                   16423103..16423258,16432841..16432915,16439329..16439472,
FT                   16441435..16441555,16452946..16453052))
FT                   /codon_start=1
FT                   /gene="4921504E06Rik"
FT                   /locus_tag="mCG_10196"
FT                   /product="RIKEN cDNA 4921504E06, isoform CRA_b"
FT                   /note="gene_id=mCG10196.2 transcript_id=mCT173765.0
FT                   protein_id=mCP96684.0 isoform=CRA_b"
FT                   /protein_id="EDL08119.1"
FT                   /translation="MAEAETETEEWTKTRGCRKILQTLEGAIEQFKFHSRLAISDDLKV
FT                   GFFTSDHATQTDCSEVFPLKDLTQSTEKLMRIITSLHVDFGFLKDLVQLKFEERLKEES
FT                   WKIVGMLCDKMLEMKRHYQQGEDIMRKSFQQQLCDAIAIIKGMYQKYFEIEDEKAALQD
FT                   ADDVKLNVLRRKLKEKEEIIKNLKNELELYEEFGFKKVDSFAKESSSPKPISEKELLDC
FT                   RAENERLIQIIAELEEESRTAINENAMLEDEVMYLKEISDQDQRTIQKLMDSRERLRYE
FT                   LDCEKLAIQDMISRQKDDIEIKRKFASISTYHGGKRGTMSKGREVSIYATHQTREGTHF
FT                   LRPPLASFSVSPKMKRKFSSKKYINTAAAPATTATETTVTVPATAEIFTHLLEKPSEKH
FT                   VRTMHITTVYYTSRTSCVQSCCLVSLFQAPCLPFSSPLSNTPNTHLRVCALETDQGILV
FT                   SP"
FT   gene            16550995..16551928
FT                   /locus_tag="mCG_10199"
FT                   /note="gene_id=mCG10199.3"
FT   mRNA            16550995..16551928
FT                   /locus_tag="mCG_10199"
FT                   /product="mCG10199"
FT                   /note="gene_id=mCG10199.3 transcript_id=mCT10156.3 created
FT                   on 22-MAY-2003"
FT   CDS             16551372..16551668
FT                   /codon_start=1
FT                   /locus_tag="mCG_10199"
FT                   /product="mCG10199"
FT                   /note="gene_id=mCG10199.3 transcript_id=mCT10156.3
FT                   protein_id=mCP2337.3"
FT                   /protein_id="EDL08120.1"
FT                   /translation="MGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLS
FT                   NGHYDAVFDHSYPNPEYDNWCKQTQIQKKRDEELAKSMAISLSKMYIEQNACS"
FT   gene            complement(16568951..16578372)
FT                   /locus_tag="mCG_147238"
FT                   /note="gene_id=mCG147238.0"
FT   mRNA            complement(join(16568951..16572153,16577941..16578372))
FT                   /locus_tag="mCG_147238"
FT                   /product="mCG147238"
FT                   /note="gene_id=mCG147238.0 transcript_id=mCT187501.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16569780..16570043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147238"
FT                   /product="mCG147238"
FT                   /note="gene_id=mCG147238.0 transcript_id=mCT187501.0
FT                   protein_id=mCP109121.0"
FT                   /protein_id="EDL08121.1"
FT                   /translation="MFLQVITDSLIIESSGIRHHLWCLLSFFGFLYVFLGFLLRICDKA
FT                   TEELILLFEVVVVNIEFVGNRALRSKDKGLCEPPQSLVVVGQ"
FT   gene            16797575..17685403
FT                   /locus_tag="mCG_120838"
FT                   /note="gene_id=mCG120838.1"
FT   mRNA            join(16797575..16798076,17001220..17001300,
FT                   17173186..17173333,17403744..17404027,17536465..17536664,
FT                   17584083..17584281,17588032..17588125,17618033..17618865,
FT                   17634760..17634809,17641002..17641168,17653063..17653208,
FT                   17655952..17656082,17656786..17656933,17660011..17660434,
FT                   17663394..17663577,17672908..17673064,17673649..17673816,
FT                   17676403..17678291)
FT                   /locus_tag="mCG_120838"
FT                   /product="mCG120838, transcript variant mCT181014"
FT                   /note="gene_id=mCG120838.1 transcript_id=mCT181014.0
FT                   created on 24-FEB-2003"
FT   gene            complement(16857669..16859529)
FT                   /pseudo
FT                   /locus_tag="mCG_50625"
FT                   /note="gene_id=mCG50625.2"
FT   mRNA            complement(16857669..16859529)
FT                   /pseudo
FT                   /locus_tag="mCG_50625"
FT                   /note="gene_id=mCG50625.2 transcript_id=mCT50808.2 created
FT                   on 30-SEP-2002"
FT   gene            16883841..16886631
FT                   /pseudo
FT                   /locus_tag="mCG_121805"
FT                   /note="gene_id=mCG121805.2"
FT   mRNA            16883841..16886631
FT                   /pseudo
FT                   /locus_tag="mCG_121805"
FT                   /note="gene_id=mCG121805.2 transcript_id=mCT123017.2
FT                   created on 01-MAY-2003"
FT   gene            complement(16928559..16929354)
FT                   /pseudo
FT                   /locus_tag="mCG_50327"
FT                   /note="gene_id=mCG50327.2"
FT   mRNA            complement(16928559..16929354)
FT                   /pseudo
FT                   /locus_tag="mCG_50327"
FT                   /note="gene_id=mCG50327.2 transcript_id=mCT50510.2 created
FT                   on 30-SEP-2002"
FT   gene            complement(17300938..17307447)
FT                   /locus_tag="mCG_1030106"
FT                   /note="gene_id=mCG1030106.0"
FT   mRNA            complement(join(17300938..17301299,17302026..17302123,
FT                   17307348..17307447))
FT                   /locus_tag="mCG_1030106"
FT                   /product="mCG1030106"
FT                   /note="gene_id=mCG1030106.0 transcript_id=mCT147810.0
FT                   created on 24-FEB-2003"
FT   CDS             complement(17301088..17301213)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030106"
FT                   /product="mCG1030106"
FT                   /note="gene_id=mCG1030106.0 transcript_id=mCT147810.0
FT                   protein_id=mCP50981.1"
FT                   /protein_id="EDL08124.1"
FT                   /translation="MASPIRRLNAEGRGDPKNHIVIGRVLNLTLLDYVESHTHLQ"
FT   gene            17372392..17372885
FT                   /pseudo
FT                   /locus_tag="mCG_1029881"
FT                   /note="gene_id=mCG1029881.1"
FT   mRNA            17372392..17372885
FT                   /pseudo
FT                   /locus_tag="mCG_1029881"
FT                   /note="gene_id=mCG1029881.1 transcript_id=mCT147585.1
FT                   created on 01-MAY-2003"
FT   mRNA            join(17393552..17393654,17403744..17404027,
FT                   17536465..17536664,17584083..17584281,17588032..17588125,
FT                   17618033..17618865,17634094..17634198,17634760..17634809,
FT                   17641002..17641168,17653069..17653208,17655952..17656082,
FT                   17656786..17656933,17660011..17660467,17663394..17663577,
FT                   17672908..17673064,17673649..17673816,17676403..17676522,
FT                   17682782..17682904,17683590..17685403)
FT                   /locus_tag="mCG_120838"
FT                   /product="mCG120838, transcript variant mCT122030"
FT                   /note="gene_id=mCG120838.1 transcript_id=mCT122030.1
FT                   created on 24-FEB-2003"
FT   CDS             join(17584127..17584281,17588032..17588125,
FT                   17618033..17618865,17634094..17634198,17634760..17634809,
FT                   17641002..17641168,17653069..17653208,17655952..17656082,
FT                   17656786..17656933,17660011..17660467,17663394..17663577,
FT                   17672908..17673064,17673649..17673652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120838"
FT                   /product="mCG120838, isoform CRA_b"
FT                   /note="gene_id=mCG120838.1 transcript_id=mCT122030.1
FT                   protein_id=mCP50646.1 isoform=CRA_b"
FT                   /protein_id="EDL08123.1"
FT                   /translation="MPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVY
FT                   YELNDVRNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMRMQREIVYARGDGLVAPRPGSV
FT                   AHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISP
FT                   SPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHV
FT                   IAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGD
FT                   LRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPP
FT                   LVEKQGFAYSTTTIPKDRETRERMQAMEKQIASLTGLVQSALFKGPITSSSKEASSEKM
FT                   VKATANRNQADGAGTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELR
FT                   LQLQQMRQLQKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLCEL
FT                   EDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAVLRIEV
FT                   EAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDASQAAQYVAMEKATAA
FT                   EVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALM
FT                   NPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAK
FT                   NRAVSIEKAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGD
FT                   AAGDKLELSEDSPNSEQELDKIGGESHPLLHPHPLGEATFLDQDLPPRDQAMWSTLAGA
FT                   CLR"
FT   CDS             join(17584127..17584281,17588032..17588125,
FT                   17618033..17618865,17634760..17634809,17641002..17641168,
FT                   17653063..17653208,17655952..17656082,17656786..17656933,
FT                   17660011..17660434,17663394..17663577,17672908..17673064,
FT                   17673649..17673652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120838"
FT                   /product="mCG120838, isoform CRA_a"
FT                   /note="gene_id=mCG120838.1 transcript_id=mCT181014.0
FT                   protein_id=mCP103936.0 isoform=CRA_a"
FT                   /protein_id="EDL08122.1"
FT                   /translation="MPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVY
FT                   YELNDVRNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMRMQREIVYARGDGLVAPRPGSV
FT                   AHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISP
FT                   SPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHV
FT                   IAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGD
FT                   LRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPP
FT                   LVEKQGFAYSTTTIPKDRETSEKMVKATANRNQADGAGTAHVSAGKVLGSVEFSLPPSQ
FT                   PLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQMKKAELEISNKVKETMKRLEDPVQR
FT                   QRTLVEQERQKYLHEEERIVKKLCELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQV
FT                   GEAVATLKGEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRRH
FT                   VTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVP
FT                   LSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGP
FT                   QSPQTPVNGSSMQSLFIEEIHSKAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIP
FT                   NLEMPPASSPVSKGDAAGDKLELSEDSPNSEQELDKIGGESHPLLHPHPLGEATFLDQD
FT                   LPPRDQAMWSTLAGACLR"
FT   gene            complement(17722868..17759126)
FT                   /locus_tag="mCG_120841"
FT                   /note="gene_id=mCG120841.1"
FT   mRNA            complement(join(17722868..17725321,17727974..17728005,
FT                   17729871..17729976,17730290..17730331,17730517..17730642,
FT                   17733837..17733926,17734003..17734076,17734654..17734732,
FT                   17734817..17734972,17735240..17735382,17735907..17736043,
FT                   17736122..17736186,17737934..17738216,17738984..17739044,
FT                   17740185..17740251,17742689..17742725,17746266..17746368,
FT                   17746484..17746642,17758788..17759126))
FT                   /locus_tag="mCG_120841"
FT                   /product="mCG120841"
FT                   /note="gene_id=mCG120841.1 transcript_id=mCT122033.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(join(17723648..17725321,17727974..17728005,
FT                   17729871..17729976,17730290..17730331,17730517..17730642,
FT                   17733837..17733926,17734003..17734076,17734654..17734732,
FT                   17734817..17734972,17735240..17735382,17735907..17736043,
FT                   17736122..17736186,17737934..17738216,17738984..17739033))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120841"
FT                   /product="mCG120841"
FT                   /note="gene_id=mCG120841.1 transcript_id=mCT122033.1
FT                   protein_id=mCP50684.1"
FT                   /protein_id="EDL08125.1"
FT                   /translation="MAQWLRALAACSSRGPEVGGSIRPWKQMYVVLRGHSLYLYKDRRE
FT                   QTTPSEEEQPISVNACLIDISYSETKRRNVFRLTTSDCECLFQAEDRDDMLSWIKTIQE
FT                   SSNLNEEDTGVTNRDLISRRIKEYNSLLSKTEQLPKTPRQSLSIRQTLLGAKSEPKTQS
FT                   PHSPKEESERKLLSKDDTSPPKDKGTWRRGIPSIVRKTFEKKPAATGTFGVRLDDCPPA
FT                   HTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWR
FT                   DLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLRTLKRLIHDLPEHHFET
FT                   LKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLI
FT                   QHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGVLPGDVSDSATSDSA
FT                   KSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFFKKENTEQS
FT                   HSEIKEESKRESETSGSKQRVVVAKESNTKKDSGTTKEEKKIPWEEPSPPHSSKRNRSP
FT                   TLSCRLAMLKEGPRSLLTQKPHCEETGSDSGTLLSTSSQASLLRSSTKKSTSPETKHSE
FT                   FLSIAGTTTSDYSTTSSTTYLTSLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPVE
FT                   TDSESEFPVFPTTLTSDRLFRGKFQEVARVSRRNSEGSEASCTEGSLTPSLDSRRQQFS
FT                   SHRLIECDTLSRKKSARFKSDSGSPGDTRTEKETPALAKMFDVMKKGKSTGSLLTPSRS
FT                   ESEKQEATWKTKIADRLKLRPRAPADDMFGVGNQKPTAETAKRKNIKRRHTLGGHRDAT
FT                   EISVLSFWKAHEQSADKESELSAVNRLKPKCSAQDLSISDWLARERVRTSASDLSRGEG
FT                   LEPQAESPSVLGTPISTHSPPSQQPEARVAATSTLASTSQSPLFTPPQSPDQINRESFQ
FT                   NMSQNASSTANIHPHKQSESPDTKAETPP"
FT   gene            complement(<17770514..>17850596)
FT                   /locus_tag="mCG_9543"
FT                   /note="gene_id=mCG9543.2"
FT   mRNA            complement(join(<17770514..17770592,17772518..17772610,
FT                   17791615..17791639,17793989..17794168,17850519..>17850596))
FT                   /locus_tag="mCG_9543"
FT                   /product="mCG9543"
FT                   /note="gene_id=mCG9543.2 transcript_id=mCT9288.2 created on
FT                   30-SEP-2002"
FT   CDS             complement(join(<17770514..17770592,17772518..17772610,
FT                   17791615..17791639,17793989..17794168,17850519..17850596))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9543"
FT                   /product="mCG9543"
FT                   /note="gene_id=mCG9543.2 transcript_id=mCT9288.2
FT                   protein_id=mCP2326.2"
FT                   /protein_id="EDL08126.1"
FT                   /translation="MATHWTGLPEEDGDKLKACGAASACEVSKNKDGKDQGEPVSPSED
FT                   EPFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPM
FT                   DTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQN"
FT   gene            <17852298..17852978
FT                   /locus_tag="mCG_57369"
FT                   /note="gene_id=mCG57369.2"
FT   mRNA            join(<17852298..17852638,17852729..17852978)
FT                   /locus_tag="mCG_57369"
FT                   /product="mCG57369"
FT                   /note="gene_id=mCG57369.2 transcript_id=mCT57552.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(<17852300..17852638,17852729..17852737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57369"
FT                   /product="mCG57369"
FT                   /note="gene_id=mCG57369.2 transcript_id=mCT57552.2
FT                   protein_id=mCP25420.2"
FT                   /protein_id="EDL08127.1"
FT                   /translation="PLPGDDPGRGVFGLQSPGPGSQARGGRRAGTGVVLARPPTTWAPA
FT                   SSFVPAPRRWAHNSGCFPSAAPGASTSLQLSAGQVLGDGGPFSAAGGARSYGMWSFQIR
FT                   ECPCPPHCKGG"
FT   gene            18022786..18024956
FT                   /locus_tag="mCG_147247"
FT                   /note="gene_id=mCG147247.0"
FT   mRNA            18022786..18024956
FT                   /locus_tag="mCG_147247"
FT                   /product="mCG147247"
FT                   /note="gene_id=mCG147247.0 transcript_id=mCT187510.0
FT                   created on 13-JAN-2004"
FT   CDS             18022887..18023261
FT                   /codon_start=1
FT                   /locus_tag="mCG_147247"
FT                   /product="mCG147247"
FT                   /note="gene_id=mCG147247.0 transcript_id=mCT187510.0
FT                   protein_id=mCP109130.0"
FT                   /protein_id="EDL08128.1"
FT                   /translation="MHLSALRGASLAYRPPTPACPFADSAARGDMGQACDSFRRKSSPL
FT                   LFAFSKPIAAAPRPAISKTPPCQILNAHLSQVNALKRVSAVRSRALEVGRSIPEDFRAW
FT                   RPARSWKAPRSEPAFPLTKP"
FT   gene            complement(18062062..18086735)
FT                   /locus_tag="mCG_17615"
FT                   /note="gene_id=mCG17615.1"
FT   mRNA            complement(join(18062062..18062450,18070499..18070645,
FT                   18075652..18075875,18078026..18078171,18086442..18086735))
FT                   /locus_tag="mCG_17615"
FT                   /product="mCG17615"
FT                   /note="gene_id=mCG17615.1 transcript_id=mCT11509.2 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(18062277..18062450,18070499..18070645,
FT                   18075652..18075875,18078026..18078171,18086442..18086518))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17615"
FT                   /product="mCG17615"
FT                   /note="gene_id=mCG17615.1 transcript_id=mCT11509.2
FT                   protein_id=mCP2291.1"
FT                   /db_xref="InterPro:IPR026150"
FT                   /db_xref="InterPro:IPR027012"
FT                   /db_xref="MGI:MGI:1918483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL11"
FT                   /protein_id="EDL08129.1"
FT                   /translation="MDSPCTSESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTA
FT                   MKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRCSPKKPAVPLRTDHPVMGIQSGKN
FT                   FINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNE
FT                   DVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVP
FT                   KKIRKQKLEKEMKQLEHDISVIEKHKIIYIANK"
FT   gene            18087080..18095098
FT                   /gene="Thnsl1"
FT                   /locus_tag="mCG_1030110"
FT                   /note="gene_id=mCG1030110.2"
FT   mRNA            join(18087080..18087215,18091255..18091411,
FT                   18094333..>18094778)
FT                   /gene="Thnsl1"
FT                   /locus_tag="mCG_1030110"
FT                   /product="threonine synthase-like 1 (bacterial), transcript
FT                   variant mCT147814"
FT                   /note="gene_id=mCG1030110.2 transcript_id=mCT147814.1
FT                   created on 30-SEP-2002"
FT   mRNA            join(<18087092..18087215,18091255..18091411,
FT                   18092761..18095098)
FT                   /gene="Thnsl1"
FT                   /locus_tag="mCG_1030110"
FT                   /product="threonine synthase-like 1 (bacterial), transcript
FT                   variant mCT190106"
FT                   /note="gene_id=mCG1030110.2 transcript_id=mCT190106.0
FT                   created on 08-MAR-2004"
FT   CDS             <18092802..18095051
FT                   /codon_start=1
FT                   /gene="Thnsl1"
FT                   /locus_tag="mCG_1030110"
FT                   /product="threonine synthase-like 1 (bacterial), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1030110.2 transcript_id=mCT190106.0
FT                   protein_id=mCP111079.0 isoform=CRA_b"
FT                   /protein_id="EDL08131.1"
FT                   /translation="KEMLTLTRCHHLKQIAQECLSSLLVKVQSRTQLLLPRASARAESG
FT                   KSWHSTHSLVGDKNIVLMGPPGSGKTTVGRILGDKLGCCVIDVDSDVLEKAWNMSASEK
FT                   LQDVGNERFLEEEGKTVLNLSASGSVISLSGSNPMHDASMWHLKKNGIVVYLDVPLTDI
FT                   ISRLKSMRIDRIVGQNTGASLRDSLKHVRLYYKKWYDARVFCESGASAEEVADKVLDVV
FT                   KRYQDVDSETFISTRHVCLKDHDKKFPPKYFSEAVVEGLASDGGLFVPEKEFPKLSPGE
FT                   WNNLIGATYIERAQVLLERCIHPADIPAAKLGEMIETAYGENFACSKVAPVRHLSGNQF
FT                   ILELFYGPTGSFKDLSLQLMPHIFAYCIPPGCNYVILVATSGDTGSAVLNGFSHLNKND
FT                   KERIAVVTFFPENGVSDFQKAEIIGSQRENGWAIGVRSDFDFCQTAIRKIFNDSDFTGF
FT                   LAVEYGTILSSANSINWARLLPQIVYHASAYLELVNQRFISFGSPVDVCVPTGNFGNVL
FT                   AAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRNRKLAQTFSPSIDILKSSNLER
FT                   HLYLMANKDGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSEGECLAAISTTYN
FT                   ASGYILDPHTAVAKVVADKMQDKSCPVLIASTAHYSKFAPAIMQALGIKELNQTSSSQL
FT                   YLLSSYNALPPPHEALLERMKQKEKMDYQVCVADVDVLKSHAEKLIQNWFVRKSE"
FT   CDS             18094371..>18094778
FT                   /codon_start=1
FT                   /gene="Thnsl1"
FT                   /locus_tag="mCG_1030110"
FT                   /product="threonine synthase-like 1 (bacterial), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1030110.2 transcript_id=mCT147814.1
FT                   protein_id=mCP51257.1 isoform=CRA_a"
FT                   /protein_id="EDL08130.1"
FT                   /translation="MMGIPIRKFICASNQNHVLTDFIKTGHYDLRNRKLAQTFSPSIDI
FT                   LKSSNLERHLYLMANKDGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSEGECL
FT                   AAISTTYNASGYILDPHTAVAKVVADKMQDKS"
FT   gene            <18246726..>18708101
FT                   /gene="Gpr158"
FT                   /locus_tag="mCG_142303"
FT                   /note="gene_id=mCG142303.0"
FT   mRNA            join(<18246726..18248342,18279808..18279913,
FT                   18461018..18461241,18531184..18531252,18621266..18621375,
FT                   18664876..18665114,18690977..18691115,18696002..18696107,
FT                   18705553..18705699,18706644..>18708101)
FT                   /gene="Gpr158"
FT                   /locus_tag="mCG_142303"
FT                   /product="G protein-coupled receptor 158, transcript
FT                   variant mCT179819"
FT                   /note="gene_id=mCG142303.0 transcript_id=mCT179819.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(<18246751..18248342,18279808..18279913,
FT                   18461018..18461241,18531184..18531252,18621266..18621375,
FT                   18664876..18665114,18690977..18692114)
FT                   /gene="Gpr158"
FT                   /locus_tag="mCG_142303"
FT                   /product="G protein-coupled receptor 158, transcript
FT                   variant mCT190161"
FT                   /note="gene_id=mCG142303.0 transcript_id=mCT190161.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<18247405..18248342,18279808..18279913,
FT                   18461018..18461241,18531184..18531252,18621266..18621314)
FT                   /codon_start=1
FT                   /gene="Gpr158"
FT                   /locus_tag="mCG_142303"
FT                   /product="G protein-coupled receptor 158, isoform CRA_b"
FT                   /note="gene_id=mCG142303.0 transcript_id=mCT190161.0
FT                   protein_id=mCP111141.0 isoform=CRA_b"
FT                   /protein_id="EDL08133.1"
FT                   /translation="LLRLSPLFYARQMGAMAYSLLFCLLLAHLGLGEVGASLDPPGRPD
FT                   SPRERTPRGKQHGQQLPRASAPDPSIPWSRSTDGTILAQKLAEEVPVDVASYLYTGDFH
FT                   QLKRANCSGRYELAGLPGKSPSLASSHPSLHGALDTLTHATNFLNMMLQSNKSREQTVQ
FT                   DDLQWYQALVRSLLEGEPSISRAAITFSTESLSTPAPQVFLQATREESRILLQDLSSSA
FT                   HHLANATLETEWFHGLRRKWRPHLHRRGSNQGPRGLGHSWRRRDGLGGDRSHVKWSPPY
FT                   LECENGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDISLQKVDIDQCSSDGWFSGTH
FT                   KCHLNNSEEGVQITIFQEAQRMCQKKPTSACPAEKAAPSVLMIVHALSRRINTCGSLLS
FT                   LSKPCVCCWTLSACWWSTIFAKQRASGHLGSSCWKQYCLVLCSYTFRSLFCTLSQVHFV
FT                   VFS"
FT   gene            complement(18323403..18324072)
FT                   /pseudo
FT                   /locus_tag="mCG_17617"
FT                   /note="gene_id=mCG17617.2"
FT   mRNA            complement(18323403..18324072)
FT                   /pseudo
FT                   /locus_tag="mCG_17617"
FT                   /note="gene_id=mCG17617.2 transcript_id=mCT11251.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(<18461020..18461241,18531184..18531252,
FT                   18621266..18621375,18664876..18665114,18690977..18691115,
FT                   18696002..18696107,18705553..18705699,18706644..18708101)
FT                   /codon_start=1
FT                   /gene="Gpr158"
FT                   /locus_tag="mCG_142303"
FT                   /product="G protein-coupled receptor 158, isoform CRA_a"
FT                   /note="gene_id=mCG142303.0 transcript_id=mCT179819.0
FT                   protein_id=mCP102741.0 isoform=CRA_a"
FT                   /protein_id="EDL08132.1"
FT                   /translation="RGPDHHFSGSTKDVSEETHVCLPCREGCPFCADDRPCFVQEDKYL
FT                   RLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFE
FT                   PSTFRCILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIV
FT                   LVVFWFLVGWTSSMCQNLERDILLVGQGQTSDHLTFNMCLIDRWDYMTAVAEFLFLLWG
FT                   IYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHAH
FT                   LTVTVTIGLLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDP
FT                   EDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCS
FT                   KEDKEGTDHSAAKGTGLVRKNPTESSGNTGRPKEESLKNRVFSLKKSHSTYDHVRDQTV
FT                   ESSSLPMESQEEEATENSTLESLSSKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSE
FT                   KKPGHPRTSMLQKSLSVIASAKEKTLGLAGKTQTLVMEDRAKSQKPKDRETIRKYSNSD
FT                   NVETIPNSGHMEEPRKPQKSGIMKQQRVSLPTANPDVSSGITQIKDNFDIGEVCPWEVY
FT                   DLTPGPMPSEPKAQKHVSIAASEVEQNPASFLKEKSYHKSKATEGLYQANHKSIDKTEV
FT                   CPWEIHSQSLLEDENRLISKTPVLPGRAREENGSQLYTTNMCAGQYEELPHKVVAPKVE
FT                   NENLNQMGDQEKQTSSSVDIIPGSCNSSNNSHQPLTSRAEVCPWEFEPLEQPNAERSVT
FT                   LPASSALSANKIPGPQK"
FT   gene            18944322..18946212
FT                   /pseudo
FT                   /locus_tag="mCG_17614"
FT                   /note="gene_id=mCG17614.2"
FT   mRNA            18944322..18946212
FT                   /pseudo
FT                   /locus_tag="mCG_17614"
FT                   /note="gene_id=mCG17614.2 transcript_id=mCT11508.2 created
FT                   on 30-SEP-2002"
FT   gene            19084521..19348334
FT                   /gene="Myo3a"
FT                   /locus_tag="mCG_125350"
FT                   /note="gene_id=mCG125350.1"
FT   mRNA            join(19084521..19084660,19098075..19098259,
FT                   19102572..19102706,19123820..19123924,19124860..19124959,
FT                   19140407..19140483,19149625..19149770,19152294..19152359,
FT                   19155385..19155540,19175253..19175352,19184050..19184166,
FT                   19185107..19185211,19185307..19185390,19191704..19191906,
FT                   19213177..19213275,19213567..19213681,19239280..19239406,
FT                   19242814..19243024,19249478..19249622,19271648..19271801,
FT                   19274551..19274639,19276473..19276602,19278365..19278444,
FT                   19278885..19278962,19288319..19288524,19295093..19295204,
FT                   19297788..19297950,19304373..19304496,19307483..19308371,
FT                   19309854..19309998,19330170..19330276,19331198..19331238,
FT                   19332207..19332350,19348136..19348334)
FT                   /gene="Myo3a"
FT                   /locus_tag="mCG_125350"
FT                   /product="myosin IIIA, transcript variant mCT126610"
FT                   /note="gene_id=mCG125350.1 transcript_id=mCT126610.1
FT                   created on 26-SEP-2002"
FT   CDS             join(19084654..19084660,19098075..19098259,
FT                   19102572..19102706,19123820..19123924,19124860..19124959,
FT                   19140407..19140483,19149625..19149770,19152294..19152359,
FT                   19155385..19155540,19175253..19175352,19184050..19184166,
FT                   19185107..19185211,19185307..19185390,19191704..19191906,
FT                   19213177..19213275,19213567..19213681,19239280..19239406,
FT                   19242814..19243024,19249478..19249622,19271648..19271801,
FT                   19274551..19274639,19276473..19276602,19278365..19278444,
FT                   19278885..19278962,19288319..19288524,19295093..19295204,
FT                   19297788..19297950,19304373..19304496,19307483..19308371,
FT                   19309854..19309998,19330170..19330276,19331198..19331238,
FT                   19332207..19332350,19348136..19348256)
FT                   /codon_start=1
FT                   /gene="Myo3a"
FT                   /locus_tag="mCG_125350"
FT                   /product="myosin IIIA, isoform CRA_b"
FT                   /note="gene_id=mCG125350.1 transcript_id=mCT126610.1
FT                   protein_id=mCP50865.1 isoform=CRA_b"
FT                   /protein_id="EDL08135.1"
FT                   /translation="MQMTETFEMLPLIGKTIIFDNFPDPSDTWEIIETIGKGTYGKVFK
FT                   VLNKKSGQKAAVKILDPIHDIDEEIEAEYNILRTLSDHPNVVRFYGIYFKKDKINGDKL
FT                   WLVLELCNGGSVTDLVKGFLKRGERMSEPVIAYILHEALMGLQHLHSNKTIHRDVKGNN
FT                   ILLTTEGGVKLVDFGVSAQLSSTRHRLNTSVGTPFWMAPEVIACEQQLDTTYDARCDTW
FT                   SLGITAIELGDGDPPLAELHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYE
FT                   KRPTVSDLLKHKFITQIEGKDVILQKQLMEFIDIHQCLGSTEKARHERIHTKKGNLNRS
FT                   LISSLKDVDDLATLDVLDENTVSEHLEKCYSRDQIYIYVGDILIALNPFQSLGIYSTKL
FT                   SRLYIGAKRTANPPHIFAMADLGYQSMVTYNADQCIVISGESGAGKTESAHLLVQQLTV
FT                   LGKANNRTLQEKILQMNNLVEAFGNACTIINDNSSRFGKYLEMKFTSSGAVVGAQISEY
FT                   LLEKSRVIHQAIGEKNFHIFYYIYAGLAEKKKLALYKLPENKPPRYLQNDNLRTVQDMM
FT                   NNSFYKSQYELIEQCFKVIGFTMEQLGSVYSVLAAILNVGNIEFSSVATEYQMDKSYIC
FT                   NHTALENSASLLCIQADELQEALTSHCVVTRGETIIRPNTVEKAADVRDAMAKTLYGRL
FT                   FSWIVNCINSLLKHDTSPSGDEELNIGILDIFGFENFKRNSFEQLCINIANEQIQYYFN
FT                   QHVFAWEQNEYLNEDVDARVIEYEDNRPLLDMFLQKPMGLLSLLDEESRFPKATDQTLI
FT                   EKFEDNLKSQYFWRPKRMELSFGIHHYAGKVLYSASGFLAKNRDTFPTDIVLLLRSSEN
FT                   SVIRQLVNHPLTKTGNLPLSKTKNIVNYQMWNSEKSTNLTKGETRDVTCHACETTNVKT
FT                   QTVSSYFRYSLMDLLSKMVVGQPHFVRCIKPNNERQARKYDKEKVLLQLRCTGILETAR
FT                   IRRLGYSHRILFANFIKRYYILCYKSSEEPPVSPDTCAAILEKAGLDNWALGKTKVFLK
FT                   YYHVEQLNLMRKEATNKLVLIQASVRAFLGARRYQELQQKRKSSAVIIQSAARRHLLRK
FT                   HGKETSNVKSAAGRSIRAKDQEFDYKKNFETKRESFVKKQTENAVPTNESNTSTPNNKE
FT                   SPSAGKTAPFRAESKATNVESNNRRYHTQKKMSNVYAEGQNQELYIVEDTWAEVSPRQK
FT                   YVQDLEESRKMRKEEKGDAVIQSYCQWYTEGSNFEESKATCLEGRETWERTSCPGLWLT
FT                   EEIYLRKTLDPTLSQKSVYQNADGKEKEHKVSVVTQNAPLGNLERDYHLLGFLGEEDTG
FT                   PVPQAQEEHKAVSIHSKYQSSKKKQQLGKDRLAPPFKNQKILSSSTEVAKTTHNVYPCP
FT                   TKQEGVHHSKMVDERDSKMASKKEAWDLAMFSRQISKLSEEYFILQKNLNEIILAQQLK
FT                   PFYLGIYRHKPINRHVSTHQYLSGVSKGEEPKILRPPRRPRKPKTLNNPEDSTYYYLLH
FT                   KSTQEEKRRPGKDSQGKLLGLEDFYYKEFLPTHYGPKAHSSNAREWKALKEPQAQPIES
FT                   NERCWTASENESLEEERISANPYDYRRLLRKTSQRQRLVQQL"
FT   mRNA            join(<19098092..19098259,19102572..19102706,
FT                   19123820..19123924,19124860..19124959,19140407..19140483,
FT                   19149625..19149770,19152294..19152359,19155385..19155540,
FT                   19175253..19175352,19184050..19184166,19185107..19185211,
FT                   19185307..19185390,19191704..19191906,19213177..19213275,
FT                   19213567..19213681,19239280..19239406,19242814..19243024,
FT                   19249478..19249622,19271648..19271801,19274551..19274639,
FT                   19276473..19276602,19278365..19278444,19278885..19278962,
FT                   19288319..19288524,19295093..19295204,19297788..19297950,
FT                   19307483..19308371,19309854..19309998,19330170..19330276,
FT                   19331198..19331238,19332207..19332350,19348136..19348334)
FT                   /gene="Myo3a"
FT                   /locus_tag="mCG_125350"
FT                   /product="myosin IIIA, transcript variant mCT190138"
FT                   /note="gene_id=mCG125350.1 transcript_id=mCT190138.0
FT                   created on 08-MAR-2004"
FT   CDS             join(19098092..19098259,19102572..19102706,
FT                   19123820..19123924,19124860..19124959,19140407..19140483,
FT                   19149625..19149770,19152294..19152359,19155385..19155540,
FT                   19175253..19175352,19184050..19184166,19185107..19185211,
FT                   19185307..19185390,19191704..19191906,19213177..19213275,
FT                   19213567..19213681,19239280..19239406,19242814..19243024,
FT                   19249478..19249622,19271648..19271801,19274551..19274639,
FT                   19276473..19276602,19278365..19278444,19278885..19278962,
FT                   19288319..19288524,19295093..19295204,19297788..19297950,
FT                   19307483..19307496)
FT                   /codon_start=1
FT                   /gene="Myo3a"
FT                   /locus_tag="mCG_125350"
FT                   /product="myosin IIIA, isoform CRA_a"
FT                   /note="gene_id=mCG125350.1 transcript_id=mCT190138.0
FT                   protein_id=mCP111083.0 isoform=CRA_a"
FT                   /protein_id="EDL08134.1"
FT                   /translation="MLPLIGKTIIFDNFPDPSDTWEIIETIGKGTYGKVFKVLNKKSGQ
FT                   KAAVKILDPIHDIDEEIEAEYNILRTLSDHPNVVRFYGIYFKKDKINGDKLWLVLELCN
FT                   GGSVTDLVKGFLKRGERMSEPVIAYILHEALMGLQHLHSNKTIHRDVKGNNILLTTEGG
FT                   VKLVDFGVSAQLSSTRHRLNTSVGTPFWMAPEVIACEQQLDTTYDARCDTWSLGITAIE
FT                   LGDGDPPLAELHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSDL
FT                   LKHKFITQIEGKDVILQKQLMEFIDIHQCLGSTEKARHERIHTKKGNLNRSLISSLKDV
FT                   DDLATLDVLDENTVSEHLEKCYSRDQIYIYVGDILIALNPFQSLGIYSTKLSRLYIGAK
FT                   RTANPPHIFAMADLGYQSMVTYNADQCIVISGESGAGKTESAHLLVQQLTVLGKANNRT
FT                   LQEKILQMNNLVEAFGNACTIINDNSSRFGKYLEMKFTSSGAVVGAQISEYLLEKSRVI
FT                   HQAIGEKNFHIFYYIYAGLAEKKKLALYKLPENKPPRYLQNDNLRTVQDMMNNSFYKSQ
FT                   YELIEQCFKVIGFTMEQLGSVYSVLAAILNVGNIEFSSVATEYQMDKSYICNHTALENS
FT                   ASLLCIQADELQEALTSHCVVTRGETIIRPNTVEKAADVRDAMAKTLYGRLFSWIVNCI
FT                   NSLLKHDTSPSGDEELNIGILDIFGFENFKRNSFEQLCINIANEQIQYYFNQHVFAWEQ
FT                   NEYLNEDVDARVIEYEDNRPLLDMFLQKPMGLLSLLDEESRFPKATDQTLIEKFEDNLK
FT                   SQYFWRPKRMELSFGIHHYAGKVLYSASGFLAKNRDTFPTDIVLLLRSSENSVIRQLVN
FT                   HPLTKTGNLPLSKTKNIVNYQMWNSEKSTNLTKGETRDVTCHACETTNVKTQTVSSYFR
FT                   YSLMDLLSKMVVGQPHFVRCIKPNNERQARKYDKEKVLLQLRCTGILETARIRRLGYSH
FT                   RILFANFIKRYYILCYKSSEEPPVSPDTCAAILEKAGLDNWALGKTKVFLKYYHVEQLN
FT                   LMRKEATNKLVLIQASVRAFLGARRYQELQQKRKSSAVIIQSGNLL"
FT   gene            complement(19319856..19320678)
FT                   /pseudo
FT                   /locus_tag="mCG_125351"
FT                   /note="gene_id=mCG125351.1"
FT   mRNA            complement(19319856..19320678)
FT                   /pseudo
FT                   /locus_tag="mCG_125351"
FT                   /note="gene_id=mCG125351.1 transcript_id=mCT126611.1
FT                   created on 30-SEP-2002"
FT   gene            19352184..19421655
FT                   /gene="Gad2"
FT                   /locus_tag="mCG_15161"
FT                   /note="gene_id=mCG15161.1"
FT   mRNA            join(19352184..19352604,19353303..19353362,
FT                   19353556..19353705,19354675..19354908,19359270..19359360,
FT                   19359827..19359939,19364806..19364921,19380701..19380780,
FT                   19396837..19396891,19398824..19398940,19400267..19400331,
FT                   19404512..19404590,19411862..19412011,19415532..19415639,
FT                   19415953..19416042,19420834..19421655)
FT                   /gene="Gad2"
FT                   /locus_tag="mCG_15161"
FT                   /product="glutamic acid decarboxylase 2"
FT                   /note="gene_id=mCG15161.1 transcript_id=mCT14311.1 created
FT                   on 30-SEP-2002"
FT   CDS             join(19352529..19352604,19353303..19353362,
FT                   19353556..19353705,19354675..19354908,19359270..19359360,
FT                   19359827..19359939,19364806..19364921,19380701..19380780,
FT                   19396837..19396891,19398824..19398940,19400267..19400331,
FT                   19404512..19404590,19411862..19412011,19415532..19415639,
FT                   19415953..19416042,19420834..19421007)
FT                   /codon_start=1
FT                   /gene="Gad2"
FT                   /locus_tag="mCG_15161"
FT                   /product="glutamic acid decarboxylase 2"
FT                   /note="gene_id=mCG15161.1 transcript_id=mCT14311.1
FT                   protein_id=mCP2303.2"
FT                   /db_xref="GOA:Q548L4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="MGI:MGI:95634"
FT                   /db_xref="UniProtKB/TrEMBL:Q548L4"
FT                   /protein_id="EDL08136.1"
FT                   /translation="MASPGSGFWSFGSEDGSADPENPGTARAWCQVAQKFTGGIGNKLC
FT                   ALLYGDSGKPAEGGGSVTSRAATGKVACTCDQKPCNCPKGDVNYAFLHATDLLPACDGE
FT                   RPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTHC
FT                   QTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLK
FT                   KMREIIGWPGGSGDGIFSPGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHS
FT                   HFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTV
FT                   YGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMG
FT                   VPLQCSALLVREEGLMQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLM
FT                   WRAKGTTGFEAHIDKCLELAEYLYTIIKNREGYEMVFDGKPQHTNVCFWFVPPSLRTLE
FT                   DNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIE
FT                   EIERLGQDL"
FT   gene            19422423..19424424
FT                   /locus_tag="mCG_52615"
FT                   /note="gene_id=mCG52615.2"
FT   mRNA            19422423..19424424
FT                   /locus_tag="mCG_52615"
FT                   /product="mCG52615"
FT                   /note="gene_id=mCG52615.2 transcript_id=mCT52798.2 created
FT                   on 26-SEP-2002"
FT   CDS             19424138..19424335
FT                   /codon_start=1
FT                   /locus_tag="mCG_52615"
FT                   /product="mCG52615"
FT                   /note="gene_id=mCG52615.2 transcript_id=mCT52798.2
FT                   protein_id=mCP25331.2"
FT                   /protein_id="EDL08137.1"
FT                   /translation="MERHRLLTVQVLTLQGLGEGAAPQNMDKGCTGVNIVTGQRSKNIK
FT                   PGIILHVLFCFQVLNANTVY"
FT   gene            19486790..19493305
FT                   /gene="1700092C17Rik"
FT                   /locus_tag="mCG_147228"
FT                   /note="gene_id=mCG147228.0"
FT   mRNA            join(19486790..19486849,19492943..19493305)
FT                   /gene="1700092C17Rik"
FT                   /locus_tag="mCG_147228"
FT                   /product="RIKEN cDNA 1700092C17"
FT                   /note="gene_id=mCG147228.0 transcript_id=mCT187491.0
FT                   created on 13-JAN-2004"
FT   CDS             19493079..19493273
FT                   /codon_start=1
FT                   /gene="1700092C17Rik"
FT                   /locus_tag="mCG_147228"
FT                   /product="RIKEN cDNA 1700092C17"
FT                   /note="gene_id=mCG147228.0 transcript_id=mCT187491.0
FT                   protein_id=mCP109110.0"
FT                   /protein_id="EDL08138.1"
FT                   /translation="MGFLPSAIKEPQIRSLKILLVIRGLKVKTHDLDQFLEETAILAPW
FT                   ISPENMWDPDLWMCVLFLA"
FT   gene            <19505119..19606794
FT                   /gene="Apbb1ip"
FT                   /locus_tag="mCG_15166"
FT                   /note="gene_id=mCG15166.2"
FT   mRNA            join(<19505119..19505251,19547662..19547733,
FT                   19550314..19550401,19554004..19554305,19557559..19557636,
FT                   19564968..19565127,19566630..19566751,19580259..19580345,
FT                   19583789..19586808)
FT                   /gene="Apbb1ip"
FT                   /locus_tag="mCG_15166"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 1 interacting protein, transcript variant
FT                   mCT190057"
FT                   /note="gene_id=mCG15166.2 transcript_id=mCT190057.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<19505120..19505251,19547662..19547733,
FT                   19550314..19550401,19554004..19554305,19557559..19557636,
FT                   19564968..19565127,19566630..19566751,19580259..19580345,
FT                   19583789..19584013)
FT                   /codon_start=1
FT                   /gene="Apbb1ip"
FT                   /locus_tag="mCG_15166"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 1 interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG15166.2 transcript_id=mCT190057.0
FT                   protein_id=mCP111068.0 isoform=CRA_b"
FT                   /protein_id="EDL08140.1"
FT                   /translation="NHSSLLIPVHLGSTRPISGSAPRISAQPPRISASPPRTLLPAVKM
FT                   GESNEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPREEFNYTVGFKDLNESLNALE
FT                   DQDLDALMADLVADISEAEQRTIQAQKESSQNQDRFALLRASDGQGTASGGYGASAAAI
FT                   DVSHHEEALPPPPVEPMLDLLPPPPPPPPPELLSKEEEEAKAKADKIKLALEKLKEAKV
FT                   KKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVF
FT                   EDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLDNKGKKENKETNEKMNAK
FT                   NKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKVCVS
FT                   VFPITTYLRRSTFRKNRGLSHS"
FT   mRNA            join(19505171..19505251,19547662..19547733,
FT                   19550314..19550401,19554004..19554305,19557559..19557636,
FT                   19564968..19565127,19566630..19566751,19580259..19580345,
FT                   19583789..19583932,19588945..19589055,19598035..19598133,
FT                   19598777..19598891,19602591..19602703,19605942..19606794)
FT                   /gene="Apbb1ip"
FT                   /locus_tag="mCG_15166"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 1 interacting protein, transcript variant
FT                   mCT14390"
FT                   /note="gene_id=mCG15166.2 transcript_id=mCT14390.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(19547662..19547733,19550314..19550401,
FT                   19554004..19554305,19557559..19557636,19564968..19565127,
FT                   19566630..19566751,19580259..19580345,19583789..19583932,
FT                   19588945..19589055,19598035..19598133,19598777..19598891,
FT                   19602591..19602703,19605942..19606463)
FT                   /codon_start=1
FT                   /gene="Apbb1ip"
FT                   /locus_tag="mCG_15166"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 1 interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG15166.2 transcript_id=mCT14390.2
FT                   protein_id=mCP2348.2 isoform=CRA_a"
FT                   /db_xref="GOA:B1AYC9"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861354"
FT                   /db_xref="UniProtKB/TrEMBL:B1AYC9"
FT                   /protein_id="EDL08139.1"
FT                   /translation="MGESNEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPREEFNY
FT                   TVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESSQNQDRFALLRASDG
FT                   QGTASGGYGASAAAIDVSHHEEALPPPPVEPMLDLLPPPPPPPPPELLSKEEEEAKAKA
FT                   DKIKLALEKLKEAKVKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDW
FT                   CLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLDNK
FT                   GKKENKETNEKMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRAS
FT                   GIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYI
FT                   KYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARAGLASRWTNLGTVGTPMPAQPS
FT                   TVSSGLKTGTSQPNGQMPQAIPSAGPPLQEAQTQIETTKDEKQGLGNHSPGATRENHRP
FT                   KSSLPPPPPPVRRSSDTCGSPALPSKVKGPGTCTFPHPPENFLPPPPPPPPEEDNSGLL
FT                   PPPPPPPYLEEPPDFVPPPPPPAAVEDSALPPPPPPPPCLSQEITKSSPLPPKKPLVPP
FT                   KRQENQGLPGAPGNSEQDFMSDLMKALQKKRGNIP"
FT   gene            complement(19625854..19627066)
FT                   /locus_tag="mCG_147253"
FT                   /note="gene_id=mCG147253.0"
FT   mRNA            complement(19625854..19627066)
FT                   /locus_tag="mCG_147253"
FT                   /product="mCG147253"
FT                   /note="gene_id=mCG147253.0 transcript_id=mCT187516.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19626219..19626518)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147253"
FT                   /product="mCG147253"
FT                   /note="gene_id=mCG147253.0 transcript_id=mCT187516.0
FT                   protein_id=mCP109135.0"
FT                   /protein_id="EDL08141.1"
FT                   /translation="MGDQPLDVMNYAKLIFFRYLISPCRPDWLCIDQIGFKLTILPQPI
FT                   AAEITDLRPHFQLYLLMHTVQLRMLKKMFLLSLFHLFILPVACRIYSEVETAFL"
FT   gene            19626848..19671616
FT                   /gene="Pdss1"
FT                   /locus_tag="mCG_15159"
FT                   /note="gene_id=mCG15159.3"
FT   mRNA            join(19626848..19627088,19632607..19632671,
FT                   19633079..19633199,19638121..19638251,19643926..19644067,
FT                   19646528..19646639,19646741..19646850,19660896..19660976,
FT                   19661100..19661213,19666918..19666998,19671182..19671616)
FT                   /gene="Pdss1"
FT                   /locus_tag="mCG_15159"
FT                   /product="prenyl (solanesyl) diphosphate synthase, subunit
FT                   1"
FT                   /note="gene_id=mCG15159.3 transcript_id=mCT14308.2 created
FT                   on 26-MAR-2003"
FT   CDS             join(19626963..19627088,19632607..19632671,
FT                   19633079..19633199,19638121..19638251,19643926..19644067,
FT                   19646528..19646639,19646741..19646850,19660896..19660976,
FT                   19661100..19661213,19666918..19666998,19671182..19671322)
FT                   /codon_start=1
FT                   /gene="Pdss1"
FT                   /locus_tag="mCG_15159"
FT                   /product="prenyl (solanesyl) diphosphate synthase, subunit
FT                   1"
FT                   /note="gene_id=mCG15159.3 transcript_id=mCT14308.2
FT                   protein_id=mCP2362.1"
FT                   /protein_id="EDL08142.1"
FT                   /translation="MRWSCWRRGCSWRPTAVGSPRRERPGCVEPLGTRAASDTRAQIPY
FT                   FSLMKILMSASPTMHSISQFHQRTPAMCSCRQTQSGEKYSDPFKLGWRDLKGLYEDIRK
FT                   ELHISTRELKDMSEYYFDGKGKAFRPIIVVLMARACNIHHNNAREMQASQRSIALVAEM
FT                   IHTATLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASVALARIGNTAVVSM
FT                   LAQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVH
FT                   EIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGIATGPVLFACQQFPEMNA
FT                   MIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHKAVREIRKLRPSTERDALIQLS
FT                   ESVLTRDK"
FT   gene            complement(19644588..19645175)
FT                   /pseudo
FT                   /locus_tag="mCG_15158"
FT                   /note="gene_id=mCG15158.2"
FT   mRNA            complement(19644588..19645175)
FT                   /pseudo
FT                   /locus_tag="mCG_15158"
FT                   /note="gene_id=mCG15158.2 transcript_id=mCT14304.2 created
FT                   on 30-SEP-2002"
FT   gene            complement(19671435..>19771831)
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /note="gene_id=mCG15157.3"
FT   mRNA            complement(join(19671435..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684971,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702440..19702616,
FT                   19726514..19726681,19771588..>19771831))
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, transcript variant mCT190167"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT190167.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(19671665..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684971,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702429..19702616,
FT                   19726514..19726681,19771588..>19771763))
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, transcript variant mCT190168"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT190168.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(19671728..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684968,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702440..19702616,
FT                   19726514..19726681,19771588..19771825))
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, transcript variant mCT14307"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT14307.2 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(19673231..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684971,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702440..19702616,
FT                   19726514..19726681,19771588..>19771830))
FT                   /codon_start=1
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, isoform CRA_b"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT190167.0
FT                   protein_id=mCP111142.0 isoform=CRA_b"
FT                   /protein_id="EDL08144.1"
FT                   /translation="SHNTRRREGGWLASGLCGARVPGGLSFLCLFNARGSDAEGWKMAE
FT                   LQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVA
FT                   YQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRT
FT                   HKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKHGNNQPARTGTLSRTNPPTQKPPSPP
FT                   VSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSG
FT                   GSGSRENSGSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISRHNSTTSSTSS
FT                   GGYRRTPSVAAQFSAQPHVNGGPLYSQNSISVAPPPPPMPQLTPQIPLTGFVARVQENI
FT                   ADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYSDPYADGDPAWAPKNYI
FT                   EKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESIMHYT
FT                   D"
FT   CDS             complement(join(19673231..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684968,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702440..19702616,
FT                   19726514..19726681,19771588..19771704))
FT                   /codon_start=1
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, isoform CRA_a"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT14307.2
FT                   protein_id=mCP2340.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TJR5"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR012849"
FT                   /db_xref="InterPro:IPR028456"
FT                   /db_xref="InterPro:IPR028457"
FT                   /db_xref="MGI:MGI:104913"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJR5"
FT                   /protein_id="EDL08143.1"
FT                   /translation="MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRK
FT                   ALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKV
FT                   ARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKHGNNQPART
FT                   GTLSRTNPPTQKPPSPPVSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPG
FT                   RTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTAGPAPGAAPGSQYGTM
FT                   TRQISRHNSTTSSTSSGGYRRTPSVAAQFSAQPHVNGGPLYSQNSISVAPPPPPMPQLT
FT                   PQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYS
FT                   DPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRV
FT                   TGLFPGNYVESIMHYTD"
FT   CDS             complement(join(19673231..19673406,19677937..19678122,
FT                   19681544..19681630,19684795..19684971,19688378..19688478,
FT                   19692066..19692206,19693760..19693860,19702429..>19702440))
FT                   /codon_start=1
FT                   /gene="Abi1"
FT                   /locus_tag="mCG_15157"
FT                   /product="abl-interactor 1, isoform CRA_c"
FT                   /note="gene_id=mCG15157.3 transcript_id=mCT190168.0
FT                   protein_id=mCP111143.0 isoform=CRA_c"
FT                   /protein_id="EDL08145.1"
FT                   /translation="GKHSHGNNQPARTGTLSRTNPPTQKPPSPPVSGRGTLGRNTPYKT
FT                   LEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGI
FT                   PIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVAAQFSA
FT                   QPHVNGGPLYSQNSISVAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDI
FT                   PMFDDSPPPPPPPPVDYEDEEAAVVQYSDPYADGDPAWAPKNYIEKVVAIYDYTKDKDD
FT                   ELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESIMHYTD"
FT   gene            19799892..19846618
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /note="gene_id=mCG15163.1"
FT   mRNA            join(19799892..19799964,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826067..19826295,19831229..19831431,19841904..19841945,
FT                   19842313..19842422,19844164..19846618)
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   transcript variant mCT14312"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT14312.2 created
FT                   on 26-SEP-2002"
FT   mRNA            join(<19799912..19799964,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826067..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842422,19844164..19844564)
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   transcript variant mCT190055"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT190055.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<19799914..19799964,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826067..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842422,19844164..19844176)
FT                   /codon_start=1
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT190055.0
FT                   protein_id=mCP111067.0 isoform=CRA_d"
FT                   /protein_id="EDL08149.1"
FT                   /translation="RRRDKTDRPCQSFGYIKFHAGSWGSWCCCCCVITADRPWDRGRRW
FT                   QLEMADTPSVYETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPG
FT                   FWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLHVIGPFYEIV
FT                   EDKKSSKSSDLTSDLGNVLTSSNAKAVNGKAESSDSGAESEEEEAQEELKGAEQSGSDD
FT                   KKTLKKSADKNLEIIVTNGYKGSFVQDIQSDIHTDSSRSTRSSEDEKPGDESSQQTGHT
FT                   IVCAHQDRNEDPSEDASGIHHLTSDSDSEVYCDSMEQFGQEEYYLGGDPTQHLESSGFC
FT                   EDAQQSPGNGSIGKMWMVAVKGKGEVKHGGEDGRSSSGAPHRETRGGESEDFSSVRRGR
FT                   GNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLIRLQEDMQNVLQRLHK
FT                   LETLTASQAKLSLQTSNQPSSQRPAWWPFEMSPGALAFAIIWPFIAQWLAHLYYQRRRR
FT                   KLN"
FT   mRNA            join(19800766..19800962,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826028..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842423,19844164..19846169)
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   transcript variant mCT174050"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT174050.0 created
FT                   on 26-SEP-2002"
FT   mRNA            join(<19800821..19800962,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826067..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842422,19844164..19846164)
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   transcript variant mCT190054"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT190054.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<19800822..19800962,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826067..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842422,19844164..19844176)
FT                   /codon_start=1
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT190054.0
FT                   protein_id=mCP111066.0 isoform=CRA_c"
FT                   /protein_id="EDL08148.1"
FT                   /translation="GGCPPTAELLRNGGCDWLAGIFRVGERVRYHGRLNLQGLLLEMLF
FT                   LAFHAGSWGSWCCCCCVITADRPWDRGRRWQLEMADTPSVYETRFEAAVKVIQSLPKNG
FT                   SFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYV
FT                   EEMKKIIETMPMTEKVEELLHVIGPFYEIVEDKKSSKSSDLTSDLGNVLTSSNAKAVNG
FT                   KAESSDSGAESEEEEAQEELKGAEQSGSDDKKTLKKSADKNLEIIVTNGYKGSFVQDIQ
FT                   SDIHTDSSRSTRSSEDEKPGDESSQQTGHTIVCAHQDRNEDPSEDASGIHHLTSDSDSE
FT                   VYCDSMEQFGQEEYYLGGDPTQHLESSGFCEDAQQSPGNGSIGKMWMVAVKGKGEVKHG
FT                   GEDGRSSSGAPHRETRGGESEDFSSVRRGRGNRIPHLSEGPKGRQVGSGGDGERWGSDR
FT                   GSRGSLNEQIALVLIRLQEDMQNVLQRLHKLETLTASQAKLSLQTSNQPSSQRPAWWPF
FT                   EMSPGALAFAIIWPFIAQWLAHLYYQRRRRKLN"
FT   CDS             join(19800948..19800962,19801129..19801297,
FT                   19807168..19807288,19809823..19809895,19812118..19812232,
FT                   19819264..19819398,19821370..19821567,19822255..19822361,
FT                   19826028..19826295,19831232..19831431,19841904..19841945,
FT                   19842313..19842423,19844164..19844223)
FT                   /codon_start=1
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT174050.0
FT                   protein_id=mCP96969.0 isoform=CRA_b"
FT                   /protein_id="EDL08147.1"
FT                   /translation="MLFLAFHAGSWGSWCCCCCVITADRPWDRGRRWQLEMADTPSVYE
FT                   TRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDA
FT                   WSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLHVIGPFYEIVEDKKSSKSSDLT
FT                   SDLGNVLTSSNAKAVNGKAESSDSGAESEEEEAQEELKGAEQSGSDDKKTLKKSADKNL
FT                   EIIVTNGYKGSFVQDIQSDIHTDSSRSTRSSEDEKPGDESSQQTGHTIVCAHQDRNEDP
FT                   SEDASGIHHLTSDSDSEVYCDSMEQFGQEESLASFMSNNGHFQYYLGGDPTQHLESSGF
FT                   CEDAQQSPGNGSIGKMWMVAVKGKGEVKHGGEDGRSSSGAPHRETRGGESEDFSSVRRG
FT                   RGNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLIRLQEDMQNVLQRLH
FT                   KLETLTASQAKLSLQTSNQPSSQRPAWWPFEMSPGALAFAIIWPFIAQWLAHLYYQRRR
FT                   RKTKLKKWLFTQEDCWAWTT"
FT   CDS             join(19801222..19801297,19807168..19807288,
FT                   19809823..19809895,19812118..19812232,19819264..19819398,
FT                   19821370..19821567,19822255..19822361,19826067..19826295,
FT                   19831229..19831431,19841904..19841945,19842313..19842422,
FT                   19844164..19844176)
FT                   /codon_start=1
FT                   /gene="Acbd5"
FT                   /locus_tag="mCG_15163"
FT                   /product="acyl-Coenzyme A binding domain containing 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15163.1 transcript_id=mCT14312.2
FT                   protein_id=mCP2318.2 isoform=CRA_a"
FT                   /protein_id="EDL08146.1"
FT                   /translation="MADTPSVYETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQA
FT                   TEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEEL
FT                   LHVIGPFYEIVEDKKSSKSSDLTSDLGNVLTSSNAKAVNGKAESSDSGAESEEEEAQEE
FT                   LKGAEQSGSDDKKTLKKSADKNLEIIVTNGYKGSFVQDIQSDIHTDSSRSTRSSEDEKP
FT                   GDESSQQTGHTIVCAHQDRNEDPSEDASGIHHLTSDSDSEVYCDSMEQFGQEEYYLGGD
FT                   PTQHLESSGFCEDAQQSPGNGSIGKMWMVAVKGKGEVKHGGEDGRSSSGAPHRETRGGE
FT                   SEDFSSVRRGRVGNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLIRLQ
FT                   EDMQNVLQRLHKLETLTASQAKLSLQTSNQPSSQRPAWWPFEMSPGALAFAIIWPFIAQ
FT                   WLAHLYYQRRRRKLN"
FT   gene            complement(19849784..19887573)
FT                   /gene="Mastl"
FT                   /locus_tag="mCG_15155"
FT                   /note="gene_id=mCG15155.2"
FT   mRNA            complement(join(19849784..19850252,19852117..19852218,
FT                   19852553..19852666,19863340..19863478,19864285..19865391,
FT                   19868531..19868703,19871567..19871714,19872158..19872264,
FT                   19877017..19877105,19877695..19877834,19882641..19882778,
FT                   19887332..19887573))
FT                   /gene="Mastl"
FT                   /locus_tag="mCG_15155"
FT                   /product="microtubule associated serine/threonine
FT                   kinase-like"
FT                   /note="gene_id=mCG15155.2 transcript_id=mCT14306.1 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(19850095..19850252,19852117..19852218,
FT                   19852553..19852666,19863340..19863478,19864285..19865391,
FT                   19868531..19868703,19871567..19871714,19872158..19872264,
FT                   19877017..19877105,19877695..19877834,19882641..19882778,
FT                   19887332..19887514))
FT                   /codon_start=1
FT                   /gene="Mastl"
FT                   /locus_tag="mCG_15155"
FT                   /product="microtubule associated serine/threonine
FT                   kinase-like"
FT                   /note="gene_id=mCG15155.2 transcript_id=mCT14306.1
FT                   protein_id=mCP2321.1"
FT                   /db_xref="GOA:Q8C0P0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1914371"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C0P0"
FT                   /protein_id="EDL08150.1"
FT                   /translation="MESASASEENEGGAAIEECVSRIPVPRPPSIEEFTIVKPISRGAF
FT                   GKVYLGQKGGKLYAVKVVKKADMINKNMTHQVQAERDALALSKSPFVVHLYYSLQSASN
FT                   IYLIMEYLIGGDVKSLLHIYGYFDEEMAIKYISEVALALDYLHRHGIIHRDLKPDNMLI
FT                   SNEGHIKLTDFGLSKVTLNRDINMMDILTTPSMSKPKQDYSRTPGQVLSLISSLGFFTP
FT                   VGEKDQDSANMFSAPKSAAQLSRGFICPMSVDQKEPTSYSSKLLKSCFETLSSNPEIPV
FT                   KCLTSNLLQCRKRLGTSSTSSQSHTFVSSVESECHSNPKWERDCQSTESSGCAMSWNAV
FT                   EMLYAKSTSAIKTKTELELALSPIHDSSAIPAAGSNQVTLPRKCFREISWEARDPDNEN
FT                   MTIDKGQSGFCQSSQRSVNSSATSEEHLGKRNYKRNFHLVDSSPCQEIMQSKKNCTEYE
FT                   ANKERQGCRANQSTGLTTEVQNLKLSGCESQQLDYANKENIVTYLTDRQTPEKLHIPTI
FT                   AKNLMSELDEDCELSSKKDCLSSNSVCSDEDRALKTTCVDSDSSFPGVSMMESSLEIQA
FT                   LEPDKSIRDYSFEEPNTEDLFVLPKCQENSLPQDDCHACIQDSSQVSAHPSKAPKALTS
FT                   KINVVAFRSFNSHINASTNSEPSKISITSLDAMDISCDYSGSYPMAVSPTEKGRHYTSH
FT                   QTPNQVKLGTSYRTPKSVRRGAAPVDDGRILGTPDYLAPELLLGTAHGPAVDWWALGVC
FT                   LFEFLTGIPPFNDETPQQVFQNILKRDIPWPEGEEKLSDNAQSAMDMLLTIDDSKRAGM
FT                   RELKQHPLFSEVDWENLQHQTMPFVPQPDDETDTSYFEARNNAQHLTISGFSL"
FT   gene            19888189..19930138
FT                   /gene="Yme1l1"
FT                   /locus_tag="mCG_15167"
FT                   /note="gene_id=mCG15167.2"
FT   mRNA            join(19888189..19888384,19891846..19891977,
FT                   19894155..19894317,19896154..19896252,19899939..19900048,
FT                   19904635..19904785,19906848..19906931,19912834..19912916,
FT                   19915021..19915111,19917986..19918138,19918674..19918806,
FT                   19919588..19919650,19922823..19922935,19924218..19924373,
FT                   19924891..19925042,19926320..19926446,19926538..19926611,
FT                   19927125..19927211,19928692..19930138)
FT                   /gene="Yme1l1"
FT                   /locus_tag="mCG_15167"
FT                   /product="YME1-like 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG15167.2 transcript_id=mCT14391.1 created
FT                   on 26-SEP-2002"
FT   CDS             join(19888352..19888384,19891846..19891977,
FT                   19894155..19894317,19896154..19896252,19899939..19900048,
FT                   19904635..19904785,19906848..19906931,19912834..19912916,
FT                   19915021..19915111,19917986..19918138,19918674..19918806,
FT                   19919588..19919650,19922823..19922935,19924218..19924373,
FT                   19924891..19925042,19926320..19926446,19926538..19926611,
FT                   19927125..19927211,19928692..19928835)
FT                   /codon_start=1
FT                   /gene="Yme1l1"
FT                   /locus_tag="mCG_15167"
FT                   /product="YME1-like 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG15167.2 transcript_id=mCT14391.1
FT                   protein_id=mCP2359.1"
FT                   /protein_id="EDL08151.1"
FT                   /translation="MFSLSSTVQPQVTIPLSHLINAFHSPKNISVSVNTPVSQKQHRDT
FT                   VPEHEAPSSEPVLNLRDLGLSELKIGQIDKMVENLLPGFYKDKRVSSCWHTSHISAQSF
FT                   FENKYGHLDMFSTLRSSSLYRQHPKTLRSICSDLQYFPVFIQSRGFKTLKSRTRRLQST
FT                   SERLVEAQNIAPSFVKGFLLRDRGTDLESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQ
FT                   ALTQKTNDSLRRTRLILFVLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFE
FT                   HVKGVEEAKQELQEVVEFLKNPQKFTVLGGKLPKGILLVGPPGTGKTLLARAVAGEADV
FT                   PFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSR
FT                   QTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEIL
FT                   KWYLNKIKFDKSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKD
FT                   KILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLL
FT                   PENDRWNETRAQLLAQMDVSMGGRVAEELIFGTDHITTGASSDFDNATKIAKRMVTKFG
FT                   MSEKLGVMTYSDTGKLSPETQSAIEQEIRILLRESYERAKHILKTHAKEHKNLAEALLT
FT                   YETLDAKEIQIVLEGKKLEVR"
FT   gene            19939278..19999105
FT                   /locus_tag="mCG_52616"
FT                   /note="gene_id=mCG52616.1"
FT   mRNA            join(19939278..19939908,19944200..19944314,
FT                   19944467..19944640,19958769..19958875,19962009..19962146,
FT                   19965750..19965787,19972930..19972960,19977069..19977117,
FT                   19988922..19988994,19995657..19995730,19998703..19999105)
FT                   /locus_tag="mCG_52616"
FT                   /product="mCG52616"
FT                   /note="gene_id=mCG52616.1 transcript_id=mCT52799.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(19939616..19939908,19944200..19944314,
FT                   19944467..19944640,19958769..19958875,19962009..19962146,
FT                   19965750..19965787,19972930..19972960,19977069..19977117,
FT                   19988922..19988994,19995657..19995730,19998703..19998759)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52616"
FT                   /product="mCG52616"
FT                   /note="gene_id=mCG52616.1 transcript_id=mCT52799.2
FT                   protein_id=mCP25371.2"
FT                   /db_xref="GOA:Q9D4J9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1918231"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4J9"
FT                   /protein_id="EDL08152.1"
FT                   /translation="MGGKYSRGEERRPLGFPGFSALCCCQKTNREETPLGFCDIKARRS
FT                   NLSFGREDPAYLDMAYFPDNDLHMAACAGDLPFVRLYFTLGKYEVNHRDRENRNAMHFA
FT                   CFYGHLELVIYLWRRGCEINVCDNHNITPLMKAVQSWEDKIVCFLLEHHANLHIKDSMG
FT                   NTALHYAVYSGNLATAARLLQYGADIEERTKDNLTPLLLALRENRLKMAQFLVRMEASV
FT                   HAVDSQRRNSLMYAVRCDSPVMVNLILQQGVDINLKDLFGWTALRYAIEGDRDVRTMLL
FT                   ELRKRNRAFQSSENSSIRLINKADAEVTSPTANEKVIEMQDPFTTNEASVEKTQTRRPA
FT                   ESELEVFSLEEEISYKETINNLQQNPGQRSAKTDAATENRSP"
FT   gene            19966803..19968337
FT                   /pseudo
FT                   /locus_tag="mCG_15165"
FT                   /note="gene_id=mCG15165.2"
FT   mRNA            19966803..19968337
FT                   /pseudo
FT                   /locus_tag="mCG_15165"
FT                   /note="gene_id=mCG15165.2 transcript_id=mCT14310.2 created
FT                   on 30-SEP-2002"
FT   gene            20022900..20026494
FT                   /locus_tag="mCG_1030119"
FT                   /note="gene_id=mCG1030119.1"
FT   mRNA            join(20022900..20023098,20024615..20024820,
FT                   20025164..20026494)
FT                   /locus_tag="mCG_1030119"
FT                   /product="mCG1030119"
FT                   /note="gene_id=mCG1030119.1 transcript_id=mCT147823.1
FT                   created on 30-SEP-2002"
FT   CDS             20025381..20025869
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030119"
FT                   /product="mCG1030119"
FT                   /note="gene_id=mCG1030119.1 transcript_id=mCT147823.1
FT                   protein_id=mCP50601.1"
FT                   /protein_id="EDL08153.1"
FT                   /translation="MLVNQRIDLVQEQVDVLWQMAQLSCEHKLPSLCITSVQFENFTRA
FT                   TNLSKALSRYLLQNWTIEFEQTLRELRIAVLQVNSTCLDLSLTEGFSTWISAAFSYFKE
FT                   WIGVDLFGVAVCGGVLLLLWMICKLKAQTRRDRMVETQVLVALEHGASPDIRLSMLKQ"
FT   gene            20053317..20134200
FT                   /gene="Nxph2"
FT                   /locus_tag="mCG_51344"
FT                   /note="gene_id=mCG51344.2"
FT   mRNA            join(20053317..20053611,20131916..20134200)
FT                   /gene="Nxph2"
FT                   /locus_tag="mCG_51344"
FT                   /product="neurexophilin 2"
FT                   /note="gene_id=mCG51344.2 transcript_id=mCT51527.2 created
FT                   on 30-NOV-2004"
FT   CDS             join(20053561..20053611,20131916..20132650)
FT                   /codon_start=1
FT                   /gene="Nxph2"
FT                   /locus_tag="mCG_51344"
FT                   /product="neurexophilin 2"
FT                   /note="gene_id=mCG51344.2 transcript_id=mCT51527.2
FT                   protein_id=mCP39911.2"
FT                   /db_xref="GOA:Q3KP70"
FT                   /db_xref="InterPro:IPR010450"
FT                   /db_xref="InterPro:IPR026845"
FT                   /db_xref="MGI:MGI:107491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KP70"
FT                   /protein_id="EDL08154.1"
FT                   /translation="MSLRPLPLLVVPGLLQLLFCDSEEVIHNTESVDWEDRTVPETLVG
FT                   NLFHSRITSPLRLFVKQPPDPKPSYADNTKNFWDWLANITEIQEQLARTKRRPIVKTGK
FT                   FKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGLGNVSVSLVPPSKV
FT                   VEFEISPQSTLETKESKSFNCHIEYEKTDRAKKTALCNFDPSKICYQEQTQSHVSWLCS
FT                   KPFKVICIHIIFYSVDYKLVQKVCPDYNYHSETPYLSFG"
FT   gene            complement(20242840..20304828)
FT                   /gene="4921517N04Rik"
FT                   /locus_tag="mCG_4844"
FT                   /note="gene_id=mCG4844.1"
FT   mRNA            complement(join(20242840..20244242,20247787..20247840,
FT                   20247930..20248072,20250611..20250733,20270110..20270165,
FT                   20270243..20270420,20275979..20276106,20277518..20277669,
FT                   20277925..20278046,20278216..20278351,20304617..20304828))
FT                   /gene="4921517N04Rik"
FT                   /locus_tag="mCG_4844"
FT                   /product="RIKEN cDNA 4921517N04"
FT                   /note="gene_id=mCG4844.1 transcript_id=mCT3973.1 created on
FT                   26-SEP-2002"
FT   CDS             complement(join(20244098..20244242,20247787..20247840,
FT                   20247930..20248072,20250611..20250733,20270110..20270165,
FT                   20270243..20270420,20275979..20276106,20277518..20277669,
FT                   20277925..20278046,20278216..20278293))
FT                   /codon_start=1
FT                   /gene="4921517N04Rik"
FT                   /locus_tag="mCG_4844"
FT                   /product="RIKEN cDNA 4921517N04"
FT                   /note="gene_id=mCG4844.1 transcript_id=mCT3973.1
FT                   protein_id=mCP19553.2"
FT                   /db_xref="GOA:Q2M2N2"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="MGI:MGI:1924107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2M2N2"
FT                   /protein_id="EDL08155.1"
FT                   /translation="MSREPTPPLPGDMSTSPVAESWCYTQVKVVKFSYMWTINNFSFCR
FT                   EEMGEVLKSSTFSSGPNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKF
FT                   SLLNDKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSV
FT                   VQDSVNVSGHTSTNTLKVPECRLAEDLGNLWENTRFTDCCFFVRGKEFKAHKSVLAARS
FT                   PVFNAMFEHEMEECTKNRVEINDLDPEVFKEMMRFVYTGKAPNLDKMADNLLAAADKYA
FT                   LERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGK
FT                   NWNNNQATDIMETSGWKSMIQSHPHLVAEAFRALASSQCPQFGIPRKRLKQS"
FT   gene            20364471..20428309
FT                   /locus_tag="mCG_141277"
FT                   /note="gene_id=mCG141277.0"
FT   mRNA            join(20364471..20364505,20426400..20426589,
FT                   20428116..20428309)
FT                   /locus_tag="mCG_141277"
FT                   /product="mCG141277"
FT                   /note="gene_id=mCG141277.0 transcript_id=mCT174274.0
FT                   created on 07-OCT-2002"
FT   gene            20413058..20413913
FT                   /pseudo
FT                   /locus_tag="mCG_1029929"
FT                   /note="gene_id=mCG1029929.1"
FT   mRNA            20413058..20413913
FT                   /pseudo
FT                   /locus_tag="mCG_1029929"
FT                   /note="gene_id=mCG1029929.1 transcript_id=mCT147633.1
FT                   created on 25-NOV-2002"
FT   CDS             join(20426479..20426589,20428116..20428172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141277"
FT                   /product="mCG141277"
FT                   /note="gene_id=mCG141277.0 transcript_id=mCT174274.0
FT                   protein_id=mCP97193.0"
FT                   /protein_id="EDL08156.1"
FT                   /translation="MRSNCKAFSQLVIKGERPLVGGTISGLVVLGSIREKARQASKEHP
FT                   SMASASAPAS"
FT   gene            20638408..20638812
FT                   /pseudo
FT                   /locus_tag="mCG_4840"
FT                   /note="gene_id=mCG4840.1"
FT   mRNA            20638408..20638812
FT                   /pseudo
FT                   /locus_tag="mCG_4840"
FT                   /note="gene_id=mCG4840.1 transcript_id=mCT3974.1 created on
FT                   30-SEP-2002"
FT   gene            complement(20732678..20779270)
FT                   /gene="Hnmt"
FT                   /locus_tag="mCG_4841"
FT                   /note="gene_id=mCG4841.1"
FT   mRNA            complement(join(20732678..20733718,20738773..20738866,
FT                   20743980..20744113,20748742..20748849,20775517..20775569,
FT                   20778565..20778711,20779197..20779270))
FT                   /gene="Hnmt"
FT                   /locus_tag="mCG_4841"
FT                   /product="histamine N-methyltransferase, transcript variant
FT                   mCT3975"
FT                   /note="gene_id=mCG4841.1 transcript_id=mCT3975.1 created on
FT                   26-SEP-2002"
FT   mRNA            complement(join(20732704..20733718,20738773..20738866,
FT                   20743980..20744113,20748742..20748849,20775517..20775569,
FT                   20778565..20778711,20778876..>20778958))
FT                   /gene="Hnmt"
FT                   /locus_tag="mCG_4841"
FT                   /product="histamine N-methyltransferase, transcript variant
FT                   mCT190050"
FT                   /note="gene_id=mCG4841.1 transcript_id=mCT190050.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(20733357..20733718,20738773..20738866,
FT                   20743980..20744113,20748742..20748849,20775517..20775569,
FT                   20778565..20778711,20778876..>20778958))
FT                   /codon_start=1
FT                   /gene="Hnmt"
FT                   /locus_tag="mCG_4841"
FT                   /product="histamine N-methyltransferase, isoform CRA_a"
FT                   /note="gene_id=mCG4841.1 transcript_id=mCT190050.0
FT                   protein_id=mCP111033.0 isoform=CRA_a"
FT                   /protein_id="EDL08157.1"
FT                   /translation="GKFCTNSGGSRRLCLEVFSAGQIQSRFKEPNMASCMRSLFSDQGR
FT                   YVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGEAKAEIKILSVGGGAGEVDLQILSK
FT                   VQAQYPGICINNEVVEPSAEQIVKYKELVAKTSNMENIKFSWHKETSSEYQKRMLEEEE
FT                   EPPKWDFIHMIQMLYYVKDIPATLKFFHGLLAASAKILIILVSGTSGWEKLWKKYGSRL
FT                   PRDDLCQYVTSSDLAQILDDLGIKYECYDLVSTMDITDCFIDGNENGDLLWDFLTETCN
FT                   FSKTAPLDLKAEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEANV"
FT   CDS             complement(join(20733357..20733718,20738773..20738866,
FT                   20743980..20744113,20748742..20748849,20775517..20775569,
FT                   20778565..20778701))
FT                   /codon_start=1
FT                   /gene="Hnmt"
FT                   /locus_tag="mCG_4841"
FT                   /product="histamine N-methyltransferase, isoform CRA_b"
FT                   /note="gene_id=mCG4841.1 transcript_id=mCT3975.1
FT                   protein_id=mCP19638.1 isoform=CRA_b"
FT                   /db_xref="GOA:A2AQK4"
FT                   /db_xref="InterPro:IPR016673"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:2153181"
FT                   /db_xref="UniProtKB/TrEMBL:A2AQK4"
FT                   /protein_id="EDL08158.1"
FT                   /translation="MASCMRSLFSDQGRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIA
FT                   RIGEAKAEIKILSVGGGAGEVDLQILSKVQAQYPGICINNEVVEPSAEQIVKYKELVAK
FT                   TSNMENIKFSWHKETSSEYQKRMLEEEEEPPKWDFIHMIQMLYYVKDIPATLKFFHGLL
FT                   AASAKILIILVSGTSGWEKLWKKYGSRLPRDDLCQYVTSSDLAQILDDLGIKYECYDLV
FT                   STMDITDCFIDGNENGDLLWDFLTETCNFSKTAPLDLKAEIMKDLQEPEFSVKKEGKVL
FT                   FNNNLSFIVVEANV"
FT   gene            complement(20801863..>20824680)
FT                   /gene="Trf3"
FT                   /locus_tag="mCG_4833"
FT                   /note="gene_id=mCG4833.2"
FT   mRNA            complement(join(20801863..20801940,20805983..20806077,
FT                   20817101..20817268,20821052..20821143,20823775..20823862,
FT                   20824574..>20824680))
FT                   /gene="Trf3"
FT                   /locus_tag="mCG_4833"
FT                   /product="TBP-related factor 3"
FT                   /note="gene_id=mCG4833.2 transcript_id=mCT3980.2 created on
FT                   03-OCT-2002"
FT   CDS             complement(join(20801864..20801940,20805983..20806077,
FT                   20817101..20817268,20821052..20821143,20823775..20823862,
FT                   20824574..>20824680))
FT                   /codon_start=1
FT                   /gene="Trf3"
FT                   /locus_tag="mCG_4833"
FT                   /product="TBP-related factor 3"
FT                   /note="gene_id=mCG4833.2 transcript_id=mCT3980.2
FT                   protein_id=mCP19572.2"
FT                   /protein_id="EDL08159.1"
FT                   /translation="PSPETPNSNALPVALIASMMPMNPVPGFSGIVPQLQNVVSTANLA
FT                   CKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAA
FT                   RKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSYEPELFPGLIY
FT                   KMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFKKV"
FT   gene            20880872..20888235
FT                   /locus_tag="mCG_4845"
FT                   /note="gene_id=mCG4845.1"
FT   mRNA            join(20880872..20880947,20882301..20882394,
FT                   20882947..20883054,20886501..20886640,20887435..20888235)
FT                   /locus_tag="mCG_4845"
FT                   /product="mCG4845"
FT                   /note="gene_id=mCG4845.1 transcript_id=mCT3978.1 created on
FT                   26-SEP-2002"
FT   CDS             join(20882304..20882394,20882947..20883054,
FT                   20886501..20886640,20887435..20887647)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4845"
FT                   /product="mCG4845"
FT                   /note="gene_id=mCG4845.1 transcript_id=mCT3978.1
FT                   protein_id=mCP19569.2"
FT                   /db_xref="GOA:Q08EA6"
FT                   /db_xref="InterPro:IPR000975"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR020877"
FT                   /db_xref="InterPro:IPR027172"
FT                   /db_xref="MGI:MGI:1916927"
FT                   /db_xref="UniProtKB/TrEMBL:Q08EA6"
FT                   /protein_id="EDL08160.1"
FT                   /translation="MMAFPPQSCVHVLPPKSIQMWEPNHNTMHGSSQSPRNYRVHDSQQ
FT                   MVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEM
FT                   EGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTI
FT                   ILTHQRGKLVNTNFYIESEK"
FT   gene            complement(20894222..21615455)
FT                   /locus_tag="mCG_147249"
FT                   /note="gene_id=mCG147249.0"
FT   mRNA            complement(join(20894222..20894275,21614054..21615455))
FT                   /locus_tag="mCG_147249"
FT                   /product="mCG147249"
FT                   /note="gene_id=mCG147249.0 transcript_id=mCT187512.0
FT                   created on 13-JAN-2004"
FT   gene            20903871..20906377
FT                   /pseudo
FT                   /locus_tag="mCG_4838"
FT                   /note="gene_id=mCG4838.2"
FT   mRNA            join(20903871..20904331,20904415..20906377)
FT                   /pseudo
FT                   /locus_tag="mCG_4838"
FT                   /note="gene_id=mCG4838.2 transcript_id=mCT3986.2 created on
FT                   07-OCT-2002"
FT   gene            20912456..20918123
FT                   /gene="Il1f9"
FT                   /locus_tag="mCG_1029993"
FT                   /note="gene_id=mCG1029993.1"
FT   mRNA            join(20912456..20912599,20912999..20913106,
FT                   20913920..20914059,20917878..20918123)
FT                   /gene="Il1f9"
FT                   /locus_tag="mCG_1029993"
FT                   /product="interleukin 1 family, member 9"
FT                   /note="gene_id=mCG1029993.1 transcript_id=mCT147697.1
FT                   created on 07-OCT-2002"
FT   CDS             join(20912476..20912599,20912999..20913106,
FT                   20913920..20914059,20917878..20918087)
FT                   /codon_start=1
FT                   /gene="Il1f9"
FT                   /locus_tag="mCG_1029993"
FT                   /product="interleukin 1 family, member 9"
FT                   /note="gene_id=mCG1029993.1 transcript_id=mCT147697.1
FT                   protein_id=mCP50896.1"
FT                   /db_xref="GOA:Q3U0P4"
FT                   /db_xref="InterPro:IPR000975"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="MGI:MGI:2449929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U0P4"
FT                   /protein_id="EDL08162.1"
FT                   /translation="MENNEKKNIVYGSDVEMEHERAGLFVSSAMFSKHPFSTHISGRET
FT                   PDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQ
FT                   NPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHY
FT                   IASSKTGNPIFLTSKKGEYYNINFNLDIKS"
FT   gene            20934862..20945148
FT                   /gene="Il1f6"
FT                   /locus_tag="mCG_4836"
FT                   /note="gene_id=mCG4836.2"
FT   mRNA            join(20934862..20934980,20935250..20935307,
FT                   20935396..20935509,20935981..20936120,20943832..20944045,
FT                   20944911..20945148)
FT                   /gene="Il1f6"
FT                   /locus_tag="mCG_4836"
FT                   /product="interleukin 1 family, member 6"
FT                   /note="gene_id=mCG4836.2 transcript_id=mCT3984.2 created on
FT                   26-SEP-2002"
FT   CDS             join(20935292..20935307,20935396..20935509,
FT                   20935981..20936120,20943832..20944044)
FT                   /codon_start=1
FT                   /gene="Il1f6"
FT                   /locus_tag="mCG_4836"
FT                   /product="interleukin 1 family, member 6"
FT                   /note="gene_id=mCG4836.2 transcript_id=mCT3984.2
FT                   protein_id=mCP19647.2"
FT                   /db_xref="GOA:Q149U6"
FT                   /db_xref="InterPro:IPR000975"
FT                   /db_xref="InterPro:IPR003297"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR027163"
FT                   /db_xref="MGI:MGI:1859324"
FT                   /db_xref="UniProtKB/TrEMBL:Q149U6"
FT                   /protein_id="EDL08163.1"
FT                   /translation="MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVT
FT                   ITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPV
FT                   KASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH"
FT   gene            <20996390..21002864
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /note="gene_id=mCG141248.1"
FT   mRNA            join(<20996390..20996561,20996687..20996812,
FT                   20996916..20996968,20999100..20999185,21000249..21000376,
FT                   21000586..21002864)
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta),
FT                   transcript variant mCT190136"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT190136.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(20996390..20996561,20996687..20996816,
FT                   20996916..20996968,20999100..20999185,21000249..21000376,
FT                   21000586..21002847)
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta),
FT                   transcript variant mCT174047"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT174047.0
FT                   created on 26-MAR-2003"
FT   mRNA            join(20996451..20996561,20996916..20996968,
FT                   20999100..20999185,21000249..21000376,21000586..21001514)
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta),
FT                   transcript variant mCT181592"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT181592.0
FT                   created on 26-MAR-2003"
FT   CDS             join(<20996532..20996561,20996687..20996812,
FT                   20996916..20996968,20999100..20999185,21000249..21000376,
FT                   21000586..21000810)
FT                   /codon_start=1
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT190136.0
FT                   protein_id=mCP111093.0 isoform=CRA_c"
FT                   /protein_id="EDL08167.1"
FT                   /translation="LPKLPSLRDKDHGILEEQADNHRLLPGEKGRSDGCFVGSFLTSRS
FT                   RIACFTQGLHTVELMMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISV
FT                   VPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRR
FT                   DMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD"
FT   mRNA            join(20996710..20996968,20999100..20999185,
FT                   21000249..21000376,21000590..21001647)
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta),
FT                   transcript variant mCT181593"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT181593.0
FT                   created on 26-MAR-2003"
FT   CDS             join(20996937..20996968,20999100..20999185,
FT                   21000249..21000376,21000586..21000810)
FT                   /codon_start=1
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT174047.0
FT                   protein_id=mCP96966.0 isoform=CRA_a"
FT                   /protein_id="EDL08164.1"
FT                   /translation="MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISV
FT                   VPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRR
FT                   DMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD"
FT   CDS             join(20996937..20996968,20999100..20999185,
FT                   21000249..21000376,21000586..21000810)
FT                   /codon_start=1
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT181592.0
FT                   protein_id=mCP104515.0 isoform=CRA_a"
FT                   /protein_id="EDL08165.1"
FT                   /translation="MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISV
FT                   VPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRR
FT                   DMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD"
FT   CDS             join(20996937..20996968,20999100..20999185,
FT                   21000249..21000376,21000590..21000592)
FT                   /codon_start=1
FT                   /gene="Il1f5"
FT                   /locus_tag="mCG_141248"
FT                   /product="interleukin 1 family, member 5 (delta), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG141248.1 transcript_id=mCT181593.0
FT                   protein_id=mCP104514.0 isoform=CRA_b"
FT                   /protein_id="EDL08166.1"
FT                   /translation="MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISV
FT                   VPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLE"
FT   gene            21010634..>21013187
FT                   /gene="Il1f10"
FT                   /locus_tag="mCG_61751"
FT                   /note="gene_id=mCG61751.2"
FT   mRNA            join(21010634..21010693,21012183..21012268,
FT                   21012582..21012709,21012975..>21013187)
FT                   /gene="Il1f10"
FT                   /locus_tag="mCG_61751"
FT                   /product="interleukin 1 family, member 10"
FT                   /note="gene_id=mCG61751.2 transcript_id=mCT61934.2 created
FT                   on 07-OCT-2002"
FT   CDS             join(21010662..21010693,21012183..21012268,
FT                   21012582..21012709,21012975..21013187)
FT                   /codon_start=1
FT                   /gene="Il1f10"
FT                   /locus_tag="mCG_61751"
FT                   /product="interleukin 1 family, member 10"
FT                   /note="gene_id=mCG61751.2 transcript_id=mCT61934.2
FT                   protein_id=mCP39920.2"
FT                   /db_xref="GOA:Q3KNF2"
FT                   /db_xref="InterPro:IPR000975"
FT                   /db_xref="InterPro:IPR003297"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR027164"
FT                   /db_xref="MGI:MGI:2652548"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KNF2"
FT                   /protein_id="EDL08168.1"
FT                   /translation="MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCIL
FT                   PNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQR
FT                   SLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR"
FT   gene            21041860..21042524
FT                   /locus_tag="mCG_1030126"
FT                   /note="gene_id=mCG1030126.0"
FT   mRNA            join(21041860..21042077,21042197..21042524)
FT                   /locus_tag="mCG_1030126"
FT                   /product="mCG1030126"
FT                   /note="gene_id=mCG1030126.0 transcript_id=mCT147830.0
FT                   created on 07-OCT-2002"
FT   CDS             join(21041911..21042077,21042197..21042227)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030126"
FT                   /product="mCG1030126"
FT                   /note="gene_id=mCG1030126.0 transcript_id=mCT147830.0
FT                   protein_id=mCP50995.1"
FT                   /protein_id="EDL08169.1"
FT                   /translation="MIISADRGKLVPNLGPLGLGPETTLCTDPSLHQEVSEGPLRDHCS
FT                   VTHTMRLIQESTFLQDTTTH"
FT   gene            21056293..21070434
FT                   /gene="Il1rn"
FT                   /locus_tag="mCG_4837"
FT                   /note="gene_id=mCG4837.2"
FT   mRNA            join(21056293..21056426,21064954..21065005,
FT                   21066900..21066988,21067950..21068062,21068849..21070434)
FT                   /gene="Il1rn"
FT                   /locus_tag="mCG_4837"
FT                   /product="interleukin 1 receptor antagonist"
FT                   /note="gene_id=mCG4837.2 transcript_id=mCT3985.2 created on
FT                   01-OCT-2002"
FT   CDS             join(21056417..21056426,21064954..21065005,
FT                   21066900..21066988,21067950..21068062,21068849..21069064)
FT                   /codon_start=1
FT                   /gene="Il1rn"
FT                   /locus_tag="mCG_4837"
FT                   /product="interleukin 1 receptor antagonist"
FT                   /note="gene_id=mCG4837.2 transcript_id=mCT3985.2
FT                   protein_id=mCP19590.1"
FT                   /db_xref="GOA:Q542W1"
FT                   /db_xref="InterPro:IPR000975"
FT                   /db_xref="InterPro:IPR003297"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR020877"
FT                   /db_xref="InterPro:IPR027166"
FT                   /db_xref="MGI:MGI:96547"
FT                   /db_xref="UniProtKB/TrEMBL:Q542W1"
FT                   /protein_id="EDL08170.1"
FT                   /translation="MASEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGP
FT                   NIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKR
FT                   FTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ"
FT   gene            <21104904..21128697
FT                   /gene="Psd4"
FT                   /locus_tag="mCG_4839"
FT                   /note="gene_id=mCG4839.2"
FT   mRNA            join(<21104904..21105031,21115802..21115930,
FT                   21116174..21116282,21116708..21117062,21119951..21120130,
FT                   21120544..21120624,21120751..21120863,21121054..21121112,
FT                   21121262..21121351,21122401..21122444,21122730..21122890,
FT                   21123912..21123982,21124267..21124430,21124838..21124982,
FT                   21125218..21125361,21126508..21128697)
FT                   /gene="Psd4"
FT                   /locus_tag="mCG_4839"
FT                   /product="pleckstrin and Sec7 domain containing 4"
FT                   /note="gene_id=mCG4839.2 transcript_id=mCT3979.2 created on
FT                   07-OCT-2002"
FT   CDS             join(<21105026..21105031,21115802..21115930,
FT                   21116174..21116282,21116708..21117062,21119951..21120130,
FT                   21120544..21120624,21120751..21120863,21121054..21121112,
FT                   21121262..21121351,21122401..21122444,21122730..21122890,
FT                   21123912..21123982,21124267..21124430,21124838..21124982,
FT                   21125218..21125361,21126508..21126765)
FT                   /codon_start=1
FT                   /gene="Psd4"
FT                   /locus_tag="mCG_4839"
FT                   /product="pleckstrin and Sec7 domain containing 4"
FT                   /note="gene_id=mCG4839.2 transcript_id=mCT3979.2
FT                   protein_id=mCP19594.2"
FT                   /protein_id="EDL08171.1"
FT                   /translation="VQTSCEDDLGHGSPKAPFVDHELIQESDNFEFDLRPATTHPVQPW
FT                   GSQTSQSLSDLTQPILEDLQREDPSRSQETLISQNRGERDAGCFQEPVFCTLAPWGSQT
FT                   SLLEPNCPESEGRGSGPQPSPVSSQDSSPRVLLHSPKWPQDASHLLQKDRSELSSLKEE
FT                   ETEEVPSLRQEAECEDTSRSEDASANQHHVHLASAEGLPESPMPQAQSPEEGWRPSSSR
FT                   EKLANDIRNDKGAWNLALRLYQLNGFRKSEVAAHLRKNNDFSRAVAEAYLSFFQFEGQS
FT                   LDRALRGFLQALVLSGETQERERILYQFSKRFHYCNPGAFPSVDSVHTLTCAIMLLNTD
FT                   LHGQNIGKSMSCQEFVTNLNGLQDGRNFPKELLKALYWSIRSEKLEWAIDEEDADRPEK
FT                   DQPSPSAGKISSPFLQMAQDPTMPTYKQGILARKMHHIADGKKTPWGKRGWKMFHTLLR
FT                   GMVLYFLKGEGQWLDGESLVGHMVDEPVGVHHSLASPATHYTKKPHVFQLRTADWRLYL
FT                   FQAPTAKEMASWIARINLAAATHSAPPFPAAVGSQRRFVRPILPMSPVQSSLEEQHRSH
FT                   ENCLDAASDDLLDLQRNLPERRGRSRELEEYRLRKEYLEHEKTRYETYVQLLVARLHFP
FT                   LGDLALWEDQLGKETDGSQEPRPSLKKSHSSPSLHQEEAPTTAKVKRNISERRTYRKII
FT                   PKRNRNQL"
FT   gene            complement(21140050..21195181)
FT                   /gene="Pax8"
FT                   /locus_tag="mCG_128146"
FT                   /note="gene_id=mCG128146.0"
FT   mRNA            complement(join(21140050..21141113,21142458..21142544,
FT                   21149017..21149118,21155333..21155539,21156018..21156138,
FT                   21160210..21160385,21160648..21160773,21161162..21161250,
FT                   21162510..21162707,21164136..21164301,21194698..21194805,
FT                   21195110..21195181))
FT                   /gene="Pax8"
FT                   /locus_tag="mCG_128146"
FT                   /product="paired box gene 8"
FT                   /note="gene_id=mCG128146.0 transcript_id=mCT129440.0
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(21141037..21141113,21142458..21142544,
FT                   21149017..21149118,21155333..21155539,21156018..21156138,
FT                   21160210..21160385,21160648..21160773,21161162..21161250,
FT                   21162510..21162707,21164136..21164301,21194698..21194722))
FT                   /codon_start=1
FT                   /gene="Pax8"
FT                   /locus_tag="mCG_128146"
FT                   /product="paired box gene 8"
FT                   /note="gene_id=mCG128146.0 transcript_id=mCT129440.0
FT                   protein_id=mCP51315.1"
FT                   /db_xref="GOA:Q00288"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022130"
FT                   /db_xref="MGI:MGI:97492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00288"
FT                   /protein_id="EDL08172.1"
FT                   /translation="MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPC
FT                   DISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFA
FT                   WEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSS
FT                   AVTPPESPQSDSLGSTYSINGLLGIAQPGNDNKRKMDDSDQDSCRLSIDSQSSSSGPRK
FT                   HLRTDTFSQHHLEALECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSALDDGKATLTS
FT                   SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGG
FT                   PAGASVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIA
FT                   GMVAGSEYSGNAYSHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTSATAFDHL"
FT   gene            21162402..21185028
FT                   /locus_tag="mCG_1050961"
FT                   /note="gene_id=mCG1050961.0"
FT   mRNA            join(21162402..21162596,21170797..21170885,
FT                   21180668..21180884,21182426..21183523,21183538..21185028)
FT                   /locus_tag="mCG_1050961"
FT                   /product="mCG1050961"
FT                   /note="gene_id=mCG1050961.0 transcript_id=mCT194750.0
FT                   created on 27-JAN-2005"
FT   CDS             21182887..21183165
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050961"
FT                   /product="mCG1050961"
FT                   /note="gene_id=mCG1050961.0 transcript_id=mCT194750.0
FT                   protein_id=mCP115779.0"
FT                   /protein_id="EDL08173.1"
FT                   /translation="MVWAVSPFKNDLTIRSRDPGSLESTSPLGLLSLSCNCGFNQNITS
FT                   HTCNFISESLGVSENRGPSLSHLSPLVLGQFQSIESFIPSVFMCVRR"
FT   gene            complement(21325634..>21485478)
FT                   /gene="Cacna1b"
FT                   /locus_tag="mCG_20317"
FT                   /note="gene_id=mCG20317.1"
FT   mRNA            complement(join(21325634..21326359,21326701..21326945,
FT                   21327201..21327405,21329136..21329252,21329404..21329539,
FT                   21336193..21336320,21337048..21337160,21341928..21342036,
FT                   21344567..21344663,21351259..21351386,21354340..21354484,
FT                   21356670..21356761,21357916..21357981,21358338..21358454,
FT                   21367741..21367824,21368159..21368269,21369367..21369531,
FT                   21369800..21370001,21370454..21370591,21372249..21372409,
FT                   21373728..21373824,21376635..21376741,21377833..21377892,
FT                   21378207..21378336,21381096..21381222,21398775..21398992,
FT                   21399803..21400567,21406694..21406800,21408625..21408692,
FT                   21411706..21411823,21418245..21418317,21418543..21418674,
FT                   21420902..21421014,21423484..21423596,21427065..21427275,
FT                   21441509..21441565,21442405..21442520,21443782..21443885,
FT                   21453079..21453269,21454605..21454757,21456355..21456446,
FT                   21480602..21480741,21484096..21484201,21485084..>21485478))
FT                   /gene="Cacna1b"
FT                   /locus_tag="mCG_20317"
FT                   /product="calcium channel, voltage-dependent, N type, alpha
FT                   1B subunit, transcript variant mCT174077"
FT                   /note="gene_id=mCG20317.1 transcript_id=mCT174077.0 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(21325634..21326359,21326701..21326945,
FT                   21327201..21327405,21329136..21329252,21329404..21329539,
FT                   21336193..21336320,21337048..21337160,21337629..21337736,
FT                   21341928..21342036,21344567..21344663,21351259..21351386,
FT                   21354340..21354484,21356670..21356761,21357916..21357981,
FT                   21358338..21358454,21367741..21367824,21368159..21368269,
FT                   21369367..21369531,21369800..21370001,21370454..21370591,
FT                   21372249..21372409,21373728..21373824,21376635..21376741,
FT                   21377833..21377892,21378207..21378336,21381096..21381222,
FT                   21398775..21398992,21399803..21400567,21406694..21406800,
FT                   21408625..21408692,21411706..21411823,21418245..21418317,
FT                   21418543..21418674,21420902..21421014,21423484..21423596,
FT                   21427065..21427275,21441509..21441565,21442405..21442520,
FT                   21443782..21443885,21453079..21453269,21454605..21454757,
FT                   21456355..21456446,21480602..21480741,21484096..21484201,
FT                   21485084..>21485478))
FT                   /gene="Cacna1b"
FT                   /locus_tag="mCG_20317"
FT                   /product="calcium channel, voltage-dependent, N type, alpha
FT                   1B subunit, transcript variant mCT20415"
FT                   /note="gene_id=mCG20317.1 transcript_id=mCT20415.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(21325829..21326359,21326701..21326945,
FT                   21327201..21327405,21329136..21329252,21329404..21329539,
FT                   21336193..21336320,21337048..21337160,21341928..21342036,
FT                   21344567..21344663,21351259..21351386,21354340..21354484,
FT                   21356670..21356761,21357916..21357981,21358338..21358454,
FT                   21367741..21367824,21368159..21368269,21369367..21369531,
FT                   21369800..21370001,21370454..21370591,21372249..21372409,
FT                   21373728..21373824,21376635..21376741,21377833..21377892,
FT                   21378207..21378336,21381096..21381222,21398775..21398992,
FT                   21399803..21400567,21406694..21406800,21408625..21408692,
FT                   21411706..21411823,21418245..21418317,21418543..21418674,
FT                   21420902..21421014,21423484..21423596,21427065..>21427275))
FT                   /codon_start=1
FT                   /gene="Cacna1b"
FT                   /locus_tag="mCG_20317"
FT                   /product="calcium channel, voltage-dependent, N type, alpha
FT                   1B subunit, isoform CRA_a"
FT                   /note="gene_id=mCG20317.1 transcript_id=mCT174077.0
FT                   protein_id=mCP96996.0 isoform=CRA_a"
FT                   /protein_id="EDL08174.1"
FT                   /translation="GSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVKAQSFYWVVL
FT                   CVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRSYFRSSFNC
FT                   FDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMK
FT                   SIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQILTGEDWN
FT                   AVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEEEM
FT                   EEAANQKLALQKAKEVAEVSPMSAANISIAAQQNSAKARSVWEQRASQLRLQNLRASCE
FT                   ALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVVEPGRDGLRGPVGSKSKPEGTEATES
FT                   ADLPRRHHRHRDRDKTSATAPAGGEQDRTESTETGPREERARPRRSHSKETPGADTQVR
FT                   CERSRRHHRRGSPEEATEREPRRHRAHRHAQDSSKEGTAPVLVPKGERRARHRGPRTGP
FT                   REAENNEEPTRRHRARHKVPPTLQPPEREAAEKESNAVEGDKETRNHQPKEPHCDLEAI
FT                   AVTGVGPLHMLPSTCLQKVDEQPEDADNQRNVTRMGSQPSDPSTTVHVPVTLTGPPGET
FT                   PVVPSGNMNLEGQAEGKKEAEADDVLRRGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMR
FT                   YFEMVILVVIALSSIALAAEDPVRTDSFRNNALKYMDYIFTGVFTFEMVIKMIDLGLLL
FT                   HPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVLRPLKTIKRLPKL
FT                   KAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
FT                   DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSP
FT                   GFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAIS
FT                   AKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLK
FT                   CLNIVFTSMFSMECILKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLS
FT                   FLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNI
FT                   ALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGNRACDPHANASECGSDF
FT                   AYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACG
FT                   RISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIRT
FT                   ALEIKLAPADEMTVGKVYAALMIFDFYKQNKTTRDQTHQAPGGLSQMGPVSLFHPLKAT
FT                   LEQTQPAVLRGARVFLRQKSATSLSNGGAIQTQESGIKESLSWGTQRTQDALYEARAPL
FT                   ERGHSAEIPVGQSGTLAVDVQMQNMTLRGPDGEPQPGLESQGRAASMPRLAAETQPAPN
FT                   ASPMKRSISTLAPRPHGTQLCSTVLDRPPPSQASHHHHHRCHRRRDKKQRSLEKGPSLS
FT                   VDPEGAPSTAAGPGLPHGEGSTACRRDRKQERGRSQERRQPSSSSSEKQRFYSCDRFGS
FT                   REPPQLMPSLSSHPTSPTAALEPAPHPQGSGSVNGSPLMSTSGASTPGRGGRRQLPQTP
FT                   LTPRPSITYKTANSSPVHFAEGQSGLPAFSPGRLSRGLSEHNALLQKEPLSQPLAPGSR
FT                   IGSDPYLGQRLDSEASAHTLPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPN
FT                   GYHCTLGLSTGVRARHSYHHPDQDHWC"
FT   CDS             complement(join(21325829..21326359,21326701..21326945,
FT                   21327201..21327405,21329136..21329252,21329404..21329539,
FT                   21336193..21336320,21337048..21337160,21337629..21337736,
FT                   21341928..21342036,21344567..21344663,21351259..21351386,
FT                   21354340..21354484,21356670..21356761,21357916..21357981,
FT                   21358338..21358454,21367741..21367824,21368159..21368269,
FT                   21369367..21369531,21369800..21370001,21370454..21370591,
FT                   21372249..21372409,21373728..21373824,21376635..21376741,
FT                   21377833..21377892,21378207..21378336,21381096..21381222,
FT                   21398775..21398992,21399803..21400567,21406694..21406800,
FT                   21408625..21408692,21411706..21411823,21418245..21418317,
FT                   21418543..21418674,21420902..21421014,21423484..21423596,
FT                   21427065..>21427275))
FT                   /codon_start=1
FT                   /gene="Cacna1b"
FT                   /locus_tag="mCG_20317"
FT                   /product="calcium channel, voltage-dependent, N type, alpha
FT                   1B subunit, isoform CRA_b"
FT                   /note="gene_id=mCG20317.1 transcript_id=mCT20415.2
FT                   protein_id=mCP19646.2 isoform=CRA_b"
FT                   /protein_id="EDL08175.1"
FT                   /translation="GSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVKAQSFYWVVL
FT                   CVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRSYFRSSFNC
FT                   FDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMK
FT                   SIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQILTGEDWN
FT                   AVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEEEM
FT                   EEAANQKLALQKAKEVAEVSPMSAANISIAAQQNSAKARSVWEQRASQLRLQNLRASCE
FT                   ALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVVEPGRDGLRGPVGSKSKPEGTEATES
FT                   ADLPRRHHRHRDRDKTSATAPAGGEQDRTESTETGPREERARPRRSHSKETPGADTQVR
FT                   CERSRRHHRRGSPEEATEREPRRHRAHRHAQDSSKEGTAPVLVPKGERRARHRGPRTGP
FT                   REAENNEEPTRRHRARHKVPPTLQPPEREAAEKESNAVEGDKETRNHQPKEPHCDLEAI
FT                   AVTGVGPLHMLPSTCLQKVDEQPEDADNQRNVTRMGSQPSDPSTTVHVPVTLTGPPGET
FT                   PVVPSGNMNLEGQAEGKKEAEADDVLRRGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMR
FT                   YFEMVILVVIALSSIALAAEDPVRTDSFRNNALKYMDYIFTGVFTFEMVIKMIDLGLLL
FT                   HPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVLRPLKTIKRLPKL
FT                   KAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
FT                   DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSP
FT                   GFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAIS
FT                   AKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLK
FT                   CLNIVFTSMFSMECILKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLS
FT                   FLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNI
FT                   ALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGNRACDPHANASECGSDF
FT                   AYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACG
FT                   RISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIRT
FT                   ALEIKLAPAGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMI
FT                   FDFYKQNKTTRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSATS
FT                   LSNGGAIQTQESGIKESLSWGTQRTQDALYEARAPLERGHSAEIPVGQSGTLAVDVQMQ
FT                   NMTLRGPDGEPQPGLESQGRAASMPRLAAETQPAPNASPMKRSISTLAPRPHGTQLCST
FT                   VLDRPPPSQASHHHHHRCHRRRDKKQRSLEKGPSLSVDPEGAPSTAAGPGLPHGEGSTA
FT                   CRRDRKQERGRSQERRQPSSSSSEKQRFYSCDRFGSREPPQLMPSLSSHPTSPTAALEP
FT                   APHPQGSGSVNGSPLMSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAEGQ
FT                   SGLPAFSPGRLSRGLSEHNALLQKEPLSQPLAPGSRIGSDPYLGQRLDSEASAHTLPED
FT                   TLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVRARHSYHHPDQ
FT                   DHWC"
FT   gene            complement(21513067..>21641645)
FT                   /gene="Ehmt1"
FT                   /locus_tag="mCG_128165"
FT                   /note="gene_id=mCG128165.1"
FT   mRNA            complement(join(21513067..21514425,21514576..21514751,
FT                   21523768..21523846,21524282..21524368,21525257..21525372,
FT                   21526186..21526263,21527003..21527147,21527317..21527484,
FT                   21528457..21528611,21535784..21535888,21537989..21538090,
FT                   21547091..21547213,21558499..21558605,21559679..21559761,
FT                   21560804..21560971,21561633..21561859,21562739..21562882,
FT                   21570048..21570193,21574766..21574903,21578707..21578827,
FT                   21585305..21585493,21585854..21586011,21599560..21599731,
FT                   21606192..21606748,21609036..21609102,21641608..21641638))
FT                   /gene="Ehmt1"
FT                   /locus_tag="mCG_128165"
FT                   /product="euchromatic histone methyltransferase 1,
FT                   transcript variant mCT129459"
FT                   /note="gene_id=mCG128165.1 transcript_id=mCT129459.1
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(21513509..21514425,21514576..21514751,
FT                   21523768..21523846,21524282..21524368,21525257..21525372,
FT                   21526186..21526263,21527003..21527147,21527317..21527484,
FT                   21528457..21528611,21535784..21535888,21537989..21538090,
FT                   21547091..21547213,21558499..21558605,21559679..21559761,
FT                   21560804..21560971,21561633..21561859,21562739..21562882,
FT                   21570048..21570193,21574766..21574903,21578707..21578827,
FT                   21585305..21585493,21585854..21585990,21599560..21599731,
FT                   21606192..21606748,21609036..21609102,21641608..>21641645))
FT                   /gene="Ehmt1"
FT                   /locus_tag="mCG_128165"
FT                   /product="euchromatic histone methyltransferase 1,
FT                   transcript variant mCT190029"
FT                   /note="gene_id=mCG128165.1 transcript_id=mCT190029.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(21514245..21514425,21514576..21514751,
FT                   21523768..21523846,21524282..21524368,21525257..21525372,
FT                   21526186..21526263,21527003..21527147,21527317..21527484,
FT                   21528457..21528611,21535784..21535888,21537989..21538090,
FT                   21547091..21547213,21558499..21558605,21559679..21559761,
FT                   21560804..21560971,21561633..21561859,21562739..21562882,
FT                   21570048..21570193,21574766..21574903,21578707..21578827,
FT                   21585305..21585493,21585854..21585990,21599560..21599731,
FT                   21606192..21606748,21609036..21609102,21641608..>21641643))
FT                   /codon_start=1
FT                   /gene="Ehmt1"
FT                   /locus_tag="mCG_128165"
FT                   /product="euchromatic histone methyltransferase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG128165.1 transcript_id=mCT190029.0
FT                   protein_id=mCP111063.0 isoform=CRA_b"
FT                   /protein_id="EDL08177.1"
FT                   /translation="LRARAMAAADAEQAVLAKQETKQDCCMKTELLREDTPMAADEGST
FT                   EKQEGETPMAADGETNGSCEKSGDPSHLNAPKHTQENTRASPQEGTNRVSRVAENGVSE
FT                   RDTEVGKQNHVTADDFMQTSVIGSNGYFLNKPALQGQPLRTPNILTSSLPGHAAKTLPG
FT                   GASKCRTLSALPQTPTTAPTVPGEGSADTEDRKPTASGTDVRVHRARKTMPKSILGLHA
FT                   ASKDHREVQDHKEPKEDINRNISECGRQQLLPTFPALHQSLPQNQCYMATTKSQTAAAV
FT                   SRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGAKGEKALDDSALHVNGESL
FT                   EMDSEDEDSDELEDDEDHGAEQAAAFPTEDSRTSKESMSETDRAAKSSESSIKKKFLKR
FT                   RGKTDSPWIKPARKRRRRSRKKPSSMLGSEACKSSPGSMEQAALGDSAGYMEVSLDSLD
FT                   LRVRGILSSQTENEGLASGPDVLGTDGLQEVPLCSCRMETPKSREISTLANNQCMATES
FT                   VDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQ
FT                   PESSISHRFHKDCASRVNNASYCPHCGEEASKAKEVTIAKADTTSTVTLAPGQEKSLAA
FT                   EGRADTTTGSIAGAPEDERSQSTAPQAPECFDPAGPAGLVRPTSGLSQGPGKETLESAL
FT                   IALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQSKRSPLHAAAEA
FT                   GHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLDAVKYLIKAGAQVDPKDAEGSTC
FT                   LHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVELVKLLLSKGSDINI
FT                   RDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLS
FT                   RDSDVTLKNKEGETPLQCASLSSQVWSALQMSKALRDSAPDKPVAVEKTVSRDIARGYE
FT                   RIPIPCVNAVDSELCPTNYKYVSQNCVTSPMNIDRNITHLQYCVCVDDCSSSTCMCGQL
FT                   SMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTQDMG
FT                   WGVRSLQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVS
FT                   RFINHHCEPNLVPVRVFMSHQDLRFPRIAFFSTRLIQAGEQLGFDYGERFWDVKGKLFS
FT                   CRCGSSKCRHSSAALAQRQASAAQEPQENGLPDTSSAAAADPL"
FT   CDS             complement(join(21514245..21514425,21514576..21514751,
FT                   21523768..21523846,21524282..21524368,21525257..21525372,
FT                   21526186..21526263,21527003..21527147,21527317..21527484,
FT                   21528457..21528611,21535784..21535888,21537989..21538090,
FT                   21547091..21547213,21558499..21558605,21559679..21559761,
FT                   21560804..21560971,21561633..21561859,21562739..21562882,
FT                   21570048..21570193,21574766..21574903,21578707..21578827,
FT                   21585305..21585493,21585854..21586011,21599560..21599731,
FT                   21606192..21606748,21609036..21609102,21641608..21641628))
FT                   /codon_start=1
FT                   /gene="Ehmt1"
FT                   /locus_tag="mCG_128165"
FT                   /product="euchromatic histone methyltransferase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG128165.1 transcript_id=mCT129459.1
FT                   protein_id=mCP50727.1 isoform=CRA_a"
FT                   /protein_id="EDL08176.1"
FT                   /translation="MAAADAEQAVLAKQETKQDCCMKTELLREDTPMAADEGSTEKQEG
FT                   ETPMAADGETNGSCEKSGDPSHLNAPKHTQENTRASPQEGTNRVSRVAENGVSERDTEV
FT                   GKQNHVTADDFMQTSVIGSNGYFLNKPALQGQPLRTPNILTSSLPGHAAKTLPGGASKC
FT                   RTLSALPQTPTTAPTVPGEGSADTEDRKPTASGTDVRVHRARKTMPKSILGLHAASKDH
FT                   REVQDHKEPKEDINRNISECGRQQLLPTFPALHQSLPQNQCYMATTKSQTACLPFVLAA
FT                   AVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGAKGEKALDDSALHVNGE
FT                   SLEMDSEDEDSDELEDDEDHGAEQAAAFPTEDSRTSKESMSETDRAAKSSESSIKKKFL
FT                   KRRGKTDSPWIKPARKRRRRSRKKPSSMLGSEACKSSPGSMEQAALGDSAGYMEVSLDS
FT                   LDLRVRGILSSQTENEGLASGPDVLGTDGLQEVPLCSCRMETPKSREISTLANNQCMAT
FT                   ESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFME
FT                   CQPESSISHRFHKDCASRVNNASYCPHCGEEASKAKEVTIAKADTTSTVTLAPGQEKSL
FT                   AAEGRADTTTGSIAGAPEDERSQSTAPQAPECFDPAGPAGLVRPTSGLSQGPGKETLES
FT                   ALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQSKRSPLHAAA
FT                   EAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLDAVKYLIKAGAQVDPKDAEGS
FT                   TCLHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVELVKLLLSKGSDI
FT                   NIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLF
FT                   LSRDSDVTLKNKEGETPLQCASLSSQVWSALQMSKALRDSAPDKPVAVEKTVSRDIARG
FT                   YERIPIPCVNAVDSELCPTNYKYVSQNCVTSPMNIDRNITHLQYCVCVDDCSSSTCMCG
FT                   QLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTQD
FT                   MGWGVRSLQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGN
FT                   VSRFINHHCEPNLVPVRVFMSHQDLRFPRIAFFSTRLIQAGEQLGFDYGERFWDVKGKL
FT                   FSCRCGSSKCRHSSAALAQRQASAAQEPQENGLPDTSSAAAADPL"
FT   CDS             complement(21614490..21614798)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147249"
FT                   /product="mCG147249"
FT                   /note="gene_id=mCG147249.0 transcript_id=mCT187512.0
FT                   protein_id=mCP109132.0"
FT                   /protein_id="EDL08161.1"
FT                   /translation="MRIKPGACPCSAILPTIPLCGLHACVCVHVPVCMRAGNGVHTLVH
FT                   INETLCQKQGGYLLGCVAQGLPLASTFSSNSWLKSFGLNRSKSKFFAYLPCQNSFQS"
FT   gene            complement(21647499..21657418)
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /note="gene_id=mCG20307.1"
FT   mRNA            complement(join(21647499..21647823,21647903..21648341,
FT                   21648419..21648595,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21649876..21649986,21657243..21657418))
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, transcript variant
FT                   mCT20408"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT20408.2 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(21647500..21647823,21647903..21648341,
FT                   21648419..21648595,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21657243..21657393))
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, transcript variant
FT                   mCT174292"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT174292.0 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(<21647501..21647554,21648504..21648595,
FT                   21648692..21648874,21649025..21649179,21649273..21649323,
FT                   21649876..21649986,21657243..>21657382))
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, transcript variant
FT                   mCT190023"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190023.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<21647501..21647554,21648504..21648595,
FT                   21648692..21648874,21649025..21649179,21649273..21649323,
FT                   21649876..21649986,21657243..>21657381))
FT                   /codon_start=1
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190023.0
FT                   protein_id=mCP111020.0 isoform=CRA_b"
FT                   /protein_id="EDL08179.1"
FT                   /translation="RGAGDRGMGRVQLFEIRLSQGRVVYGPGEPLAGAVHLRLGAPLPF
FT                   RAIRVTCMGSCGVSTKANDGAWVVEESYFNSSLSLADKGSLPAGEHNFPFQFLLPATAP
FT                   TSFEGPFGKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASTTKKF
FT                   SYKLVKTGNVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQKVSYKAKRW
FT                   IYDVRTIAEVEGTGVKAWRRAQAAEIWAWRDCINKALYL"
FT   mRNA            complement(join(21647502..21647823,21647903..21648595,
FT                   21648730..21648874,21649025..21649179,21649273..21649323,
FT                   21649876..21649986,21657243..>21657362))
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, transcript variant
FT                   mCT190025"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190025.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(<21647753..21647823,21647903..21648341,
FT                   21648419..21648592,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21649876..21649986,21657243..>21657360))
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, transcript variant
FT                   mCT190024"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190024.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(21647753..21647823,21647903..21648341,
FT                   21648419..21648595,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21657243..21657360))
FT                   /codon_start=1
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT174292.0
FT                   protein_id=mCP97211.0 isoform=CRA_a"
FT                   /protein_id="EDL08178.1"
FT                   /translation="MGRVQLFEIRLSQGRVVYGPGEPLAGAVHLRLGAPLPFRGSLPAG
FT                   EHNFPFQFLLPATAPTSFEGPFGKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSI
FT                   PDIEQPNVASTTKKFSYKLVKTGNVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPV
FT                   VASLLQKVSYKAKRWIYDVRTIAEVEGTGVKAWRRAQWQEQILVPALPQSALPGCSLIH
FT                   IDYYLQVSMKAPEATVTLPLFVGNIAVNQTPLSPCPGRESSPGTLSLVVPSAPPQEEAE
FT                   AVASGPHFSDPVSLSTKSHSQQQPLSAPLGSVSVTTTEPWVQVGSPARHSLHPPLCISI
FT                   GATVPYFAEGSAGPVPTTSALILPPEYSSWGYPYEAPPSYEQSCGAAGTDLGLIPGS"
FT   CDS             complement(join(21647753..21647823,21647903..21648341,
FT                   21648419..21648592,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21649876..21649986,21657243..21657360))
FT                   /codon_start=1
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190024.0
FT                   protein_id=mCP111021.0 isoform=CRA_c"
FT                   /protein_id="EDL08180.1"
FT                   /translation="MGRVQLFEIRLSQGRVVYGPGEPLAGAVHLRLGAPLPFRAIRVTC
FT                   MGSCGVSTKANDGAWVVEESYFNSSLSLADKGSLPAGEHNFPFQFLLPATAPTSFEGPF
FT                   GKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASTTKKFSYKLVKT
FT                   GNVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQVSYKAKRWIYDVRTIA
FT                   EVEGTGVKAWRRAQWQEQILVPALPQSALPGCSLIHIDYYLQVSMKAPEATVTLPLFVG
FT                   NIAVNQTPLSPCPGRESSPGTLSLVVPSAPPQEEAEAVASGPHFSDPVSLSTKSHSQQQ
FT                   PLSAPLGSVSVTTTEPWVQVGSPARHSLHPPLCISIGATVPYFAEGSAGPVPTTSALIL
FT                   PPEYSSWGYPYEAPPSYEQSCGAAGTDLGLIPGS"
FT   CDS             complement(join(21647753..21647823,21647903..21648341,
FT                   21648419..21648595,21648692..21648874,21649025..21649179,
FT                   21649273..21649323,21649876..21649986,21657243..21657360))
FT                   /codon_start=1
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, isoform CRA_e"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT20408.2
FT                   protein_id=mCP19596.2 isoform=CRA_e"
FT                   /protein_id="EDL08182.1"
FT                   /translation="MGRVQLFEIRLSQGRVVYGPGEPLAGAVHLRLGAPLPFRAIRVTC
FT                   MGSCGVSTKANDGAWVVEESYFNSSLSLADKGSLPAGEHNFPFQFLLPATAPTSFEGPF
FT                   GKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASTTKKFSYKLVKT
FT                   GNVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQKVSYKAKRWIYDVRTI
FT                   AEVEGTGVKAWRRAQWQEQILVPALPQSALPGCSLIHIDYYLQVSMKAPEATVTLPLFV
FT                   GNIAVNQTPLSPCPGRESSPGTLSLVVPSAPPQEEAEAVASGPHFSDPVSLSTKSHSQQ
FT                   QPLSAPLGSVSVTTTEPWVQVGSPARHSLHPPLCISIGATVPYFAEGSAGPVPTTSALI
FT                   LPPEYSSWGYPYEAPPSYEQSCGAAGTDLGLIPGS"
FT   CDS             complement(join(21647753..21647823,21647903..>21648560))
FT                   /codon_start=1
FT                   /gene="Arrdc1"
FT                   /locus_tag="mCG_20307"
FT                   /product="arrestin domain containing 1, isoform CRA_d"
FT                   /note="gene_id=mCG20307.1 transcript_id=mCT190025.0
FT                   protein_id=mCP111022.0 isoform=CRA_d"
FT                   /protein_id="EDL08181.1"
FT                   /translation="CADHCRGGGYRCQGLEACSVARTDPGACPAPVSPAWLQPYPYRLL
FT                   PSGLVLPRAGWPEARWPWPDSSIPTFFQVSMKAPEATVTLPLFVGNIAVNQTPLSPCPG
FT                   RESSPGTLSLVVPSAPPQEEAEAVASGPHFSDPVSLSTKSHSQQQPLSAPLGSVSVTTT
FT                   EPWVQVGSPARHSLHPPLCISIGATVPYFAEGSAGPVPTTSALILPPEYSSWGYPYEAP
FT                   PSYEQSCGAAGTDLGLIPGS"
FT   gene            21671753..21683087
FT                   /locus_tag="mCG_20305"
FT                   /note="gene_id=mCG20305.2"
FT   mRNA            join(21671753..21671953,21673381..21673440,
FT                   21674280..21674386,21674930..21675070,21681985..21682165,
FT                   21682867..21683087)
FT                   /locus_tag="mCG_20305"
FT                   /product="mCG20305"
FT                   /note="gene_id=mCG20305.2 transcript_id=mCT20404.2 created
FT                   on 03-FEB-2003"
FT   CDS             join(21671903..21671953,21673381..21673440,
FT                   21674280..21674386,21674930..21675070,21681985..21682165,
FT                   21682867..21683010)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20305"
FT                   /product="mCG20305"
FT                   /note="gene_id=mCG20305.2 transcript_id=mCT20404.2
FT                   protein_id=mCP19442.2"
FT                   /protein_id="EDL08183.1"
FT                   /translation="MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDAD
FT                   GNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLV
FT                   PWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENS
FT                   CTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHE
FT                   LEPER"
FT   gene            21686328..21697393
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /note="gene_id=mCG20312.2"
FT   mRNA            join(21686328..21686567,21689500..21689597,
FT                   21692830..21692899,21692995..21693060,21693447..21693619,
FT                   21695446..21697393)
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, transcript variant
FT                   mCT174076"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT174076.0 created
FT                   on 26-SEP-2002"
FT   mRNA            join(<21686341..21686567,21686965..21687098,
FT                   21687398..21687485,21689503..21689597,21690446..21690618,
FT                   21692830..21692899,21692995..21693060,21693447..21693619,
FT                   21695446..21697392)
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, transcript variant
FT                   mCT20416"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT20416.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(<21686373..21686567,21686965..21687098,
FT                   21687398..21687485,21689503..21689597,21690446..21690618,
FT                   21692830..21692899,21692995..21693060,21693447..21693619,
FT                   21695446..21695933)
FT                   /codon_start=1
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, isoform CRA_d"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT20416.2
FT                   protein_id=mCP19547.2 isoform=CRA_d"
FT                   /protein_id="EDL08187.1"
FT                   /translation="GKWRESVAHASFGSGSMAGSHAGTLRVLQAVDTELTADSVEWCPV
FT                   EGYRHLLACGTYQLRAPRDQPALDGSEPQVRLGRLYLFSFSEHNTAKPLLEVQRRDSSA
FT                   VLDMKWCHIPVSGHVLLGLANASGSIGLLRLMECENNSYTLQPISSLALDENCLSLSMD
FT                   WSTGKSVRAREQPLKIISSDSKGQLHLLMVNEGTAELQLVASWPAHHFEAWIAAFNYWQ
FT                   TELVYSGGDDCLLRGWDTRMLGTPVFTSKRHCMGVCSIQSSPHQEHILATGSYDEHVLL
FT                   WDTRNIRQPLADVPVQGGVWRLKWHPVHHHLLLAACMHNGFKILNCQKAIEEKQDITVL
FT                   TSHEMPNSLVYGADWSWLFHSMKPTPTWFFDQNDMGVKAADHSSLKVTEEPPIHSQEQT
FT                   MDRQVEGPANAHTRAELKASLLPLTEDMKNSKDCSSSSVKTRDLSHCSGGQSFDNSLLA
FT                   TCSFYDHVLHLWKWETNQARTLCSGTGCDLGSADH"
FT   mRNA            join(<21686402..21686567,21686965..21687098,
FT                   21689503..21689597,21690446..21690618,21692830..21692899,
FT                   21692995..21693060,21693447..21693619,21695446..21696081)
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, transcript variant
FT                   mCT190068"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT190068.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<21686408..21687485,21689503..21689597,
FT                   21690446..21690618,21692830..21692899,21692995..21693060,
FT                   21693447..21693619,21695446..21696081)
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, transcript variant
FT                   mCT190067"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT190067.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21687057..21687098,21689503..21689597,
FT                   21690446..21690618,21692830..21692899,21692995..21693060,
FT                   21693447..21693619,21695446..21695933)
FT                   /codon_start=1
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, isoform CRA_c"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT190068.0
FT                   protein_id=mCP111024.0 isoform=CRA_c"
FT                   /protein_id="EDL08186.1"
FT                   /translation="GPKKGLFCCPGHEMNNSYTLQPISSLALDENCLSLSMDWSTGKSV
FT                   RAREQPLKIISSDSKGQLHLLMVNEGTAELQLVASWPAHHFEAWIAAFNYWQTELVYSG
FT                   GDDCLLRGWDTRMLGTPVFTSKRHCMGVCSIQSSPHQEHILATGSYDEHVLLWDTRNIR
FT                   QPLADVPVQGGVWRLKWHPVHHHLLLAACMHNGFKILNCQKAIEEKQDITVLTSHEMPN
FT                   SLVYGADWSWLFHSMKPTPTWFFDQNDMGVKAADHSSLKVTEEPPIHSQEQTMDRQVEG
FT                   PANAHTRAELKASLLPLTEDMKNSKDCSSSSVKTRDLSHCSGGQSFDNSLLATCSFYDH
FT                   VLHLWKWETNQARTLCSGTGCDLGSADH"
FT   CDS             join(<21687237..21687485,21689503..21689597,
FT                   21690446..21690618,21692830..21692899,21692995..21693060,
FT                   21693447..21693619,21695446..21695933)
FT                   /codon_start=1
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, isoform CRA_b"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT190067.0
FT                   protein_id=mCP111023.0 isoform=CRA_b"
FT                   /protein_id="EDL08185.1"
FT                   /translation="SGKHPEIKFDNLKSLCLETTVGSSLVLEMKYRKSLGFRKLFPAVS
FT                   AYFYLFSLRCHIPVSGHVLLGLANASGSIGLLRLMECENNSYTLQPISSLALDENCLSL
FT                   SMDWSTGKSVRAREQPLKIISSDSKGQLHLLMVNEGTAELQLVASWPAHHFEAWIAAFN
FT                   YWQTELVYSGGDDCLLRGWDTRMLGTPVFTSKRHCMGVCSIQSSPHQEHILATGSYDEH
FT                   VLLWDTRNIRQPLADVPVQGGVWRLKWHPVHHHLLLAACMHNGFKILNCQKAIEEKQDI
FT                   TVLTSHEMPNSLVYGADWSWLFHSMKPTPTWFFDQNDMGVKAADHSSLKVTEEPPIHSQ
FT                   EQTMDRQVEGPANAHTRAELKASLLPLTEDMKNSKDCSSSSVKTRDLSHCSGGQSFDNS
FT                   LLATCSFYDHVLHLWKWETNQARTLCSGTGCDLGSADH"
FT   CDS             join(21689546..21689597,21692830..21692899,
FT                   21692995..21693060,21693447..21693619,21695446..21695933)
FT                   /codon_start=1
FT                   /gene="Wdr85"
FT                   /locus_tag="mCG_20312"
FT                   /product="WD40 repeat domain 85, isoform CRA_a"
FT                   /note="gene_id=mCG20312.2 transcript_id=mCT174076.0
FT                   protein_id=mCP96995.0 isoform=CRA_a"
FT                   /protein_id="EDL08184.1"
FT                   /translation="MRIVCPCQWIGPLGNLSGGDDCLLRGWDTRMLGTPVFTSKRHCMG
FT                   VCSIQSSPHQEHILATGSYDEHVLLWDTRNIRQPLADVPVQGGVWRLKWHPVHHHLLLA
FT                   ACMHNGFKILNCQKAIEEKQDITVLTSHEMPNSLVYGADWSWLFHSMKPTPTWFFDQND
FT                   MGVKAADHSSLKVTEEPPIHSQEQTMDRQVEGPANAHTRAELKASLLPLTEDMKNSKDC
FT                   SSSSVKTRDLSHCSGGQSFDNSLLATCSFYDHVLHLWKWETNQARTLCSGTGCDLGSAD
FT                   H"
FT   gene            complement(21697211..21698966)
FT                   /locus_tag="mCG_55255"
FT                   /note="gene_id=mCG55255.1"
FT   mRNA            complement(join(21697211..21698609,21698816..21698966))
FT                   /locus_tag="mCG_55255"
FT                   /product="mCG55255"
FT                   /note="gene_id=mCG55255.1 transcript_id=mCT55438.1 created
FT                   on 26-SEP-2002"
FT   CDS             complement(21698179..21698586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55255"
FT                   /product="mCG55255"
FT                   /note="gene_id=mCG55255.1 transcript_id=mCT55438.1
FT                   protein_id=mCP39840.0"
FT                   /protein_id="EDL08188.1"
FT                   /translation="MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSD
FT                   RKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKE
FT                   GTFDANNLEKYGFEPTQEGKLFQLYPKNFPR"
FT   gene            <21700015..21781143
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /note="gene_id=mCG20285.3"
FT   mRNA            join(<21700015..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21706365..21706456,
FT                   21706620..21706760,21708087..21708246,21712506..21712586,
FT                   21722405..21722533,21723260..21723340,21724330..21724453,
FT                   21725725..21725862,21729682..21729782,21729956..21730099,
FT                   21737781..21737858,21738573..21738778,21742213..21742344,
FT                   21743574..21743697,21746471..21746584,21749007..21749076,
FT                   21756610..21756759,21765927..21765990,21766693..21766861,
FT                   21768036..21768218,21769179..21769297,21774698..21774854,
FT                   21777085..21777201,21777344..21777413,21777941..21778057,
FT                   21778687..21778835,21779118..21779270,21779394..21779504,
FT                   21779639..21779723,21780481..21780584,21780757..21781141)
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   transcript variant mCT190093"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190093.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21700015..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21706365..21706456,
FT                   21706620..21706760,21708087..21708246,21712506..21712586,
FT                   21722405..21722533,21723260..21723340,21724330..21724453,
FT                   21725725..21725862,21729682..21729782,21729956..21730099,
FT                   21737781..21737858,21738573..21738778,21742213..21742344,
FT                   21743574..21743697,21746471..21746584,21749007..21749076,
FT                   21756610..21756759,21765927..21765990,21766693..21766861,
FT                   21768036..21768218,21769179..21769297,21774698..21774854,
FT                   21777085..21777201,21777344..21777413,21777941..21778057,
FT                   21778687..21778835,21779118..21779270,21779394..21779504,
FT                   21779639..21779723,21780481..21780584,21780757..21780879)
FT                   /codon_start=1
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190093.0
FT                   protein_id=mCP111113.0 isoform=CRA_a"
FT                   /protein_id="EDL08189.1"
FT                   /translation="AHRESRRFWKTTCFGAQSSEVSSNKSVCVERSWQDWNYSCPAVKV
FT                   RVQQFVSACLLFALHIALLSVMQNEEDACLEAGYCLGTTLSSWRLHFMEEQSQSTMLMG
FT                   IGIGALLTLAFVGITFFFVYRRVRRLRRAEPTPQYRFRKRDKVMFYGRKIMRKVTTLPH
FT                   TLVGNTSAPRQRVRKRTKVLSLAKRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSH
FT                   LPSEVLYMLKNVRVLGHFEKPLFLELCKHMVFVQLQEGEHVFQPGEPDISIYVVQDGRL
FT                   EVCIQDADGTEVVVKEVLPGDSVHSLLSILDVITGHTAPYKTVSARAAVSSTVLWLPAA
FT                   AFQGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNPESQAIPLLSVASVA
FT                   GRAKRQMSYGPEEQLERSLRPSEFSSSDHGSSCVTVSGPLLKRSCSVPLPSNHGEVDEL
FT                   RQSQGSGSNTSAFQESHEGATSDLGMAYNRARILPHSDEQLGNSLASKSKKSVVAETPS
FT                   AIFHYSENFRDETGACGKTDAIFRAATKDLLTLMKLDDPSLLDGRVAFLHVPAGTLVSK
FT                   QGDQDVNILFVVSGMLHVYQQKIDSLEDTCLFLTHPGEMVGQLAVLTGEPLMFTIRANR
FT                   DCSFLSISKAHFYEIMRKRPDVVLGVAHTVVKRMSSFVRQIDFALDWMEVEAGRAIYRQ
FT                   GDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEYGRGDLVGVVETLTHQARATTVHAVRDS
FT                   ELAKLPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGSATGHQLGFNTASSKWDLGN
FT                   PPGNLSTVAALPASEDVPLTAFALELQHALSAIGPVLLLTSDNIKQRLGSAALDSIHEY
FT                   RLSSWLGQQEDIHRIVLYQADGTLTPWTQRCIRQADCILIVGLGEQEPAVGELEQMLES
FT                   TAVRAQKQLILLHKEDGPVPSRTVEWLNMRSWCSGHLHLCCPRRVFSKRSLPKLVEMYT
FT                   RVFQRPPDRHSDFSRLARMLTGNAIALVLGGGGARGCAQVGILRALAECGVPVDIIGGT
FT                   SIGAFMGALFAEERSYSQTRIRAKQWAEGMTSMMKTILDLTYPITSMFSGTGFNSSISN
FT                   IFKDRQIEDLWLPYFAITTDITASAMRVHTDGSLWRYVRASMSLSGYMPPLCDPKDGHL
FT                   LMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYGDALSGWWLLWKRWNPLATK
FT                   VKVLNMAEIQTRLAYVCCVRQLEMVKNSDYCEYLRPPIDSYRTLDFGKFDEICEVGYQH
FT                   GRTVFDIWVRSGVLEKMLQDQQGTSKRKDCGVFTCPNSSFTDLAEIVSRIEPAKVAAVD
FT                   DESDYQTEYEEELPAIPKETYADFQSTGIELDSDSEYEPSMLQGPPSLTSPEQSQDSFP
FT                   WLPNQDDQGPRLEHPS"
FT   mRNA            join(<21700033..21700146,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21706365..21706456,
FT                   21706620..21706760,21708087..21708246,21712501..21712586,
FT                   21722405..21722533,21723260..21723340,21724330..21724453,
FT                   21725725..21725862,21729682..21730099,21737781..21737858,
FT                   21738573..21738778,21742213..21742344,21743574..21743697,
FT                   21746471..21746584,21749007..21749076,21756610..21756759,
FT                   21765927..21765990,21766693..21766861,21768036..21768218,
FT                   21769179..21769297,21774698..21774854,21777085..21777201,
FT                   21777344..21777413,21777941..21778057,21778687..21778835,
FT                   21779118..21779270,21779394..21779504,21779639..21779723,
FT                   21780481..21780584,21780757..21781143)
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   transcript variant mCT190094"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190094.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<21700075..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21706365..21706456,
FT                   21706620..21706760,21708087..21708246,21712506..21712586,
FT                   21722405..21722533,21723260..21723340,21724330..21724453,
FT                   21725725..21725862,21729682..21729782,21729956..21730099,
FT                   21737781..21737858,21738573..21738778,21742213..21742344,
FT                   21743574..21743697,21746471..21746584,21749007..21749076,
FT                   21756610..21756759,21765927..21766442)
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   transcript variant mCT190095"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190095.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21700075..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21706365..21706456,
FT                   21706620..21706760,21708087..21708246,21712506..21712586,
FT                   21722405..21722533,21723260..21723340,21724330..21724453,
FT                   21725725..21725862,21729682..21729782,21729956..21730099,
FT                   21737781..21737858,21738573..21738778,21742213..21742344,
FT                   21743574..21743697,21746471..21746584,21749007..21749076,
FT                   21756610..21756759,21765927..21766054)
FT                   /codon_start=1
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190095.0
FT                   protein_id=mCP111115.0 isoform=CRA_c"
FT                   /protein_id="EDL08191.1"
FT                   /translation="VSSNKSVCVERSWQDWNYSCPAVKVRVQQFVSACLLFALHIALLS
FT                   VMQNEEDACLEAGYCLGTTLSSWRLHFMEEQSQSTMLMGIGIGALLTLAFVGITFFFVY
FT                   RRVRRLRRAEPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGNTSAPRQRVRKRTKVL
FT                   SLAKRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEK
FT                   PLFLELCKHMVFVQLQEGEHVFQPGEPDISIYVVQDGRLEVCIQDADGTEVVVKEVLPG
FT                   DSVHSLLSILDVITGHTAPYKTVSARAAVSSTVLWLPAAAFQGVFEKYPETLVRVVQII
FT                   MVRLQRVTFLALHNYLGLTTELFNPESQAIPLLSVASVAGRAKRQMSYGPEEQLERSLR
FT                   PSEFSSSDHGSSCVTVSGPLLKRSCSVPLPSNHGEVDELRQSQGSGSNTSAFQESHEGA
FT                   TSDLGMAYNRARILPHSDEQLGNSLASKSKKSVVAETPSAIFHYSENFRDETGACGKTD
FT                   AIFRAATKDLLTLMKLDDPSLLDGRVAFLHVPAGTLVSKQGDQDVNILFVVSGMLHVYQ
FT                   QKIDSLEDTCLFLTHPGEMVGQLAVLTGEPLMFTIRANRDCSFLSISKAHFYEIMRKRP
FT                   DVVLGVAHTVVKRMSSFVRQIDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRSVIR
FT                   KDDGKKRLAGEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQV
FT                   VTRLIHLLGEKILGSLQQGSATGHQLGFNTASSKWDLGNPPGNLSTVAALPASEDVPLT
FT                   AFALELQHALSAIGPVLLLTSDNIKQRLGSAALDRCAPAPVWSHMENFSQFELLS"
FT   mRNA            join(21700080..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21705709..21705800,
FT                   21705964..21706104,21706364..21706456,21706620..21706760,
FT                   21708087..21708246,21712506..21712586,21722405..21722533,
FT                   21723260..21723340,21724330..21724453,21725725..21725862,
FT                   21729682..21729782,21729956..21730099,21737781..21737858,
FT                   21738573..21738778,21742213..21742344,21743574..21743697,
FT                   21746471..21746584,21749007..21749076,21756610..21756759,
FT                   21765927..21765990,21766693..21766861,21768036..21768218,
FT                   21769179..21769297,21774698..21774854,21777085..21777201,
FT                   21777344..21777413,21777941..21778057,21778687..21778835,
FT                   21779118..21779270,21779394..21779504,21779639..21779723,
FT                   21780481..21780584,21780757..21781143)
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   transcript variant mCT20168"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT20168.2 created
FT                   on 07-OCT-2002"
FT   CDS             join(21700213..21700242,21703971..21704045,
FT                   21704140..21704227,21704650..21704729,21705709..21705800,
FT                   21705964..21706104,21706364..21706456,21706620..21706760,
FT                   21708087..21708246,21712506..21712586,21722405..21722533,
FT                   21723260..21723340,21724330..21724453,21725725..21725862,
FT                   21729682..21729782,21729956..21730099,21737781..21737858,
FT                   21738573..21738778,21742213..21742344,21743574..21743697,
FT                   21746471..21746584,21749007..21749076,21756610..21756759,
FT                   21765927..21765990,21766693..21766861,21768036..21768218,
FT                   21769179..21769297,21774698..21774854,21777085..21777201,
FT                   21777344..21777413,21777941..21778057,21778687..21778835,
FT                   21779118..21779270,21779394..21779504,21779639..21779723,
FT                   21780481..21780584,21780757..21780879)
FT                   /codon_start=1
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT20168.2
FT                   protein_id=mCP19574.2 isoform=CRA_d"
FT                   /protein_id="EDL08192.1"
FT                   /translation="MQNEEDACLEAGYCLGTTLSSWRLHFMEEQSQSTMLMGIGIGALL
FT                   TLAFVGITFFFVYRRVRRLRRAEPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGNTS
FT                   APRQRVRKRTKVLSLAKRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLY
FT                   MLKNVRVTTLPHTLVGNTSAPRQRVRKRTKVLSLAKRILRFKKEYPTLQPKEPPPSLLE
FT                   ADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMVFVQLQEGEHVFQPGEP
FT                   DISIYVVQDGRLEVCIQDADGTEVVVKEVLPGDSVHSLLSILDVITGHTAPYKTVSARA
FT                   AVSSTVLWLPAAAFQGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNPES
FT                   QAIPLLSVASVAGRAKRQMSYGPEEQLERSLRPSEFSSSDHGSSCVTVSGPLLKRSCSV
FT                   PLPSNHGEVDELRQSQGSGSNTSAFQESHEGATSDLGMAYNRARILPHSDEQLGNSLAS
FT                   KSKKSVVAETPSAIFHYSENFRDETGACGKTDAIFRAATKDLLTLMKLDDPSLLDGRVA
FT                   FLHVPAGTLVSKQGDQDVNILFVVSGMLHVYQQKIDSLEDTCLFLTHPGEMVGQLAVLT
FT                   GEPLMFTIRANRDCSFLSISKAHFYEIMRKRPDVVLGVAHTVVKRMSSFVRQIDFALDW
FT                   MEVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEYGRGDLVGVVETLTHQ
FT                   ARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGSATGHQLG
FT                   FNTASSKWDLGNPPGNLSTVAALPASEDVPLTAFALELQHALSAIGPVLLLTSDNIKQR
FT                   LGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADGTLTPWTQRCIRQADCILIVGLGEQE
FT                   PAVGELEQMLESTAVRAQKQLILLHKEDGPVPSRTVEWLNMRSWCSGHLHLCCPRRVFS
FT                   KRSLPKLVEMYTRVFQRPPDRHSDFSRLARMLTGNAIALVLGGGGARGCAQVGILRALA
FT                   ECGVPVDIIGGTSIGAFMGALFAEERSYSQTRIRAKQWAEGMTSMMKTILDLTYPITSM
FT                   FSGTGFNSSISNIFKDRQIEDLWLPYFAITTDITASAMRVHTDGSLWRYVRASMSLSGY
FT                   MPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYGDALSGWW
FT                   LLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSDYCEYLRPPIDSYRTLDFG
FT                   KFDEICEVGYQHGRTVFDIWVRSGVLEKMLQDQQGTSKRKDCGVFTCPNSSFTDLAEIV
FT                   SRIEPAKVAAVDDESDYQTEYEEELPAIPKETYADFQSTGIELDSDSEYEPSMLQGPPS
FT                   LTSPEQSQDSFPWLPNQDDQGPRLEHPS"
FT   gene            21710547..21711111
FT                   /pseudo
FT                   /locus_tag="mCG_128150"
FT                   /note="gene_id=mCG128150.0"
FT   mRNA            21710547..21711111
FT                   /pseudo
FT                   /locus_tag="mCG_128150"
FT                   /note="gene_id=mCG128150.0 transcript_id=mCT129444.0
FT                   created on 01-MAY-2003"
FT   gene            complement(21720477..21721575)
FT                   /pseudo
FT                   /locus_tag="mCG_20296"
FT                   /note="gene_id=mCG20296.2"
FT   mRNA            complement(21720477..21721575)
FT                   /pseudo
FT                   /locus_tag="mCG_20296"
FT                   /note="gene_id=mCG20296.2 transcript_id=mCT20180.2 created
FT                   on 07-OCT-2002"
FT   CDS             join(<21729755..21730099,21737781..21737858,
FT                   21738573..21738778,21742213..21742344,21743574..21743697,
FT                   21746471..21746584,21749007..21749076,21756610..21756759,
FT                   21765927..21765990,21766693..21766861,21768036..21768218,
FT                   21769179..21769297,21774698..21774854,21777085..21777201,
FT                   21777344..21777413,21777941..21778057,21778687..21778835,
FT                   21779118..21779270,21779394..21779504,21779639..21779723,
FT                   21780481..21780584,21780757..21780879)
FT                   /codon_start=1
FT                   /gene="Pnpla7"
FT                   /locus_tag="mCG_20285"
FT                   /product="patatin-like phospholipase domain containing 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20285.3 transcript_id=mCT190094.0
FT                   protein_id=mCP111114.0 isoform=CRA_b"
FT                   /protein_id="EDL08190.1"
FT                   /translation="ATWELFGQQGISIHVLLLVPCAVSVALFTSAVGVAQADIPSISSR
FT                   SWRCTSFLIIPLLMMCIFVLSKSKKSVVAETPSAIFHYSENFRDETGACGKTDAIFRAA
FT                   TKDLLTLMKLDDPSLLDGRVAFLHVPAGTLVSKQGDQDVNILFVVSGMLHVYQQKIDSL
FT                   EDTCLFLTHPGEMVGQLAVLTGEPLMFTIRANRDCSFLSISKAHFYEIMRKRPDVVLGV
FT                   AHTVVKRMSSFVRQIDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKK
FT                   RLAGEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIH
FT                   LLGEKILGSLQQGSATGHQLGFNTASSKWDLGNPPGNLSTVAALPASEDVPLTAFALEL
FT                   QHALSAIGPVLLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADGTLTP
FT                   WTQRCIRQADCILIVGLGEQEPAVGELEQMLESTAVRAQKQLILLHKEDGPVPSRTVEW
FT                   LNMRSWCSGHLHLCCPRRVFSKRSLPKLVEMYTRVFQRPPDRHSDFSRLARMLTGNAIA
FT                   LVLGGGGARGCAQVGILRALAECGVPVDIIGGTSIGAFMGALFAEERSYSQTRIRAKQW
FT                   AEGMTSMMKTILDLTYPITSMFSGTGFNSSISNIFKDRQIEDLWLPYFAITTDITASAM
FT                   RVHTDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAI
FT                   DVGSRDETDLTNYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVK
FT                   NSDYCEYLRPPIDSYRTLDFGKFDEICEVGYQHGRTVFDIWVRSGVLEKMLQDQQGTSK
FT                   RKDCGVFTCPNSSFTDLAEIVSRIEPAKVAAVDDESDYQTEYEEELPAIPKETYADFQS
FT                   TGIELDSDSEYEPSMLQGPPSLTSPEQSQDSFPWLPNQDDQGPRLEHPS"
FT   gene            21781487..21789966
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /note="gene_id=mCG20303.2"
FT   mRNA            join(21781487..21781757,21782084..21782145,
FT                   21784187..21784262,21785339..21785407,21786107..21786159,
FT                   21786691..21786780,21787225..21787349,21787565..21787648,
FT                   21787778..21787811,21787900..21787970,21788145..21788224,
FT                   21788348..21788450,21788579..21788654,21788758..21789815)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT174073"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT174073.0 created
FT                   on 26-SEP-2002"
FT   mRNA            join(21781493..21781757,21782084..21782145,
FT                   21784187..21784266,21785339..21785769)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT174072"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT174072.0 created
FT                   on 26-SEP-2002"
FT   mRNA            join(<21781499..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784266,21786107..21786159,
FT                   21786691..21786780,21787225..21787349,21787565..21787648,
FT                   21787778..21787811,21787900..21787970,21788145..21788224,
FT                   21788348..21788450,21788579..21788654,21788758..21789966)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT190175"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190175.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(21781499..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784262,21785339..21785407,
FT                   21786107..21786159,21786691..21786780,21787225..21787349,
FT                   21787565..21787648,21787778..21787811,21787900..21787970,
FT                   21788145..21788224,21788348..21788450,21788579..21788654,
FT                   21788758..21789966)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT20405"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT20405.1 created
FT                   on 26-SEP-2002"
FT   mRNA            join(<21781520..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784262,21785339..21785407,
FT                   21786107..21786159,21787225..21787349,21787565..21787648,
FT                   21787778..21787811,21787900..21787970,21788145..21788224,
FT                   21788348..21788450,21788579..21788654,21788758..21789966)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT190176"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190176.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21781597..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784262,21785339..21785407,
FT                   21786107..21786159,21787225..21787349,21787565..21787648,
FT                   21787778..21787811,21787900..21787970,21788145..21788224,
FT                   21788348..21788450,21788579..21788654,21788758..21788855)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_d"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190176.0
FT                   protein_id=mCP111165.0 isoform=CRA_d"
FT                   /protein_id="EDL08196.1"
FT                   /translation="RDLRRRTAPPAEAAGARRALKSGGCAGAVTMGAAASRRRALRSEA
FT                   MSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLV
FT                   SNGRYEGSISDEAVSGKPAIEGPQPHVYTISREPALLPGSEAEAIELAVVKGRRQRERH
FT                   PHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAQLVPGPSSRAFGLEQPPLP
FT                   EAPGRHKKLERMYSVDGVSDDVPIRTWFPKENLFSFQTATTTMQAVFRGYAERKRRKRE
FT                   NDSASVIQRNFRKHLRMVGSRRVKAQSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNT
FT                   EGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYH
FT                   KGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVI
FT                   HIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKS
FT                   RQHSKLLDFDDVL"
FT   mRNA            join(<21781687..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784266,21785339..21785407,
FT                   21786107..21786159,21786691..21786780,21787225..21787349,
FT                   21787565..21787648,21787778..21787811,21787900..21787970,
FT                   21788145..21788224,21788348..21788450,21788579..21788654,
FT                   21788758..>21788855)
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, transcript variant
FT                   mCT190174"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190174.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(21781687..21781757,21782084..21782145,
FT                   21782722..21783222,21784187..21784262,21785339..21785407,
FT                   21786107..21786159,21786691..21786780,21787225..21787349,
FT                   21787565..21787648,21787778..21787811,21787900..21787970,
FT                   21788145..21788224,21788348..21788450,21788579..21788654,
FT                   21788758..21788855)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_f"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT20405.1
FT                   protein_id=mCP19407.1 isoform=CRA_f"
FT                   /protein_id="EDL08198.1"
FT                   /translation="MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGAD
FT                   HLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGRYEGSISDEAVSGKPAIEGPQPHVYTI
FT                   SREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSR
FT                   QGSKECPGCAQLVPGPSSRAFGLEQPPLPEAPGRHKKLERMYSVDGVSDDVPIRTWFPK
FT                   ENLFSFQTATTTMQAVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAE
FT                   RRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNT
FT                   EGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYH
FT                   KGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVI
FT                   HIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKS
FT                   RQHSKLLDFDDVL"
FT   CDS             join(21781687..21781757,21782084..21782145,
FT                   21784187..21784262,21785339..21785407,21786107..21786159,
FT                   21786691..21786780,21787225..21787349,21787565..21787648,
FT                   21787778..21787811,21787900..21787970,21788145..21788224,
FT                   21788348..21788450,21788579..21788654,21788758..21788855)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_a"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT174073.0
FT                   protein_id=mCP96991.0 isoform=CRA_a"
FT                   /protein_id="EDL08193.1"
FT                   /translation="MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGAD
FT                   DVPIRTWFPKENLFSFQTATTTMQAVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGS
FT                   RRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTE
FT                   KGLEAMACNTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILE
FT                   EIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLM
FT                   SKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYF
FT                   DFRLYRLWKSRQHSKLLDFDDVL"
FT   CDS             join(21781687..21781757,21782084..21782145,
FT                   21784187..21784266)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_e"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT174072.0
FT                   protein_id=mCP96992.0 isoform=CRA_e"
FT                   /protein_id="EDL08197.1"
FT                   /translation="MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGAD
FT                   DVPIRTWFPKENLFSFQTATTTMQA"
FT   CDS             join(<21782962..21783222,21784187..21784266,
FT                   21785339..21785407,21786107..21786159,21786691..21786780,
FT                   21787225..21787349,21787565..21787648,21787778..21787811,
FT                   21787900..21787970,21788145..21788224,21788348..21788450,
FT                   21788579..21788654,21788758..21788855)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_b"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190174.0
FT                   protein_id=mCP111163.0 isoform=CRA_b"
FT                   /protein_id="EDL08194.1"
FT                   /translation="KGGDSGNGTLTTTASPCVPAQAAAGRTSAGPAKAGQEAARAPKSA
FT                   QDVPSWSLVPLLGPLGWSSHLYLRLLAATRSWKGCIALMECLMMSPSVPGSPRKTFSAS
FT                   RRQPQLCKREVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERS
FT                   FSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNTEGFLP
FT                   PKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKI
FT                   WKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGC
FT                   YILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSK
FT                   LLDFDDVL"
FT   CDS             join(<21782962..21783222,21784187..21784266,
FT                   21786107..21786159,21786691..21786780,21787225..21787349,
FT                   21787565..21787648,21787778..21787811,21787900..21787970,
FT                   21788145..21788224,21788348..21788450,21788579..21788654,
FT                   21788758..21788855)
FT                   /codon_start=1
FT                   /gene="Nelf"
FT                   /locus_tag="mCG_20303"
FT                   /product="nasal embryonic LHRH factor, isoform CRA_c"
FT                   /note="gene_id=mCG20303.2 transcript_id=mCT190175.0
FT                   protein_id=mCP111164.0 isoform=CRA_c"
FT                   /protein_id="EDL08195.1"
FT                   /translation="KGGDSGNGTLTTTASPCVPAQAAAGRTSAGPAKAGQEAARAPKSA
FT                   QDVPSWSLVPLLGPLGWSSHLYLRLLAATRSWKGCIALMECLMMSPSVPGSPRKTFSAS
FT                   RRQPQLCKRENFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSS
FT                   DLQSSHCTLDEACEDLDWDTEKGLEAMACNTEGFLPPKVMLISSKVPKAEYIPTIIRRD
FT                   DPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVAT
FT                   FAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYK
FT                   VTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL"
FT   gene            21807481..21812893
FT                   /locus_tag="mCG_20282"
FT                   /note="gene_id=mCG20282.2"
FT   mRNA            join(21807481..21807729,21808989..21809125,
FT                   21809211..21809328,21810106..21810256,21810398..21810557,
FT                   21810676..21810912,21811003..21811266,21811439..21811549,
FT                   21811904..21812038,21812139..21812893)
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, transcript variant mCT20164"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT20164.3 created
FT                   on 10-JUN-2003"
FT   mRNA            join(21807481..21807729,21810398..21810912,
FT                   21811003..21811266,21811439..21811549,21811904..21812038,
FT                   21812139..21812893)
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, transcript variant mCT185211"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT185211.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(<21807639..21807729,21808984..21809125,
FT                   21809211..21809328,21810106..21810256,21810398..21810557,
FT                   21810676..21810912,21811003..21811266,21811439..21811549,
FT                   21811904..21812038,21812139..21812515)
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, transcript variant mCT190087"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT190087.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21807641..21807729,21808984..21809125,
FT                   21809211..21809328,21810106..21810256,21810398..21810557,
FT                   21810676..21810912,21811003..21811266,21811439..21811549,
FT                   21811904..21812038,21812139..21812330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, isoform CRA_a"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT190087.0
FT                   protein_id=mCP111019.0 isoform=CRA_a"
FT                   /protein_id="EDL08199.1"
FT                   /translation="RWRRGVEDSRCAGQKQNFLKLSLKVGSQCSSDPLTMGLSWKERVF
FT                   MALLGVAAASGLTMLVLILVKAINVLLPADTKFGIVFDAGSSHTSLFVYQWPANKEKDT
FT                   GVVSQALTCQIEGPGISSYTSDPTQAGESLKSCLEEALALIPQAQHPETPTFLGSTAGM
FT                   RLLSQKNSSQARDILAAVSQTLSKSPVDFWGAKILAGQDEGAFGWITINYVLGMLLKYS
FT                   SGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCF
FT                   GRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQAILPLSSLYDSPCIHTTDSLNHTQ
FT                   NLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYTFHFL
FT                   NLTSRQSLNTVNDTVWKFCQKPWKLVEVSYPGQERWLRDYCASGLYILVLLLEGYKFSE
FT                   ETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAPTHWRAQSYSIWTAGVVFAVLTLV
FT                   AILGAAAIQIFWTQD"
FT   CDS             join(21809000..21809125,21809211..21809328,
FT                   21810106..21810256,21810398..21810557,21810676..21810912,
FT                   21811003..21811266,21811439..21811549,21811904..21812038,
FT                   21812139..21812330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, isoform CRA_b"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT20164.3
FT                   protein_id=mCP19564.3 isoform=CRA_b"
FT                   /protein_id="EDL08200.1"
FT                   /translation="MGLSWKERVFMALLGVAAASGLTMLVLILVKAINVLLPADTKFGI
FT                   VFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCLE
FT                   EALALIPQAQHPETPTFLGSTAGMRLLSQKNSSQARDILAAVSQTLSKSPVDFWGAKIL
FT                   AGQDEGAFGWITINYVLGMLLKYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILD
FT                   QSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQ
FT                   AILPLSSLYDSPCIHTTDSLNHTQNLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFN
FT                   GIYQPPVHGQFYAFSNFYYTFHFLNLTSRQSLNTVNDTVWKFCQKPWKLVEVSYPGQER
FT                   WLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEA
FT                   PTHWRAQSYSIWTAGVVFAVLTLVAILGAAAIQIFWTQD"
FT   CDS             join(21810712..21810912,21811003..21811266,
FT                   21811439..21811549,21811904..21812038,21812139..21812330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20282"
FT                   /product="mCG20282, isoform CRA_c"
FT                   /note="gene_id=mCG20282.2 transcript_id=mCT185211.0
FT                   protein_id=mCP106469.0 isoform=CRA_c"
FT                   /protein_id="EDL08201.1"
FT                   /translation="MLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHS
FT                   YLCFGRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQAILPLSSLYDSPCIHTTDSL
FT                   NHTQNLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYT
FT                   FHFLNLTSRQSLNTVNDTVWKFCQKPWKLVEVSYPGQERWLRDYCASGLYILVLLLEGY
FT                   KFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAPTHWRAQSYSIWTAGVVFAV
FT                   LTLVAILGAAAIQIFWTQD"
FT   gene            complement(21812676..21822357)
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /note="gene_id=mCG20286.2"
FT   mRNA            complement(join(21812676..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814308..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817804,21818899..21819007,21819720..21819802,
FT                   21821926..21822314))
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, transcript variant
FT                   mCT174290"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT174290.0 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(21812677..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814308..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817767,21817823..21817859,21818899..21819007,
FT                   21819720..21819802,21821926..21822357))
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, transcript variant
FT                   mCT20169"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT20169.2 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(21812886..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814332..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817804,21818899..21819007,21819720..21819802,
FT                   21821926..>21822309))
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, transcript variant
FT                   mCT190099"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT190099.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(21812902..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814332..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817804,21818899..21819007,21819720..21819802,
FT                   21821926..>21822135))
FT                   /codon_start=1
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, isoform CRA_b"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT190099.0
FT                   protein_id=mCP111116.0 isoform=CRA_b"
FT                   /protein_id="EDL08203.1"
FT                   /translation="LPSPQSRRPRSMSSLGDQIRDWHRGVLAVAREDWDSALCFFSDVR
FT                   EPLARMYFNRGCVHLMAGDPEAALRAFDQAVTKDTCMAVGFLQRGVANFQLQRFQEAVS
FT                   DFQLALAQLRDNAVIDYTQLGLNFKLQAWEVLYNMASAQCQAGLWTKAANTLVEAISKW
FT                   PEGAQDILDIAMDKVQKQVPLQLQQVPKGEVFQPPRRYLKHLEPMDFLGKAKVVASVIP
FT                   DDHNAQPQQRSQAEHAGHQPSSSMCGHTSPGLYDSLLASRRPGPGPSEVSSGSEGAATK
FT                   DPESLVTVTVQCHFTVPLKVPRGTGLSSFQTLLAQALLHQTQTGQLSYKAPGEERSWIP
FT                   ISTEESLQSIWRNVPVGPGGLQLQCQGVWGRPVLYQVVAQYNYRAQRPEDLDFHQGDTV
FT                   DVLCEVDEAWLEGHRDGCVGIFPKCFVVPAGAYVEAMLVLGPQPGDQN"
FT   CDS             complement(join(21812902..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814308..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817804,21818899..21819007,21819720..21819802,
FT                   21821926..21822102))
FT                   /codon_start=1
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, isoform CRA_a"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT174290.0
FT                   protein_id=mCP97209.0 isoform=CRA_a"
FT                   /protein_id="EDL08202.1"
FT                   /translation="MSSLGDQIRDWHRGVLAVAREDWDSALCFFSDVREPLARMYFNRG
FT                   CVHLMAGDPEAALRAFDQAVTKDTCMAVGFLQRGVANFQLQRFQEAVSDFQLALAQLRD
FT                   NAVIDYTQLGLNFKLQAWEVLYNMASAQCQAGLWTKAANTLVEAISKWPEGAQDILDIA
FT                   MDKVQKQVPLQLQQVPKGEVFQPPRRYLKHLEPMDFLGKAKVVASVIPDDHNAQPQQRS
FT                   QAEHAGHQPSSSMCKRVLSTTGGHTSPGLYDSLLASRRPGPGPSEVSSGSEGAATKDPE
FT                   SLVTVTVQCHFTVPLKVPRGTGLSSFQTLLAQALLHQTQTGQLSYKAPGEERSWIPIST
FT                   EESLQSIWRNVPVGPGGLQLQCQGVWGRPVLYQVVAQYNYRAQRPEDLDFHQGDTVDVL
FT                   CEVDEAWLEGHRDGCVGIFPKCFVVPAGAYVEAMLVLGPQPGDQN"
FT   CDS             complement(join(21812902..21813032,21813151..21813265,
FT                   21813364..21813478,21813798..21813952,21814117..21814205,
FT                   21814308..21814377,21816352..21816399,21817348..21817455,
FT                   21817670..21817767,21817823..21817859,21818899..21819007,
FT                   21819720..21819802,21821926..21822102))
FT                   /codon_start=1
FT                   /gene="Noxa1"
FT                   /locus_tag="mCG_20286"
FT                   /product="NADPH oxidase activator 1, isoform CRA_c"
FT                   /note="gene_id=mCG20286.2 transcript_id=mCT20169.2
FT                   protein_id=mCP19663.2 isoform=CRA_c"
FT                   /protein_id="EDL08204.1"
FT                   /translation="MSSLGDQIRDWHRGVLAVAREDWDSALCFFSDVREPLARMYFNRG
FT                   CVHLMAGDPEAALRAFDQAVTKDTCMAVGFLQRGVANFQLQRFQEAVSDFQLALAQLRD
FT                   NAVIDYTQLGLNFKLQAWEVLYNMASAQCQSWLWTKAANTLVEAISKWPEGAQDILDIA
FT                   MDKVQKQVPLQLQQVPKGEVFQPPRRYLKHLEPMDFLGKAKVVASVIPDDHNAQPQQRS
FT                   QAEHAGHQPSSSMCKRVLSTTGGHTSPGLYDSLLASRRPGPGPSEVSSGSEGAATKDPE
FT                   SLVTVTVQCHFTVPLKVPRGTGLSSFQTLLAQALLHQTQTGQLSYKAPGEERSWIPIST
FT                   EESLQSIWRNVPVGPGGLQLQCQGVWGRPVLYQVVAQYNYRAQRPEDLDFHQGDTVDVL
FT                   CEVDEAWLEGHRDGCVGIFPKCFVVPAGAYVEAMLVLGPQPGDQN"
FT   gene            complement(21850354..21873429)
FT                   /locus_tag="mCG_128170"
FT                   /note="gene_id=mCG128170.1"
FT   mRNA            complement(join(21850354..21850482,21872146..21872236,
FT                   21873085..21873429))
FT                   /locus_tag="mCG_128170"
FT                   /product="mCG128170"
FT                   /note="gene_id=mCG128170.1 transcript_id=mCT129464.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(21872174..21872236,21873085..21873195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128170"
FT                   /product="mCG128170"
FT                   /note="gene_id=mCG128170.1 transcript_id=mCT129464.1
FT                   protein_id=mCP51114.1"
FT                   /protein_id="EDL08205.1"
FT                   /translation="MCTSPDAYGRHTAHTGKHLLQDCSRPQRNWPELRSSAGRAFLTLW
FT                   HDFCLLPSPIKQ"
FT   gene            21908545..21911117
FT                   /gene="Nrarp"
FT                   /locus_tag="mCG_56531"
FT                   /note="gene_id=mCG56531.2"
FT   mRNA            21908545..21911117
FT                   /gene="Nrarp"
FT                   /locus_tag="mCG_56531"
FT                   /product="Notch-regulated ankyrin repeat protein"
FT                   /note="gene_id=mCG56531.2 transcript_id=mCT56714.2 created
FT                   on 11-NOV-2002"
FT   CDS             21908898..21909242
FT                   /codon_start=1
FT                   /gene="Nrarp"
FT                   /locus_tag="mCG_56531"
FT                   /product="Notch-regulated ankyrin repeat protein"
FT                   /note="gene_id=mCG56531.2 transcript_id=mCT56714.2
FT                   protein_id=mCP39844.2"
FT                   /protein_id="EDL08206.1"
FT                   /translation="MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVN
FT                   SFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLI
FT                   TKAKYAASGR"
FT   gene            complement(21920479..21924529)
FT                   /gene="A830007P12Rik"
FT                   /locus_tag="mCG_20316"
FT                   /note="gene_id=mCG20316.1"
FT   mRNA            complement(join(21920479..21923694,21924361..21924529))
FT                   /gene="A830007P12Rik"
FT                   /locus_tag="mCG_20316"
FT                   /product="RIKEN cDNA A830007P12"
FT                   /note="gene_id=mCG20316.1 transcript_id=mCT20418.1 created
FT                   on 07-OCT-2002"
FT   CDS             complement(21922378..21923658)
FT                   /codon_start=1
FT                   /gene="A830007P12Rik"
FT                   /locus_tag="mCG_20316"
FT                   /product="RIKEN cDNA A830007P12"
FT                   /note="gene_id=mCG20316.1 transcript_id=mCT20418.1
FT                   protein_id=mCP19642.1"
FT                   /protein_id="EDL08207.1"
FT                   /translation="MDRSHPSLEPQAKGPCVIAPVRAVLRLRRRVCVLRKRRLLQPGTE
FT                   PDSGTGTLGPTGSLGTLRADLDQPKFFTFDSLTELTSRTPRKRRRRSRVVLYPETSRKC
FT                   RPRTERQSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRSVFGQPAAV
FT                   GRIMALLRDYLATHVHSHPLLLALHGPSGVGKSHVGRLLARHFRAVLEDGALVLQYHAR
FT                   YHCPEPRPVQDCRKELAQRVADVVAQAEAEEKTPLLVLDEAELLPPALLDELHDLLQPQ
FT                   RSHHFHNAIYVLLSGAGGIEITHFVLQNASRMLPPLRHSAGSTQTEESPAQELLTSLRE
FT                   LLAREHPLWHTAAIVPFLLLDKPDVVNCFREEMAGEGFFPEQALAEHLAEQLSYYHVAG
FT                   HEFAITGCKQVVAKVNLLQHKPAHAGH"
FT   gene            complement(21927490..21939162)
FT                   /gene="A730008L03Rik"
FT                   /locus_tag="mCG_20301"
FT                   /note="gene_id=mCG20301.2"
FT   mRNA            complement(join(21927490..21928237,21928430..21928538,
FT                   21928816..21928957,21930913..21931019,21931120..21931262,
FT                   21931659..21931754,21931970..21932072,21932901..21933013,
FT                   21933934..21934119,21937629..21937859,21938213..21938312,
FT                   21938484..21938647,21938877..21939162))
FT                   /gene="A730008L03Rik"
FT                   /locus_tag="mCG_20301"
FT                   /product="RIKEN cDNA A730008L03, transcript variant
FT                   mCT20402"
FT                   /note="gene_id=mCG20301.2 transcript_id=mCT20402.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(21927490..21928237,21928430..21928538,
FT                   21928816..21928957,21930913..21931019,21931120..21931262,
FT                   21931659..21931754,21931970..21932072,21932901..21933013,
FT                   21933934..21934119,21937629..21937859,21938213..21938312,
FT                   21938484..21939156))
FT                   /gene="A730008L03Rik"
FT                   /locus_tag="mCG_20301"
FT                   /product="RIKEN cDNA A730008L03, transcript variant
FT                   mCT174071"
FT                   /note="gene_id=mCG20301.2 transcript_id=mCT174071.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(21928091..21928237,21928430..21928538,
FT                   21928816..21928957,21930913..21931019,21931120..21931262,
FT                   21931659..21931754,21931970..21932072,21932901..21933013,
FT                   21933934..21934119,21937629..21937859,21938213..21938312,
FT                   21938484..21938647,21938877..21938978))
FT                   /codon_start=1
FT                   /gene="A730008L03Rik"
FT                   /locus_tag="mCG_20301"
FT                   /product="RIKEN cDNA A730008L03, isoform CRA_b"
FT                   /note="gene_id=mCG20301.2 transcript_id=mCT20402.2
FT                   protein_id=mCP19707.1 isoform=CRA_b"
FT                   /protein_id="EDL08209.1"
FT                   /translation="MFAGLQDLGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQ
FT                   SALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLV
FT                   KMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSP
FT                   LLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVGKNVKLYDMVLQFL
FT                   RTLFLRTRNVHYCTLRAELLMSLHDLDVSDICTVDPCHKFTWCLDACIRERFVDSKRAR
FT                   ELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLSLSTIRHLQELVSQETLPRDSPDLLL
FT                   LLRLLALGQGAWDLIDSQVFKEPKMEAELITKFLPMLMSLVVDDFTFNVDQKLPAEEKA
FT                   SVTYPNTLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFS
FT                   DIFLHLLTGSLVLLADEFALEDFCSSLFDGFFLTASPRKENVHRHVLRLLLHLHARVAP
FT                   SKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLDHRKPSPTQAAETPALDLPLPSVPA
FT                   PATL"
FT   CDS             complement(join(21928091..21928237,21928430..21928538,
FT                   21928816..21928957,21930913..21931019,21931120..21931262,
FT                   21931659..21931754,21931970..21932072,21932901..21933013,
FT                   21933934..21934119,21937629..21937859,21938213..21938263))
FT                   /codon_start=1
FT                   /gene="A730008L03Rik"
FT                   /locus_tag="mCG_20301"
FT                   /product="RIKEN cDNA A730008L03, isoform CRA_a"
FT                   /note="gene_id=mCG20301.2 transcript_id=mCT174071.0
FT                   protein_id=mCP96990.0 isoform=CRA_a"
FT                   /protein_id="EDL08208.1"
FT                   /translation="MPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIW
FT                   QDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVG
FT                   KNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVSDICTVDPCHKFTWCLDA
FT                   CIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLSLSTIRHLQELVS
FT                   QETLPRDSPDLLLLLRLLALGQGAWDLIDSQVFKEPKMEAELITKFLPMLMSLVVDDFT
FT                   FNVDQKLPAEEKASVTYPNTLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLL
FT                   PGLVETFGDLAFSDIFLHLLTGSLVLLADEFALEDFCSSLFDGFFLTASPRKENVHRHV
FT                   LRLLLHLHARVAPSKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLDHRKPSPTQAAE
FT                   TPALDLPLPSVPAPATL"
FT   gene            complement(21939981..21942443)
FT                   /locus_tag="mCG_20289"
FT                   /note="gene_id=mCG20289.2"
FT   mRNA            complement(join(21939981..21940947,21941064..21941358,
FT                   21941606..21941917,21942011..21942171,21942270..21942408))
FT                   /locus_tag="mCG_20289"
FT                   /product="mCG20289, transcript variant mCT20173"
FT                   /note="gene_id=mCG20289.2 transcript_id=mCT20173.2 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(21939983..21940947,21941064..21941358,
FT                   21941606..21941694,21941783..21941917,21942011..21942171,
FT                   21942270..21942443))
FT                   /locus_tag="mCG_20289"
FT                   /product="mCG20289, transcript variant mCT174291"
FT                   /note="gene_id=mCG20289.2 transcript_id=mCT174291.0 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(21940814..21940947,21941064..21941358,
FT                   21941606..21941694,21941783..21941917,21942011..21942171,
FT                   21942270..21942376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20289"
FT                   /product="mCG20289, isoform CRA_a"
FT                   /note="gene_id=mCG20289.2 transcript_id=mCT174291.0
FT                   protein_id=mCP97210.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RSX4"
FT                   /db_xref="InterPro:IPR010736"
FT                   /db_xref="MGI:MGI:1921722"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSX4"
FT                   /protein_id="EDL08210.1"
FT                   /translation="MNFDQKAVKFLANFYINGGKHWTRGPLSQKPLHPTQPSAAAVLWW
FT                   DQELETAWDEMWHPKMKRSSSGFRLRIGAPNESTPISTGTLRELWLERRPPILMDLDVP
FT                   GPAQYEVPNMSLREASPHPQYTIGRKYPVREGGGRRAWQTMWLQSESPFMQKTDFNRET
FT                   KWPSPAEYTPLSQPAFPAFSFGDRHRSVVKMPESRFRPGMLRARGPCSYTPLLPTSKPS
FT                   GEKRPSPNTYNILPGYRLQSTRSPAFSMSRSPAFASWVSSSGTPGPAAYYVEDCYNSRF
FT                   PSSPGVVIQGVRRPKRHDTGPFCTL"
FT   CDS             complement(join(21940814..21940947,21941064..21941358,
FT                   21941606..21941881))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20289"
FT                   /product="mCG20289, isoform CRA_b"
FT                   /note="gene_id=mCG20289.2 transcript_id=mCT20173.2
FT                   protein_id=mCP19597.2 isoform=CRA_b"
FT                   /protein_id="EDL08211.1"
FT                   /translation="MSLAQPSTRCPICLCERPLHTPNTPSVASTRFEVHAPTTLPVLGE
FT                   WEPLALKTSPPTIRPTAEGGGRRAWQTMWLQSESPFMQKTDFNRETKWPSPAEYTPLSQ
FT                   PAFPAFSFGDRHRSVVKMPESRFRPGMLRARGPCSYTPLLPTSKPSGEKRPSPNTYNIL
FT                   PGYRLQSTRSPAFSMSRSPAFASWVSSSGTPGPAAYYVEDCYNSRFPSSPGVVIQGVRR
FT                   PKRHDTGPFCTL"
FT   gene            21946526..21950063
FT                   /gene="BC061039"
FT                   /locus_tag="mCG_20284"
FT                   /note="gene_id=mCG20284.2"
FT   mRNA            join(21946526..21946639,21947917..21948131,
FT                   21948236..21948495,21948585..21948711,21949102..21949196,
FT                   21949447..21949564,21949866..21950063)
FT                   /gene="BC061039"
FT                   /locus_tag="mCG_20284"
FT                   /product="cDNA sequence BC061039"
FT                   /note="gene_id=mCG20284.2 transcript_id=mCT20165.3 created
FT                   on 14-JUN-2003"
FT   CDS             join(21946584..21946639,21947917..21948131,
FT                   21948236..21948495,21948585..21948711,21949102..21949196,
FT                   21949447..21949564,21949866..21949954)
FT                   /codon_start=1
FT                   /gene="BC061039"
FT                   /locus_tag="mCG_20284"
FT                   /product="cDNA sequence BC061039"
FT                   /note="gene_id=mCG20284.2 transcript_id=mCT20165.3
FT                   protein_id=mCP19575.2"
FT                   /protein_id="EDL08212.1"
FT                   /translation="MTATQKHNLFTPEPHYIPGYAGFYPQLRYQVGNTYGRTTAQLLTD
FT                   PSVQKSPCSVLSPMTKPKFIEDFSKSKPPWIPCRDLREPYIPHYTSLKPYKNFEILGQL
FT                   PRQDVDTQGPPQVENRQGPLTAGFMPYPPYPACPPGRKGEARDLGHPGLLLAYGEEAWK
FT                   DAAPLQDTPGKNNQLYHCRRDEYLPPHPPQETLDVGRFQRLPQLDHPNLIQRKAISGYA
FT                   GFVPRFAWVMGMNYRDGVTQAMDDFDKNQFVFRHPVCALGERLPRTHWPNTTIYRSQGL
FT                   IPFYMGFIPSMQDNYALTFGNSTRRAYQKELDRRSHTL"
FT   gene            complement(21949892..21952443)
FT                   /locus_tag="mCG_20287"
FT                   /note="gene_id=mCG20287.2"
FT   mRNA            complement(join(21949892..21951152,21951718..21951828,
FT                   21951908..21952016,21952318..21952443))
FT                   /locus_tag="mCG_20287"
FT                   /product="mCG20287"
FT                   /note="gene_id=mCG20287.2 transcript_id=mCT20170.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(21950365..21951152,21951718..21951828,
FT                   21951908..21952016,21952318..21952374))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20287"
FT                   /product="mCG20287"
FT                   /note="gene_id=mCG20287.2 transcript_id=mCT20170.2
FT                   protein_id=mCP19580.2"
FT                   /protein_id="EDL08213.1"
FT                   /translation="MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE
FT                   RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRI
FT                   MNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTY
FT                   GDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQY
FT                   RALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSY
FT                   FVEWIPQQCEDSCL"
FT   gene            complement(21956683..21962073)
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /note="gene_id=mCG20309.2"
FT   mRNA            complement(join(21956683..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960298,21960758..21960844,
FT                   21961093..21961216,21961351..21961495,21961970..21962027))
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, transcript variant mCT20410"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT20410.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(21956689..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960298,21960758..21960844,
FT                   21961351..21961495,21961970..21962073))
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, transcript variant mCT174075"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT174075.0 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(21956689..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960298,21960758..21960844,
FT                   21961093..21961216,21961970..21962045))
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, transcript variant mCT174074"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT174074.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(21956841..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960298,21960758..21960844,
FT                   21961093..21961177))
FT                   /codon_start=1
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT174074.0
FT                   protein_id=mCP96993.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q80SU6"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="MGI:MGI:2159410"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80SU6"
FT                   /protein_id="EDL08215.1"
FT                   /translation="MPNSLAGGQVPNPTLDAFDLVDRSLRNAGISGSIPGLEEGGTDPW
FT                   TFSPLKNADQLKEVGMASRLRRVVSSFLKACGLLGSLYFFICSLDILSSAFQLLGSKMA
FT                   GDIFKDNVVLSNPVAGLVIGVLVTVLVQSSSTSSSIVVSMVASKLLTVQVSVPIIMGVN
FT                   VGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATAALERLSELA
FT                   LGAASLQPGQQAPDILKALTRPFTHLIIQLDSSVITSGITSNTTNSSLIKHWCGFRGET
FT                   PQGSSEGCGLFSSCTERNSSASPEEDRLLCHHLFAGSKLTDLAVGFILLAGSLLVLCVC
FT                   LVLIVKLLNSVLKGRIAQAVKTVINADFPFPFGWLSGYLAILVGAGLTFLLQSSSVFTA
FT                   AIVPLMGVGVIDLERAYPLFLGSNIGTTTTALLAALASPADMLIFAVQVALIHFFFNLA
FT                   GILLWYLVPVLRLPIPLAKRFGNLTAQYRWVAIVYLLLTFLLLPLAAFGLSLAGGTVLA
FT                   AVGGPLVGLVLLIILVNVLQQHRPSWLPRCLQSWAWLPLWLHSLEPWDRLVTACCPCRA
FT                   CSNSPMTSKVAHCYENPQVIASQQL"
FT   CDS             complement(join(21956841..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960298,21960758..21960844,
FT                   21961093..21961177))
FT                   /codon_start=1
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT20410.2
FT                   protein_id=mCP19616.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q80SU6"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="MGI:MGI:2159410"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80SU6"
FT                   /protein_id="EDL08216.1"
FT                   /translation="MPNSLAGGQVPNPTLDAFDLVDRSLRNAGISGSIPGLEEGGTDPW
FT                   TFSPLKNADQLKEVGMASRLRRVVSSFLKACGLLGSLYFFICSLDILSSAFQLLGSKMA
FT                   GDIFKDNVVLSNPVAGLVIGVLVTVLVQSSSTSSSIVVSMVASKLLTVQVSVPIIMGVN
FT                   VGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATAALERLSELA
FT                   LGAASLQPGQQAPDILKALTRPFTHLIIQLDSSVITSGITSNTTNSSLIKHWCGFRGET
FT                   PQGSSEGCGLFSSCTERNSSASPEEDRLLCHHLFAGSKLTDLAVGFILLAGSLLVLCVC
FT                   LVLIVKLLNSVLKGRIAQAVKTVINADFPFPFGWLSGYLAILVGAGLTFLLQSSSVFTA
FT                   AIVPLMGVGVIDLERAYPLFLGSNIGTTTTALLAALASPADMLIFAVQVALIHFFFNLA
FT                   GILLWYLVPVLRLPIPLAKRFGNLTAQYRWVAIVYLLLTFLLLPLAAFGLSLAGGTVLA
FT                   AVGGPLVGLVLLIILVNVLQQHRPSWLPRCLQSWAWLPLWLHSLEPWDRLVTACCPCRA
FT                   CSNSPMTSKVAHCYENPQVIASQQL"
FT   CDS             complement(join(21956841..21957305,21958363..21958487,
FT                   21958563..21958679,21958766..21958933,21959013..21959100,
FT                   21959211..21959300,21959458..21959653,21959741..21959852,
FT                   21959937..21960080,21960170..21960290))
FT                   /codon_start=1
FT                   /gene="Slc34a3"
FT                   /locus_tag="mCG_20309"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG20309.2 transcript_id=mCT174075.0
FT                   protein_id=mCP96994.0 isoform=CRA_a"
FT                   /protein_id="EDL08214.1"
FT                   /translation="MASRLRRVVSSFLKACGLLGSLYFFICSLDILSSAFQLLGSKMAG
FT                   DIFKDNVVLSNPVAGLVIGVLVTVLVQSSSTSSSIVVSMVASKLLTVQVSVPIIMGVNV
FT                   GTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATAALERLSELAL
FT                   GAASLQPGQQAPDILKALTRPFTHLIIQLDSSVITSGITSNTTNSSLIKHWCGFRGETP
FT                   QGSSEGCGLFSSCTERNSSASPEEDRLLCHHLFAGSKLTDLAVGFILLAGSLLVLCVCL
FT                   VLIVKLLNSVLKGRIAQAVKTVINADFPFPFGWLSGYLAILVGAGLTFLLQSSSVFTAA
FT                   IVPLMGVGVIDLERAYPLFLGSNIGTTTTALLAALASPADMLIFAVQVALIHFFFNLAG
FT                   ILLWYLVPVLRLPIPLAKRFGNLTAQYRWVAIVYLLLTFLLLPLAAFGLSLAGGTVLAA
FT                   VGGPLVGLVLLIILVNVLQQHRPSWLPRCLQSWAWLPLWLHSLEPWDRLVTACCPCRAC
FT                   SNSPMTSKVAHCYENPQVIASQQL"
FT   gene            complement(21966617..21967689)
FT                   /gene="2310002J15Rik"
FT                   /locus_tag="mCG_20300"
FT                   /note="gene_id=mCG20300.0"
FT   mRNA            complement(join(21966617..21967296,21967595..21967689))
FT                   /gene="2310002J15Rik"
FT                   /locus_tag="mCG_20300"
FT                   /product="RIKEN cDNA 2310002J15"
FT                   /note="gene_id=mCG20300.0 transcript_id=mCT20176.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(21966860..21967288)
FT                   /codon_start=1
FT                   /gene="2310002J15Rik"
FT                   /locus_tag="mCG_20300"
FT                   /product="RIKEN cDNA 2310002J15"
FT                   /note="gene_id=mCG20300.0 transcript_id=mCT20176.0
FT                   protein_id=mCP19702.1"
FT                   /protein_id="EDL08217.1"
FT                   /translation="MDPHEMVVKNPYAHISIPRAHLRSDLGQQLEEVPSSSSSSETQPL
FT                   PAGTCIPEPVGLLQTTEAPGPKGIKGIKGTAPEHGQQTWQSPCNPYSSGQRPSGLTYAG
FT                   LPPVGRGDDIAHHCCCCPCCSCCHCPRFCRCHSCCVIS"
FT   gene            21970865..21972189
FT                   /gene="1110061N23Rik"
FT                   /locus_tag="mCG_55810"
FT                   /note="gene_id=mCG55810.1"
FT   mRNA            join(21970865..21970938,21971127..21972189)
FT                   /gene="1110061N23Rik"
FT                   /locus_tag="mCG_55810"
FT                   /product="RIKEN cDNA 1110061N23"
FT                   /note="gene_id=mCG55810.1 transcript_id=mCT55993.1 created
FT                   on 09-OCT-2002"
FT   CDS             21971223..21972020
FT                   /codon_start=1
FT                   /gene="1110061N23Rik"
FT                   /locus_tag="mCG_55810"
FT                   /product="RIKEN cDNA 1110061N23"
FT                   /note="gene_id=mCG55810.1 transcript_id=mCT55993.1
FT                   protein_id=mCP39934.0"
FT                   /db_xref="GOA:Q8K0W3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1916096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0W3"
FT                   /protein_id="EDL08218.1"
FT                   /translation="MPADPGPEVGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELP
FT                   AATPCFPPAPRPTPTLAPKRAWPSDTEIIVNQACGGDMPTLEGASHTPPLPRRPRKGSS
FT                   ELGFPRVAPVDEVIVNQYVIRPGPTASAPSSSGPVIAGEPLECPTCGHTYNVTQRRPRV
FT                   LSCLHSVCEQCLQILYESCPKYKFISCPTCHRETVLFTDYGLAALAVNTSILSRLPPEA
FT                   LTAPSGGQWGGESEGSCYQTFRQYCGAACTCHVRNPLSACSIM"
FT   gene            complement(21975151..21983335)
FT                   /gene="Ndor1"
FT                   /locus_tag="mCG_20283"
FT                   /note="gene_id=mCG20283.2"
FT   mRNA            complement(join(21975151..21975780,21975886..21975980,
FT                   21976048..21976166,21976262..21976411,21976558..21976672,
FT                   21976831..21976938,21977026..21977246,21977331..21977452,
FT                   21977720..21977929,21978022..21978123,21978206..21978304,
FT                   21979647..21979744,21982790..21982867,21983143..21983335))
FT                   /gene="Ndor1"
FT                   /locus_tag="mCG_20283"
FT                   /product="NADPH dependent diflavin oxidoreductase 1,
FT                   transcript variant mCT20167"
FT                   /note="gene_id=mCG20283.2 transcript_id=mCT20167.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(21975636..21975780,21975886..21975980,
FT                   21976048..21976166,21976262..21976411,21976558..21976672,
FT                   21976831..21976938,21977026..21977246,21977331..21977452,
FT                   21977720..21977929,21978022..21978123,21978206..21978304,
FT                   21979647..21979744,21982790..21982867,21983143..21983277))
FT                   /codon_start=1
FT                   /gene="Ndor1"
FT                   /locus_tag="mCG_20283"
FT                   /product="NADPH dependent diflavin oxidoreductase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20283.2 transcript_id=mCT20167.2
FT                   protein_id=mCP19511.2 isoform=CRA_b"
FT                   /protein_id="EDL08220.1"
FT                   /translation="MQVPQLLVLFGSQTGTAQDEAERLGREARRRRLGCRVQALDSYSV
FT                   ANLIREPLVIFVCATTGQGDPPDNMKNFWRFIFRKSLPSSSLCQMDFAVLGLGDSSYAK
FT                   FNFVAKKLHRRLLQLGGSALLPPCLGDDQHELGPDAAIDPWVGDLWEKIMVMYPVPLDI
FT                   PEIPHGVPLPSKFIFQFLQEVPSIGAEELNIASSAPQTPPSELQPFLAPVITNQRVTGP
FT                   QHFQDVRLIEFDITDSNISFAAGDVVFILPSNSEAHTQQFCQVLCLDPNQFFTLKPREP
FT                   GVPDPPGLPQPCTVWNLVSQYLDIASVPRRSFFELLACLSQHALEREKLLELSSARGQE
FT                   ELWEYCSRPRRTILEVLCDFPHTAGAIPPDYLLDLIPRIRPRAFSIASSLLAHPRRLQI
FT                   LVAVVKYQTRLKEPRHGLCSSWLASLNPGQAGPVRVPLWVRPGSLVFPKTPDTPIIMVG
FT                   AGTGVAPFRAAIQERVAHGQTGNFLFFGCRQRDQDFYWQTEWQKLEQKGWLTLVTAFSR
FT                   EQEQKVYVQHRLRELGPLVWELLDGQGAYFYLAGNAKYLPTDVSEALMSIFQEEGRLST
FT                   ADASAYLARLQQTLRFQTETWA"
FT   mRNA            complement(join(<21976233..21976411,21976558..21976672,
FT                   21976831..21976938,21977026..21977246,21977331..21977452,
FT                   21977720..21977929,21978022..21978123,21978206..21978304,
FT                   21979647..21979744,21982790..>21982936))
FT                   /gene="Ndor1"
FT                   /locus_tag="mCG_20283"
FT                   /product="NADPH dependent diflavin oxidoreductase 1,
FT                   transcript variant mCT190090"
FT                   /note="gene_id=mCG20283.2 transcript_id=mCT190090.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(21976233..21976411,21976558..21976672,
FT                   21976831..21976938,21977026..21977246,21977331..21977452,
FT                   21977720..21977929,21978022..21978123,21978206..21978304,
FT                   21979647..21979744,21982790..21982936))
FT                   /codon_start=1
FT                   /gene="Ndor1"
FT                   /locus_tag="mCG_20283"
FT                   /product="NADPH dependent diflavin oxidoreductase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20283.2 transcript_id=mCT190090.0
FT                   protein_id=mCP111112.0 isoform=CRA_a"
FT                   /protein_id="EDL08219.1"
FT                   /translation="MRCREGTDQGCQRPYIYLCLVLEANLIREPLVIFVCATTGQGDPP
FT                   DNMKNFWRFIFRKSLPSSSLCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLP
FT                   PCLGDDQHELGPDAAIDPWVGDLWEKIMVMYPVPLDIPEIPHGVPLPSKFIFQFLQEVP
FT                   SIGAEELNIASSAPQTPPSELQPFLAPVITNQRVTGPQHFQDVRLIEFDITDSNISFAA
FT                   GDVVFILPSNSEAHTQQFCQVLCLDPNQFFTLKPREPGVPDPPGLPQPCTVWNLVSQYL
FT                   DIASVPRRSFFELLACLSQHALEREKLLELSSARGQEELWEYCSRPRRTILEVLCDFPH
FT                   TAGAIPPDYLLDLIPRIRPRAFSIASSLLAHPRRLQILVAVVKYQTRLKEPRHGLCSSW
FT                   LASLNPGQAGPVRVPLWVRPGSLVFPKTPDTPIIMVGAGTGVAPFRAAIQERVAHGQTG
FT                   EYWSSKAV"
FT   gene            21983387..21984216
FT                   /gene="C730025P13Rik"
FT                   /locus_tag="mCG_50986"
FT                   /note="gene_id=mCG50986.1"
FT   mRNA            21983387..21984216
FT                   /gene="C730025P13Rik"
FT                   /locus_tag="mCG_50986"
FT                   /product="RIKEN cDNA C730025P13"
FT                   /note="gene_id=mCG50986.1 transcript_id=mCT51169.1 created
FT                   on 07-OCT-2002"
FT   CDS             21983596..21984006
FT                   /codon_start=1
FT                   /gene="C730025P13Rik"
FT                   /locus_tag="mCG_50986"
FT                   /product="RIKEN cDNA C730025P13"
FT                   /note="gene_id=mCG50986.1 transcript_id=mCT51169.1
FT                   protein_id=mCP39929.0"
FT                   /protein_id="EDL08221.1"
FT                   /translation="MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLTPGLS
FT                   WWNVFVPFFAADGLSTYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQK
FT                   LVEQTRELWFGLITSPVFILLQLLMIRACRVN"
FT   gene            <21991153..21997683
FT                   /gene="C430004E15Rik"
FT                   /locus_tag="mCG_20315"
FT                   /note="gene_id=mCG20315.3"
FT   mRNA            join(<21991153..21992244,21996523..21996736,
FT                   21996824..21996930,21997047..>21997109)
FT                   /gene="C430004E15Rik"
FT                   /locus_tag="mCG_20315"
FT                   /product="RIKEN cDNA C430004E15, transcript variant
FT                   mCT190071"
FT                   /note="gene_id=mCG20315.3 transcript_id=mCT190071.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(21991153..21992244,21996523..21996736,
FT                   21996824..21996930,21997047..21997109)
FT                   /codon_start=1
FT                   /gene="C430004E15Rik"
FT                   /locus_tag="mCG_20315"
FT                   /product="RIKEN cDNA C430004E15, isoform CRA_a"
FT                   /note="gene_id=mCG20315.3 transcript_id=mCT190071.0
FT                   protein_id=mCP111025.0 isoform=CRA_a"
FT                   /protein_id="EDL08222.1"
FT                   /translation="MTQESPTGPANGLSGSPPVPGKWKPKVESKEPSLHPPPSPGTPSA
FT                   TSVGPPAFPAPSPASATPSQRQWVSSATSANDSFEIRPSSKPDMETIPIGDLQARALAN
FT                   LRVNSRNSFVLIPKRKAPGNYPLAGRQFEEPKGEVGWASQSQGLGSQLVSTVDGAPALE
FT                   KSPLAAEMQWAVRKGACPRPAISDTDKCVRWQRPASPPPFLPATAEAEPAEGLGVPGLA
FT                   KNGQEPVRPGLPVTFIDEVDSEEEAFQEAKLPSSAVGVPSQYHLHPARPGHTSELLNRG
FT                   SNTFTVVPKRKPGTLQEPHLSQTNGQSQQGAEEQDAESLSGPHTTLENTLKKRYPTVHE
FT                   IEVIGGYLALQKSCLIKAGSSRKKMKISFNDKSLHTTFEYPSESSLAQEEAEEEEEEEG
FT                   EEDGEEEEVGPDSEKPFTVFLPRATFVSSVGPESSSGLSSYTPKHSMAFSKWQEQTLVQ
FT                   TPTDVELPPKEVMLTPASQNDLSDFRSEPALYF"
FT   mRNA            join(21991316..21992251,21996523..21996736,
FT                   21996824..21996930,21997047..21997683)
FT                   /gene="C430004E15Rik"
FT                   /locus_tag="mCG_20315"
FT                   /product="RIKEN cDNA C430004E15, transcript variant
FT                   mCT20417"
FT                   /note="gene_id=mCG20315.3 transcript_id=mCT20417.2 created
FT                   on 07-OCT-2002"
FT   CDS             join(21991417..21992251,21996523..21996542)
FT                   /codon_start=1
FT                   /gene="C430004E15Rik"
FT                   /locus_tag="mCG_20315"
FT                   /product="RIKEN cDNA C430004E15, isoform CRA_b"
FT                   /note="gene_id=mCG20315.3 transcript_id=mCT20417.2
FT                   protein_id=mCP19613.2 isoform=CRA_b"
FT                   /protein_id="EDL08223.1"
FT                   /translation="METIPIGDLQARALANLRVNSRNSFVLIPKRKAPGNYPLAGRQFE
FT                   EPKGEVGWASQSQGLGSQLVSTVDGAPALEKSPLAAEMQWAVRKGACPRPAISDTDKCV
FT                   RWQRPASPPPFLPATAEAEPAEGLGVPGLAKNGQEPVRPGLPVTFIDEVDSEEEAFQEA
FT                   KLPSSAVGVPSQYHLHPARPGHTSELLNRGSNTFTVVPKRKPGTLQEPHLSQTNGQSQQ
FT                   GAEEQDAESLSGPHTTLENTLKKRYPTVHEIEVIGGYLALQKSCLIKAGSSRKKVSDED
FT                   LLQ"
FT   gene            complement(21998731..>22000083)
FT                   /gene="Ssna1"
FT                   /locus_tag="mCG_20298"
FT                   /note="gene_id=mCG20298.3"
FT   mRNA            complement(join(21998731..21999272,21999620..21999819,
FT                   22000000..>22000083))
FT                   /gene="Ssna1"
FT                   /locus_tag="mCG_20298"
FT                   /product="Sjogren's syndrome nuclear autoantigen 1,
FT                   transcript variant mCT190134"
FT                   /note="gene_id=mCG20298.3 transcript_id=mCT190134.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(21998734..21999272,21999620..21999819,
FT                   21999989..22000080))
FT                   /gene="Ssna1"
FT                   /locus_tag="mCG_20298"
FT                   /product="Sjogren's syndrome nuclear autoantigen 1,
FT                   transcript variant mCT20400"
FT                   /note="gene_id=mCG20298.3 transcript_id=mCT20400.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(21999165..21999272,21999620..21999819,
FT                   21999989..22000040))
FT                   /codon_start=1
FT                   /gene="Ssna1"
FT                   /locus_tag="mCG_20298"
FT                   /product="Sjogren's syndrome nuclear autoantigen 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20298.3 transcript_id=mCT20400.2
FT                   protein_id=mCP19493.2 isoform=CRA_b"
FT                   /protein_id="EDL08225.1"
FT                   /translation="MTQQGAALQNYNNELVKCIEELCQKREELCRQIQQEEDEKQRLQN
FT                   EVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLT
FT                   KATASDQKSSGGKDS"
FT   CDS             complement(join(21999165..21999272,21999620..21999819,
FT                   22000000..>22000036))
FT                   /codon_start=1
FT                   /gene="Ssna1"
FT                   /locus_tag="mCG_20298"
FT                   /product="Sjogren's syndrome nuclear autoantigen 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20298.3 transcript_id=mCT190134.0
FT                   protein_id=mCP111118.0 isoform=CRA_a"
FT                   /protein_id="EDL08224.1"
FT                   /translation="PNRARRCRTTTTSIEELCQKREELCRQIQQEEDEKQRLQNEVRQL
FT                   TEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAS
FT                   DQKSSGGKDS"
FT   gene            22000197..22013424
FT                   /gene="Anapc2"
FT                   /locus_tag="mCG_20311"
FT                   /note="gene_id=mCG20311.1"
FT   mRNA            join(22000197..22000356,22000594..22001216,
FT                   22001479..22001611,22002345..22002519,22003845..22003964,
FT                   22005164..22005281,22005852..22006033,22006700..22006841,
FT                   22007655..22007730,22007811..22008014,22012072..22012201,
FT                   22012447..22012682,22012761..22013424)
FT                   /gene="Anapc2"
FT                   /locus_tag="mCG_20311"
FT                   /product="anaphase promoting complex subunit 2"
FT                   /note="gene_id=mCG20311.1 transcript_id=mCT20412.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22000207..22000356,22000594..22001216,
FT                   22001479..22001611,22002345..22002519,22003845..22003964,
FT                   22005164..22005281,22005852..22006033,22006700..22006841,
FT                   22007655..22007730,22007811..22008014,22012072..22012201,
FT                   22012447..22012682,22012761..22012973)
FT                   /codon_start=1
FT                   /gene="Anapc2"
FT                   /locus_tag="mCG_20311"
FT                   /product="anaphase promoting complex subunit 2"
FT                   /note="gene_id=mCG20311.1 transcript_id=mCT20412.1
FT                   protein_id=mCP19697.2"
FT                   /db_xref="GOA:Q3U430"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="MGI:MGI:2139135"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U430"
FT                   /protein_id="EDL08226.1"
FT                   /translation="MEAEGVAVAAAAAAATIIASDDCDSRPGQELLVAWNTVSTGLVPP
FT                   AALGLASSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQGNIATEFWN
FT                   AIALRENSVDEPQCLGLLLDAFGLLESRLDPYLHSLELLEKWTRLGLLMGAGAQGLREK
FT                   VHTMLRGVLFFSTPRTFQEMVQRLYGRFLRVYMQSKRKGEGGTDPELEGELDSRYARRR
FT                   YYRLLQSPLCAGCGSDKQQCWCRQALEQFNQLSQVLHRLSLLERVCAEAVTTTLHQVTR
FT                   ERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDNPTRPTSPEAGNTLRRWRCHVQ
FT                   RFFYRIYATLRIEELFSIIRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKVALETRLLH
FT                   PGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSD
FT                   GTGDLAVELSKTDPACLETGQDSEDDSGEPEDWVPDPVDADPVKSSSKRRSSDIISLLV
FT                   SIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMA
FT                   DSRRINANIREEDEKRPVEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALDVYCK
FT                   KYEKLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVVLLYFQNQASWTLEELSK
FT                   VVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMAS
FT                   QADQKEEELLLFWAYIQAMLTNLESLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQK
FT                   KVRDQQLIYSAGVYRLPKNSN"
FT   gene            22015639..22016702
FT                   /locus_tag="mCG_20310"
FT                   /note="gene_id=mCG20310.2"
FT   mRNA            join(22015639..22015772,22016275..22016304,
FT                   22016466..22016702)
FT                   /locus_tag="mCG_20310"
FT                   /product="mCG20310, transcript variant mCT173782"
FT                   /note="gene_id=mCG20310.2 transcript_id=mCT173782.0 created
FT                   on 27-SEP-2002"
FT   mRNA            join(22015653..22015772,22015927..22016062,
FT                   22016275..22016304,22016466..22016692)
FT                   /locus_tag="mCG_20310"
FT                   /product="mCG20310, transcript variant mCT20411"
FT                   /note="gene_id=mCG20310.2 transcript_id=mCT20411.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22015685..22015772,22015927..22016062,
FT                   22016275..22016304,22016466..22016655)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20310"
FT                   /product="mCG20310, isoform CRA_b"
FT                   /note="gene_id=mCG20310.2 transcript_id=mCT20411.1
FT                   protein_id=mCP19543.1 isoform=CRA_b"
FT                   /protein_id="EDL08228.1"
FT                   /translation="MAPCPQPESCPAGSPLGLICLSLLLIPASAGTYCECSLGLSREAL
FT                   IALIVVLAGVSASCFCALVVVAIGVFRAKGDTCPGHSENRLVGPYGVQEDRIDLHTVHV
FT                   ESHLMDPDLDVSMMPSLDGPGLMTMTAPLEPPPPPPPPPPLPQ"
FT   CDS             join(22015741..22015772,22016275..22016304,
FT                   22016466..22016655)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20310"
FT                   /product="mCG20310, isoform CRA_a"
FT                   /note="gene_id=mCG20310.2 transcript_id=mCT173782.0
FT                   protein_id=mCP96701.0 isoform=CRA_a"
FT                   /protein_id="EDL08227.1"
FT                   /translation="MSVPFAHPCFSDTCPGHSENRLVGPYGVQEDRIDLHTVHVESHLM
FT                   DPDLDVSMMPSLDGPGLMTMTAPLEPPPPPPPPPPLPQ"
FT   gene            22017426..22018687
FT                   /gene="BC004853"
FT                   /locus_tag="mCG_20291"
FT                   /note="gene_id=mCG20291.3"
FT   mRNA            join(22017426..22018171,22018248..22018687)
FT                   /gene="BC004853"
FT                   /locus_tag="mCG_20291"
FT                   /product="cDNA sequence BC004853"
FT                   /note="gene_id=mCG20291.3 transcript_id=mCT20171.3 created
FT                   on 14-JUN-2003"
FT   CDS             join(22017499..22018171,22018248..22018570)
FT                   /codon_start=1
FT                   /gene="BC004853"
FT                   /locus_tag="mCG_20291"
FT                   /product="cDNA sequence BC004853"
FT                   /note="gene_id=mCG20291.3 transcript_id=mCT20171.3
FT                   protein_id=mCP19689.2"
FT                   /protein_id="EDL08229.1"
FT                   /translation="MRGSFFSRLPPQLSLLLLLSLRRVWTQEDIGTAPSKSPVAPECPE
FT                   ACSCSLGGKANCSALALPAVPADLSWQVRSLLLDHNRVSALPPGAFANAGALLYLDLRE
FT                   NRLRSVHARAFWGLGVLQWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSIL
FT                   GPLPLLRVLSLQDNSLSAIEAGLLNNLPALDVLRLHGNPWTCNCALRPLCTWLRKHPRP
FT                   ASETETLLCVSPRLQTLSLLTAFPDAAFKQCTQSLAARDLAVVYALGPVSFLASLAICL
FT                   ALGSVLTACGARRRRRRRTTVRHLLRRQLDPEGPPSLEDAGSPVTAAIQA"
FT   gene            <22018766..22026438
FT                   /locus_tag="mCG_145915"
FT                   /note="gene_id=mCG145915.0"
FT   mRNA            join(<22018766..22018852,22021167..22021421,
FT                   22023384..22023551,22024091..22026438)
FT                   /locus_tag="mCG_145915"
FT                   /product="mCG145915"
FT                   /note="gene_id=mCG145915.0 transcript_id=mCT186023.0
FT                   created on 04-JUL-2003"
FT   gene            complement(22019757..22046480)
FT                   /gene="Grin1"
FT                   /locus_tag="mCG_20293"
FT                   /note="gene_id=mCG20293.1"
FT   mRNA            complement(join(22019757..22019994,22021948..22022058,
FT                   22023302..22023447,22023535..22023644,22024058..22024219,
FT                   22024387..22024544,22024658..22024806,22024880..22024992,
FT                   22025106..22025224,22025298..22025462,22025696..22025823,
FT                   22025904..22026045,22031226..22031309,22031407..22031551,
FT                   22032538..22032713,22032786..22032907,22037876..22037976,
FT                   22040929..22041105,22044256..22044390,22046130..22046480))
FT                   /gene="Grin1"
FT                   /locus_tag="mCG_20293"
FT                   /product="glutamate receptor, ionotropic, NMDA1 (zeta 1)"
FT                   /note="gene_id=mCG20293.1 transcript_id=mCT20178.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(<22023456..22023551,22024091..22024522)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145915"
FT                   /product="mCG145915"
FT                   /note="gene_id=mCG145915.0 transcript_id=mCT186023.0
FT                   protein_id=mCP107417.0"
FT                   /protein_id="EDL08230.1"
FT                   /translation="RDPQQPAQRLEPQENPSQDHGSMEGAPAMFSKGLSLRMPMPKPER
FT                   KNSSPVVTRSHFCEASNSSTAESQMKAWSLLPAESGSKEPRVACSPHPAHTAEDSLHLC
FT                   LLGERAPLFLSLYCPPQPGRPLVCLLTCPAQPGWPQLHSHNCASPCAGTWCSTPPASGS
FT                   RYPQSSVLQLHR"
FT   CDS             complement(join(22031495..22031551,22032538..22032713,
FT                   22032786..22032907,22037876..22037976,22040929..22041105,
FT                   22044256..22044390,22046130..22046387))
FT                   /codon_start=1
FT                   /gene="Grin1"
FT                   /locus_tag="mCG_20293"
FT                   /product="glutamate receptor, ionotropic, NMDA1 (zeta 1)"
FT                   /note="gene_id=mCG20293.1 transcript_id=mCT20178.1
FT                   protein_id=mCP19449.2"
FT                   /protein_id="EDL08231.1"
FT                   /translation="MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREA
FT                   VNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTP
FT                   TPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHI
FT                   ILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLMEARDLEARVIILS
FT                   ASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHI
FT                   SDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKDRTTVQEGADVFQVCRWSDWPCGI
FT                   Q"
FT   gene            complement(22055506..22059729)
FT                   /locus_tag="mCG_1030131"
FT                   /note="gene_id=mCG1030131.1"
FT   mRNA            complement(join(22055506..22056263,22059690..22059729))
FT                   /locus_tag="mCG_1030131"
FT                   /product="mCG1030131"
FT                   /note="gene_id=mCG1030131.1 transcript_id=mCT147835.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(22055744..22055845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030131"
FT                   /product="mCG1030131"
FT                   /note="gene_id=mCG1030131.1 transcript_id=mCT147835.1
FT                   protein_id=mCP51138.1"
FT                   /protein_id="EDL08232.1"
FT                   /translation="MPSIKWSYSSHHVGDPSDTQCLLFTAEPLTPQS"
FT   gene            22060324..22079749
FT                   /gene="Man1b1"
FT                   /locus_tag="mCG_20295"
FT                   /note="gene_id=mCG20295.1"
FT   mRNA            join(22060324..22060518,22060977..22061085,
FT                   22061919..22062034,22065654..22065808,22069109..22069218,
FT                   22070751..22070936,22072495..22072643,22072933..22073121,
FT                   22075573..22075763,22076108..22076228,22076707..22076904,
FT                   22076988..22077119,22077899..22079749)
FT                   /gene="Man1b1"
FT                   /locus_tag="mCG_20295"
FT                   /product="mannosidase, alpha, class 1B, member 1"
FT                   /note="gene_id=mCG20295.1 transcript_id=mCT20179.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(22060402..22060518,22060977..22061085,
FT                   22061919..22062034,22065654..22065808,22069109..22069218,
FT                   22070751..22070936,22072495..22072643,22072933..22073121,
FT                   22075573..22075763,22076108..22076228,22076707..22076904,
FT                   22076988..22077119,22077899..22078102)
FT                   /codon_start=1
FT                   /gene="Man1b1"
FT                   /locus_tag="mCG_20295"
FT                   /product="mannosidase, alpha, class 1B, member 1"
FT                   /note="gene_id=mCG20295.1 transcript_id=mCT20179.2
FT                   protein_id=mCP19529.2"
FT                   /db_xref="GOA:A2AJ15"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="MGI:MGI:2684954"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2AJ15"
FT                   /protein_id="EDL08233.1"
FT                   /translation="MYPPPAPPPAPHRDFISVTLSLGESYDNSKSRRRRSCWRKWKQLS
FT                   RLQRNVILFVLGFLILCGFLYSLHTADQWKALSGRPAEVEKMKQEVLPVLPAPQKESAE
FT                   QEGFADILSQKRQRHFRRGPPHLQIRPPNTVSKDGMQDDAKEREAALGKAQQEENTQRT
FT                   VISWRGAVIEPEQATELPYKRAEASIKPLVLASKIWKEPAPPNERQKGVIEAFLHAWKG
FT                   YQKFAWGHDELKPVSKTFSEWFGLGLTLIDALDTMWILGLKQEFKQARKWVSENLDFQK
FT                   NVDVNLFESTIRILGGLLSTYHLSGDSLFLTKAEDFGKRLMPAFTTPSKIPYSDVNIGT
FT                   GFAHSPQWTSDSTVAEVTSIQLEFRELSRLTGIKKFQEAVEEVTKHIHSLSGKKDGLVP
FT                   MFINTNSGLFTHPGVFTLGARADSYYEYLLKQWIQGGKKETQLLEDYVKAIEGIKAHLL
FT                   RQSQPRKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVHHGLPADHMDLARALMETCYQ
FT                   MNQQMETGLSPEIAHFNMYPRADHKDVEVKPADRHNLLRPETVESLFYLYRVTRDRKYQ
FT                   DWGWEILQSFNKYTRVPSGGYSSINNVQNSHKPEPRDKMESFFVGETLKYLYLLFSDDL
FT                   ELLSLDSCVFNTEAHPLPIWAPA"
FT   gene            complement(22079796..>22083890)
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /note="gene_id=mCG20304.3"
FT   mRNA            complement(join(22079796..22080104,22080224..22080294,
FT                   22080691..22080755,22080898..22081054,22081146..22081264,
FT                   22081771..22081831,22082006..22082172,22082279..22082360,
FT                   22082431..22082566,22083096..22083259,22083352..22083491,
FT                   22083567..22083680,22083769..>22083865))
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, transcript variant
FT                   mCT20406"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT20406.2 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(22079815..22080104,22080224..22080294,
FT                   22080691..22080755,22080898..22081054,22081771..22081831,
FT                   22082006..22082172,22082279..22082360,22082431..22083259,
FT                   22083352..22083680,22083769..>22083890))
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, transcript variant
FT                   mCT190177"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT190177.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(22079825..22080104,22080224..22080294,
FT                   22080691..22081831,22082006..22082172,22082279..22082360,
FT                   22082431..22083491,22083567..22083680,22083769..>22083870))
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, transcript variant
FT                   mCT190178"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT190178.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(22079831..22080104,22080224..22080294,
FT                   22080691..22080755,22080898..22081054,22081771..22081831,
FT                   22082006..22082172,22082279..22082360,22082431..22082566,
FT                   22083096..22083259,22083352..22083491,22083567..22083680,
FT                   22083769..>22083865))
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, transcript variant
FT                   mCT173780"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT173780.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22079957..22080104,22080224..22080294,
FT                   22080691..22080755,22080898..22081054,22081146..22081264,
FT                   22081771..22081831,22082006..22082172,22082279..22082360,
FT                   22082431..22082566,22083096..22083259,22083352..22083491,
FT                   22083567..22083680,22083769..22083865))
FT                   /codon_start=1
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, isoform CRA_d"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT20406.2
FT                   protein_id=mCP19599.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q9ET22"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:1933213"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ET22"
FT                   /protein_id="EDL08237.1"
FT                   /translation="MNFHPCYPVDHGVPSWILVLLLSLGLCNLQARADRVLDPDFHENY
FT                   FEQYMDHFNFESFGNKTFGQRFLVSDKFWKMGEGPIFFYTGNEGDIWSFANNSGFMVEL
FT                   AAQQEALLVFAEHRYYGKSLPFGVQSTQRGYTQLLTVEQALADFAVLLQALRQDLGVHD
FT                   APTIAFGGSYGGMLSAYMRMKYPHLVAGALAASAPVVAVAGLGDSYQFFRDVTADFYGQ
FT                   SPKCAQAVRDAFQQIKDLFLQGAYDTISQNFGTCQSLSSPKDLTQLFGFARNAFTVLAM
FT                   MDYPYPTDFLGPLPANPVKVGCQRLLNEGQRIMGLRALAGLVYNSSGTEPCYDIYRLYQ
FT                   SCADPTGCGTGSDARAWDYQACTEINLTFDSNNVTDMFPEIPFSEELRQQYCLDTWGVW
FT                   PRQDWLQTSFWGGDLKAASNIIFSNGDLDPWAGGGIQSNLSTSVIAVTIQGGAHHLDLR
FT                   ASNSEDPPSVVEVRKLESTLIREWVAAARLKQPAMPRWPGPKKQHPSR"
FT   CDS             complement(join(22079957..22080104,22080224..22080294,
FT                   22080691..>22081011))
FT                   /codon_start=1
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, isoform CRA_c"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT190178.0
FT                   protein_id=mCP111167.0 isoform=CRA_c"
FT                   /protein_id="EDL08236.1"
FT                   /translation="QTCFLKSHSLKNSASNTVWIHGACGLGKTGCRPASGVVVKAWAGV
FT                   WELDAGKDPVLCPELVLQCPDAAHSFKALDNLPPLAVFLLDLKAASNIIFSNGDLDPWA
FT                   GGGIQSNLSTSVIAVTIQGGAHHLDLRASNSEDPPSVVEVRKLESTLIREWVAAARLKQ
FT                   PAMPRWPGPKKQHPSR"
FT   CDS             complement(join(22081026..22081054,22081771..22081831,
FT                   22082006..22082172,22082279..22082360,22082431..22082566,
FT                   22083096..22083259,22083352..22083491,22083567..22083680,
FT                   22083769..22083865))
FT                   /codon_start=1
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, isoform CRA_a"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT173780.0
FT                   protein_id=mCP96699.0 isoform=CRA_a"
FT                   /protein_id="EDL08234.1"
FT                   /translation="MNFHPCYPVDHGVPSWILVLLLSLGLCNLQARADRVLDPDFHENY
FT                   FEQYMDHFNFESFGNKTFGQRFLVSDKFWKMGEGPIFFYTGNEGDIWSFANNSGFMVEL
FT                   AAQQEALLVFAEHRYYGKSLPFGVQSTQRGYTQLLTVEQALADFAVLLQALRQDLGVHD
FT                   APTIAFGGSYGGMLSAYMRMKYPHLVAGALAASAPVVAVAGLGDSYQFFRDVTADFYGQ
FT                   SPKCAQAVRDAFQQIKDLFLQGAYDTISQNFGTCQSLSSPKDLTQLFGFARNAFTVLAM
FT                   MDYPYPTDFLGPLPANPVKVGCQRLLNEGQRIMGLRALAGLYGDQSDL"
FT   CDS             complement(join(22083071..22083259,22083352..22083680,
FT                   22083769..>22083889))
FT                   /codon_start=1
FT                   /gene="Dpp7"
FT                   /locus_tag="mCG_20304"
FT                   /product="dipeptidylpeptidase 7, isoform CRA_b"
FT                   /note="gene_id=mCG20304.3 transcript_id=mCT190177.0
FT                   protein_id=mCP111166.0 isoform=CRA_b"
FT                   /protein_id="EDL08235.1"
FT                   /translation="SAPGSESSMNFHPCYPVDHGVPSWILVLLLSLGLCNLQARADRVL
FT                   DPDFHENYFEQYMDHFNFESFGNKTFGQRFLVSGECWLDRMGSYLRFPGLMETHLLPTD
FT                   KFWKMGEGPIFFYTGNEGDIWSFANNSGFMVELAAQQEALLVFAEHRYYGKSLPFGVQS
FT                   TQRGYTQLLTVEQALADFAVLLQALRQDLGVHDAPTIAFGGRWVLDLPS"
FT   gene            22099313..22104472
FT                   /locus_tag="mCG_20308"
FT                   /note="gene_id=mCG20308.2"
FT   mRNA            join(22099313..22099993,22100411..22100512,
FT                   22101943..22102055,22102676..22102822,22102959..22103066,
FT                   22103155..22103265,22103343..22103954)
FT                   /locus_tag="mCG_20308"
FT                   /product="mCG20308, transcript variant mCT173781"
FT                   /note="gene_id=mCG20308.2 transcript_id=mCT173781.0 created
FT                   on 27-SEP-2002"
FT   mRNA            join(22099332..22099993,22101943..22102055,
FT                   22102676..22102822,22102959..22103066,22103155..22103265,
FT                   22103343..22104472)
FT                   /locus_tag="mCG_20308"
FT                   /product="mCG20308, transcript variant mCT20409"
FT                   /note="gene_id=mCG20308.2 transcript_id=mCT20409.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22099426..22099993,22100411..22100512,
FT                   22101943..22102055,22102676..22102822,22102959..22103066,
FT                   22103155..22103265,22103343..22103471)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20308"
FT                   /product="mCG20308, isoform CRA_a"
FT                   /note="gene_id=mCG20308.2 transcript_id=mCT173781.0
FT                   protein_id=mCP96700.0 isoform=CRA_a"
FT                   /protein_id="EDL08238.1"
FT                   /translation="MAVAAMAERGRLSHAAPAPSTEGLPRAFLQSLRTLFDILDDRQRG
FT                   YVHLREIESRWQGADARELPCGVLEGLRQVAPANGYLTFERFVAGLRTSLLKADGGQRD
FT                   QARVAARPGDQSSLQQRLMFAPADEPRTVLERKPLPLSACPASGGPSGTSRNPELLCVP
FT                   VEAASCPTETERPLSKALEQIPSADLGSSQCDTLQRQPGLLLHPGGRGGSTGAPSTSAE
FT                   EGAAACKTLGKGTGEARQAPRARGERRRHTITNGVDCSLLKQMKELDQEQEVLLQGLEM
FT                   MARGRDWYQQQLQRVQERQRRLSQSRAAADFGAEGSPRPLGRLLPKVQEVARCLGELLT
FT                   AACSGRALPSSSLGPLGPPSPSTPVWQQQTILMLKEQNRLLTQEVTDKSERITQLEQEK
FT                   SALIKQLFEARALSQQDSGPLDSTFI"
FT   CDS             join(22099426..22099993,22101943..22102055,
FT                   22102676..22102822,22102959..22103066,22103155..22103265,
FT                   22103343..22103471)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20308"
FT                   /product="mCG20308, isoform CRA_b"
FT                   /note="gene_id=mCG20308.2 transcript_id=mCT20409.1
FT                   protein_id=mCP19532.2 isoform=CRA_b"
FT                   /protein_id="EDL08239.1"
FT                   /translation="MAVAAMAERGRLSHAAPAPSTEGLPRAFLQSLRTLFDILDDRQRG
FT                   YVHLREIESRWQGADARELPCGVLEGLRQVAPANGYLTFERFVAGLRTSLLKADGGQRD
FT                   QARVAARPGDQSSLQQRLMFAPADEPRTVLERKPLPLSACPASGGPSGTSRNPELLCVP
FT                   VEAASCPTETERPLSKALEQIPSADLGAAACKTLGKGTGEARQAPRARGERRRHTITNG
FT                   VDCSLLKQMKELDQEQEVLLQGLEMMARGRDWYQQQLQRVQERQRRLSQSRAAADFGAE
FT                   GSPRPLGRLLPKVQEVARCLGELLTAACSGRALPSSSLGPLGPPSPSTPVWQQQTILML
FT                   KEQNRLLTQEVTDKSERITQLEQEKSALIKQLFEARALSQQDSGPLDSTFI"
FT   gene            22123356..22128781
FT                   /gene="Entpd2"
FT                   /locus_tag="mCG_20290"
FT                   /note="gene_id=mCG20290.2"
FT   mRNA            join(22123356..22123545,22124852..22124969,
FT                   22125457..22125607,22125747..22125906,22125988..22126215,
FT                   22126738..22126992,22127075..22127194,22128028..22128162,
FT                   22128234..22128781)
FT                   /gene="Entpd2"
FT                   /locus_tag="mCG_20290"
FT                   /product="ectonucleoside triphosphate diphosphohydrolase 2,
FT                   transcript variant mCT20174"
FT                   /note="gene_id=mCG20290.2 transcript_id=mCT20174.2 created
FT                   on 27-SEP-2002"
FT   mRNA            join(<22123366..22123545,22124852..22124969,
FT                   22125457..22125607,22125988..22126215,22126738..22127194,
FT                   22128028..22128162,22128234..22128756)
FT                   /gene="Entpd2"
FT                   /locus_tag="mCG_20290"
FT                   /product="ectonucleoside triphosphate diphosphohydrolase 2,
FT                   transcript variant mCT190114"
FT                   /note="gene_id=mCG20290.2 transcript_id=mCT190114.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(22123429..22123545,22124852..22124969,
FT                   22125457..22125607,22125747..22125906,22125988..22126215,
FT                   22126738..22126992,22127075..22127194,22128028..22128162,
FT                   22128234..22128437)
FT                   /codon_start=1
FT                   /gene="Entpd2"
FT                   /locus_tag="mCG_20290"
FT                   /product="ectonucleoside triphosphate diphosphohydrolase 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20290.2 transcript_id=mCT20174.2
FT                   protein_id=mCP19428.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q921R1"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="MGI:MGI:1096863"
FT                   /db_xref="UniProtKB/TrEMBL:Q921R1"
FT                   /protein_id="EDL08241.1"
FT                   /translation="MAGKLVSLVPPLLLAAVGLAGLLLLCVPTQDVREPPALKYGIVLD
FT                   AGSSHTSMFVYKWPADKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECLEQAL
FT                   RDVPKDRYASTPLYLGATAGMRLLNLTSPEATAKVLEAVTQTLTRYPFDFRGARILSGQ
FT                   DEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDN
FT                   EVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQIHRFHPCWPKGYSTQVLLREVYQ
FT                   SPCTMGQRPQTFNSSATVSLSGTSNAALCRDLVSGLFNISSCPFSQCSFNGVFQPPVAG
FT                   NFIAFSAFYYTVDFLKTVMGLPVGTLKQLEDATETTCNQTWAELQARVPGQQTRLPDYC
FT                   AVAMFIHQLLSRGYRFDERSFRGVVFEKKAADTAVGWALGYMLNLTNLIPADLPGLRKG
FT                   THFSSWVALLLLFTVLILAALVLLLRQVRSAKSPGAL"
FT   CDS             join(<22125524..22125607,22125988..22126215,
FT                   22126738..22127043)
FT                   /codon_start=1
FT                   /gene="Entpd2"
FT                   /locus_tag="mCG_20290"
FT                   /product="ectonucleoside triphosphate diphosphohydrolase 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20290.2 transcript_id=mCT190114.0
FT                   protein_id=mCP111117.0 isoform=CRA_a"
FT                   /protein_id="EDL08240.1"
FT                   /translation="TGTSGCAQRQICQHSTLPGSYSRHAPTQYGWVGRWIRPRKGTLGA
FT                   MDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQ
FT                   IHRFHPCWPKGYSTQVLLREVYQSPCTMGQRPQTFNSSATVSLSGTSNAALCRDLVSGL
FT                   FNISSCPFSQCSFNGVFQPPVAGNFIVSPGGWMWGRETLSMW"
FT   gene            22130624..22136991
FT                   /gene="Npdc1"
FT                   /locus_tag="mCG_20288"
FT                   /note="gene_id=mCG20288.2"
FT   mRNA            join(22130624..22130828,22133720..22133866,
FT                   22134968..22135047,22135154..22135241,22135346..22135519,
FT                   22135619..22135685,22135765..22135852,22136105..22136184,
FT                   22136403..22136499,22136597..22136989)
FT                   /gene="Npdc1"
FT                   /locus_tag="mCG_20288"
FT                   /product="neural proliferation, differentiation and control
FT                   gene 1, transcript variant mCT173779"
FT                   /note="gene_id=mCG20288.2 transcript_id=mCT173779.0 created
FT                   on 27-SEP-2002"
FT   mRNA            join(22130642..22130828,22133720..22133866,
FT                   22135101..22135241,22135346..22135519,22135619..22135685,
FT                   22135765..22135852,22136105..22136184,22136403..22136499,
FT                   22136597..22136991)
FT                   /gene="Npdc1"
FT                   /locus_tag="mCG_20288"
FT                   /product="neural proliferation, differentiation and control
FT                   gene 1, transcript variant mCT20172"
FT                   /note="gene_id=mCG20288.2 transcript_id=mCT20172.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(22130717..22130828,22133720..22133866,
FT                   22134968..22135047,22135154..22135241,22135346..22135519,
FT                   22135619..22135685,22135765..22135852,22136105..22136184,
FT                   22136403..22136499,22136597..22136689)
FT                   /codon_start=1
FT                   /gene="Npdc1"
FT                   /locus_tag="mCG_20288"
FT                   /product="neural proliferation, differentiation and control
FT                   gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG20288.2 transcript_id=mCT173779.0
FT                   protein_id=mCP96698.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AJ21"
FT                   /db_xref="InterPro:IPR009635"
FT                   /db_xref="MGI:MGI:1099802"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJ21"
FT                   /protein_id="EDL08242.1"
FT                   /translation="MATPVPPPSPRHLRLLRLLLSGLILGAALNGATARRPDATTCPGS
FT                   LDCALKRRAKCPPGAHACGPCLQSFQEDQRGFCVPRKHLSSDPSVVTMETKIVKLWMGP
FT                   SISGGCLLQELALKEKEAGHSRLTAQPLLEAAQKLLEPAATLGFSQWGQRLEPGLPSTH
FT                   GTSSPIPHTSLSSRASSGPVQMSPLEPQGRHGNGLTLVLILAFCLASSAALAVAALCWC
FT                   RLQREIRLTQKADYAATAKGPTSPSTPRISPGDQRLAHSAEMYHYQHQRQQMLCLERHK
FT                   EPPKELESASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHSTLSAPVPGPHSLPPL
FT                   Q"
FT   CDS             join(22130717..22130828,22133720..22133866,
FT                   22135101..22135241,22135346..22135519,22135619..22135685,
FT                   22135765..22135852,22136105..22136184,22136403..22136499,
FT                   22136597..22136689)
FT                   /codon_start=1
FT                   /gene="Npdc1"
FT                   /locus_tag="mCG_20288"
FT                   /product="neural proliferation, differentiation and control
FT                   gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG20288.2 transcript_id=mCT20172.2
FT                   protein_id=mCP19409.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q64322"
FT                   /db_xref="InterPro:IPR009635"
FT                   /db_xref="MGI:MGI:1099802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64322"
FT                   /protein_id="EDL08243.1"
FT                   /translation="MATPVPPPSPRHLRLLRLLLSGLILGAALNGATARRPDATTCPGS
FT                   LDCALKRRAKCPPGAHACGPCLQSFQEDQRGFCVPRKHLSSGEGLPQPRLEEEIDSLAQ
FT                   ELALKEKEAGHSRLTAQPLLEAAQKLLEPAATLGFSQWGQRLEPGLPSTHGTSSPIPHT
FT                   SLSSRASSGPVQMSPLEPQGRHGNGLTLVLILAFCLASSAALAVAALCWCRLQREIRLT
FT                   QKADYAATAKGPTSPSTPRISPGDQRLAHSAEMYHYQHQRQQMLCLERHKEPPKELESA
FT                   SSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHSTLSAPVPGPHSLPPLQ"
FT   gene            22150996..22153882
FT                   /gene="Fut7"
FT                   /locus_tag="mCG_18755"
FT                   /note="gene_id=mCG18755.0"
FT   mRNA            join(22150996..22151479,22152084..22152289,
FT                   22152397..22153882)
FT                   /gene="Fut7"
FT                   /locus_tag="mCG_18755"
FT                   /product="fucosyltransferase 7"
FT                   /note="gene_id=mCG18755.0 transcript_id=mCT15155.0 created
FT                   on 27-SEP-2002"
FT   CDS             join(22152277..22152289,22152397..22153412)
FT                   /codon_start=1
FT                   /gene="Fut7"
FT                   /locus_tag="mCG_18755"
FT                   /product="fucosyltransferase 7"
FT                   /note="gene_id=mCG18755.0 transcript_id=mCT15155.0
FT                   protein_id=mCP19639.1"
FT                   /db_xref="GOA:Q3SWS0"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="MGI:MGI:107692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3SWS0"
FT                   /protein_id="EDL08244.1"
FT                   /translation="MNCIGYHPTRRLRAWGGLAGGATFMVIWFFWLWGSAPGSAPVPQS
FT                   TLTILIWHWPFTNRPPELPGDTCTRYGMASCRLSANRSLLASADAVVFHHRELQTRQSL
FT                   LPLDQRPHGQPWVWASMESPSNTHGLHRFRGIFNWVLSYRRDSDIFVPYGRLEPLSGPT
FT                   SPLPAKSRMAAWVISNFQERQQRAKLYRQLAPHLQVDVFGRASGRPLCANCLLPTLARY
FT                   RFYLAFENSQHRDYITEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSAR
FT                   ELAVFLVSMNESRYRGFFAWRDRLRVRLLGDWRERFCTICARYPYLPRSQVYEDLESWF
FT                   QA"
FT   gene            <22156281..22175762
FT                   /gene="Abca2"
FT                   /locus_tag="mCG_18727"
FT                   /note="gene_id=mCG18727.1"
FT   mRNA            join(<22156281..22156346,22159515..22159608,
FT                   22160617..22160728,22160813..22160976,22161201..22161328,
FT                   22161503..22161613,22161848..22162066,22162429..22162796,
FT                   22163038..22163197,22163908..22164036,22164129..22164293,
FT                   22164370..22164466,22164785..22164958,22165028..22165130,
FT                   22165205..22165319,22165433..22165623,22165771..22165921,
FT                   22165998..22166202,22166341..22166505,22166607..22166787,
FT                   22166867..22167079,22168065..22168261,22168350..22168532,
FT                   22168728..22168912,22169019..22169139,22169415..22169651,
FT                   22169731..22169937,22170190..22170292,22170375..22170694,
FT                   22170769..22170982,22171069..22171174,22171266..22171377,
FT                   22171467..22171527,22171610..22171784,22171865..22171980,
FT                   22172062..22172209,22172354..22172477,22172612..22172744,
FT                   22172866..22172983,22173111..22173289,22173533..22173674,
FT                   22173774..22173908,22174001..22174104,22174178..22174270,
FT                   22174354..22174456,22174541..22174678,22174763..22174963,
FT                   22175404..22175762)
FT                   /gene="Abca2"
FT                   /locus_tag="mCG_18727"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   2"
FT                   /note="gene_id=mCG18727.1 transcript_id=mCT15023.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22156281..22156346,22159515..22159608,
FT                   22160617..22160728,22160813..22160976,22161201..22161328,
FT                   22161503..22161613,22161848..22162066,22162429..22162796,
FT                   22163038..22163197,22163908..22164036,22164129..22164293,
FT                   22164370..22164466,22164785..22164958,22165028..22165130,
FT                   22165205..22165319,22165433..22165623,22165771..22165921,
FT                   22165998..22166202,22166341..22166505,22166607..22166787,
FT                   22166867..22167079,22168065..22168261,22168350..22168532,
FT                   22168728..22168912,22169019..22169139,22169415..22169651,
FT                   22169731..22169937,22170190..22170292,22170375..22170694,
FT                   22170769..22170982,22171069..22171174,22171266..22171377,
FT                   22171467..22171527,22171610..22171784,22171865..22171980,
FT                   22172062..22172209,22172354..22172477,22172612..22172744,
FT                   22172866..22172983,22173111..22173289,22173533..22173674,
FT                   22173774..22173908,22174001..22174104,22174178..22174270,
FT                   22174354..22174456,22174541..22174678,22174763..22174963,
FT                   22175404..22175439)
FT                   /codon_start=1
FT                   /gene="Abca2"
FT                   /locus_tag="mCG_18727"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   2"
FT                   /note="gene_id=mCG18727.1 transcript_id=mCT15023.1
FT                   protein_id=mCP19717.1"
FT                   /db_xref="GOA:A2AJ26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99606"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJ26"
FT                   /protein_id="EDL08245.1"
FT                   /translation="MGFLHQLQLLLWKNVTLKRRSPWVLAFEIFIPLVLFFILLGLRQK
FT                   KPTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLHRVVE
FT                   EGNLFDPVRPSLGSELEALRQRLEALSSGPGTWESHSARPAVSSFSLDSVARDQRELWR
FT                   FLMQNLSLPNSTAQALLAARVDPSEVYRLLFGPLPDLDGKLGFLRKQEPWSRLGSNPLL
FT                   QMEELLLAPALLEQLTCAPGSGELGRILTMPEGHQVDLQGYRDAVCSGQATARAQRFSD
FT                   LAAELRNQLDTAKIAQQLGFDVPNGSDPQPQAPSPQSLPALLGDLLDAQKLLQDVDVLS
FT                   ALALLLPQGACAGQASAPQASSLNGLANSTGIGANSGSNTTVEEGTQSPVSPASPDTLQ
FT                   GQCSAFVQLWAGLQPILCGNNRTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPK
FT                   ILYAPVGSEADRVILKANETFAFVGNVTHYAQVWLNISTEIRSFLEQGRLQQHLQWLQQ
FT                   YVADLQLHPEAMNLSLEELPPALRQDFSLPNGTALLQQLDTIDNAACGWIQFMSKVSVD
FT                   IFKGFPDEESIVNYTLNQAYQDNVTVFASVIFQTRKDGSLPPHVHYKIRQNSSFTEKTN
FT                   EIRRAYWRPGPNTGGRFYFLYGFVWIQDMMERAIINTFVGHDVVEPGNYVQMFPYPCYT
FT                   RDDFLFVIEHMMPLCMVISWVYSVAMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFI
FT                   TGFVQLSISVTALTAILKYGQVLMHSHVLIIWLFLAVYAVATIMFCFLVSVLYSKAKLA
FT                   SACGGIIYFLSYVPYMYVAIREEVAHDKITAFEKCIASLMSTTAFGLGSKYFALYEVAG
FT                   VGIQWHTFSQSPVEGDDFNLLLAVTMLMVDTVVYGVLTWYIEAVHPGMYGLPRPWYFPL
FT                   QKSYWLGSGRTEAWEWSWPWAHTPRLSVMEEDQACAMESRHFEETRGMEEEPTHLPLVV
FT                   CVDKLTKVYKNDKKMALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSAT
FT                   IYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRKETDKMIE
FT                   DLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILK
FT                   YKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGYRLTLVKQPAE
FT                   PGTSQEPGLASSPSGCPRLSSCSEPQVSQFIRKHVASSLLVSDTSTELSYILPSEAVKK
FT                   GAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLKVSEEDQSLENSEADVKESRKDVLP
FT                   GAEGLTAVGGQAGNLARCSELAQSQASLQSASSVGSARGEEGTGYSDGYGDYRPLFDNL
FT                   QDPDNVSLQEAEMEALAQVGQGSRKLEGWWLKMRQFHGLLVKRFHCARRNSKALCSQIL
FT                   LPAFFVCVAMTVALSVPEIGDLPPLVLSPSQYHNYTQPRGNFIPYANEERQEYRLRLSP
FT                   DASPQQLVSTFRLPSGVGATCVLKSPANGSLGPMLNLSSGESRLLAARFFDSMCLESFT
FT                   QGLPLSNFVPPPPSPAPSDSPVSPDEDSLQAWNMSLPPTAGPETWTSAPSLPRLVHEPV
FT                   RCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVSEYLLFTSDRFRLHRYGAI
FT                   TFGNVQKSIPASFGARVPPMVRKIAVRRVAQVLYNNKGYHSMPTYLNSLNNAILRANLP
FT                   KSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFIIVAMSFVPASFVVFLVA
FT                   EKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPA
FT                   VLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFEHDKD
FT                   LKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGL
FT                   VAMTVEGFVGFFLTIMCQYNFLRQPQRLPVSTKPVEDDVDVASERQRVLRGDADNDMVK
FT                   IENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGE
FT                   AFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVKWA
FT                   LEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLI
FT                   LDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTK
FT                   SSQNVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVLGIEDY
FT                   SVSQTTLDNVFVNFAKKQSDNVEQQEAEPSSLPSPLGLLSLLRPRPAPTELRALVADEP
FT                   EDLDTEDEGLISFEEERAQLSFNTDTLC"
FT   gene            22184329..22186268
FT                   /gene="Clic3"
FT                   /locus_tag="mCG_18751"
FT                   /note="gene_id=mCG18751.0"
FT   mRNA            join(22184329..22184403,22185150..22185259,
FT                   22185338..22185463,22185604..22185710,22185793..22185968,
FT                   22186054..22186268)
FT                   /gene="Clic3"
FT                   /locus_tag="mCG_18751"
FT                   /product="chloride intracellular channel 3"
FT                   /note="gene_id=mCG18751.0 transcript_id=mCT15148.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(22184368..22184403,22185150..22185259,
FT                   22185338..22185463,22185604..22185710,22185793..22185968,
FT                   22186054..22186212)
FT                   /codon_start=1
FT                   /gene="Clic3"
FT                   /locus_tag="mCG_18751"
FT                   /product="chloride intracellular channel 3"
FT                   /note="gene_id=mCG18751.0 transcript_id=mCT15148.2
FT                   protein_id=mCP19716.2"
FT                   /protein_id="EDL08246.1"
FT                   /translation="MAETTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTV
FT                   DTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPRYRESNT
FT                   AGNDIFHKFSAFIKNPVPTQDNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRESHRR
FT                   FLDGDQFTLADCSLLPKLHIVDTVCAHFRQLPIPAELSCVRRYLDSALQKKEFKYTCPH
FT                   SAEILAAYQPAVHPR"
FT   gene            complement(22186977..22188582)
FT                   /gene="BC029214"
FT                   /locus_tag="mCG_18737"
FT                   /note="gene_id=mCG18737.2"
FT   mRNA            complement(join(22186977..22187190,22187264..22187348,
FT                   22187498..22187563,22187656..22187846,22187934..22187983,
FT                   22188144..22188204,22188276..22188582))
FT                   /gene="BC029214"
FT                   /locus_tag="mCG_18737"
FT                   /product="cDNA sequence BC029214"
FT                   /note="gene_id=mCG18737.2 transcript_id=mCT15033.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22187151..22187190,22187264..22187348,
FT                   22187498..22187563,22187656..22187846,22187934..22187983,
FT                   22188144..22188204,22188276..22188400))
FT                   /codon_start=1
FT                   /gene="BC029214"
FT                   /locus_tag="mCG_18737"
FT                   /product="cDNA sequence BC029214"
FT                   /note="gene_id=mCG18737.2 transcript_id=mCT15033.2
FT                   protein_id=mCP19657.2"
FT                   /protein_id="EDL08247.1"
FT                   /translation="MAPPLLSLPLCILPPGSGSPRLVCYCERDSGGDGDRDDFNLYVTD
FT                   AAELWSTCFSPDSLARLKARFGLSGAEDIHSRFRAACQQQAVTVSLQEDRALITLSGDT
FT                   PALAFDLSKVPSPEAAPRLQALTLSLAEHVCNLERRLAAAEETITSPKKNTQPAGTQFL
FT                   PELDHQRGSSGPGVRRRCPGESLINPGFKSKKPAAGVDFDET"
FT   gene            complement(22194213..22197535)
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /note="gene_id=mCG18746.1"
FT   mRNA            complement(join(22194213..22194342,22194798..22194856,
FT                   22195329..22195430,22195583..22195699,22196342..22196418,
FT                   22196497..22196636,22197069..22197243,22197519..22197535))
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), transcript
FT                   variant mCT15145"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT15145.2 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(22194223..22194342,22194831..22194856,
FT                   22195329..22195430,22195583..22195699,22196342..22196418,
FT                   22196497..22196636,22197069..22197243,22197519..22197535))
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), transcript
FT                   variant mCT173775"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT173775.0 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(22194223..22194856,22195329..22195430,
FT                   22195583..22195699,22196342..22196418,22196497..>22196894))
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), transcript
FT                   variant mCT190164"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT190164.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(22194227..22194342,22194831..22194856,
FT                   22195329..22195430,22195583..22195699,22196342..22196418,
FT                   22196497..22196636,22197069..>22197259))
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), transcript
FT                   variant mCT190163"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT190163.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22194837..22194856,22195329..22195430,
FT                   22195583..22195699,22196342..22196418,22196497..22196636,
FT                   22197069..>22197257))
FT                   /codon_start=1
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), isoform CRA_a"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT190163.0
FT                   protein_id=mCP111156.0 isoform=CRA_a"
FT                   /protein_id="EDL08248.1"
FT                   /translation="LLLPSFPCFVHIAGIRPRHLLCSEQMAALRMLWMGLVLLGLLGFP
FT                   QTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNL
FT                   TSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKG
FT                   PGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE"
FT   CDS             complement(join(22194837..22194856,22195329..22195430,
FT                   22195583..22195699,22196342..22196418,22196497..22196636,
FT                   22197069..22197182))
FT                   /codon_start=1
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), isoform CRA_c"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT15145.2
FT                   protein_id=mCP19420.2 isoform=CRA_c"
FT                   /db_xref="GOA:O09114"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002972"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:99261"
FT                   /db_xref="PDB:2CZT"
FT                   /db_xref="PDB:2CZU"
FT                   /db_xref="PDB:2E4J"
FT                   /db_xref="PDB:2KTD"
FT                   /db_xref="PDB:2RQ0"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09114"
FT                   /protein_id="EDL08250.1"
FT                   /translation="MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYS
FT                   AGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGH
FT                   YTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKF
FT                   TTFSKAQGLTEEDIVFLPQPDKCIQE"
FT   CDS             complement(join(22194837..22194856,22195329..22195430,
FT                   22195583..22195699,22196342..22196418,22196497..22196636,
FT                   22197069..22197182))
FT                   /codon_start=1
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), isoform CRA_c"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT173775.0
FT                   protein_id=mCP96694.0 isoform=CRA_c"
FT                   /db_xref="GOA:O09114"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002972"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:99261"
FT                   /db_xref="PDB:2CZT"
FT                   /db_xref="PDB:2CZU"
FT                   /db_xref="PDB:2E4J"
FT                   /db_xref="PDB:2KTD"
FT                   /db_xref="PDB:2RQ0"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09114"
FT                   /protein_id="EDL08251.1"
FT                   /translation="MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYS
FT                   AGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGH
FT                   YTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKF
FT                   TTFSKAQGLTEEDIVFLPQPDKCIQE"
FT   CDS             complement(join(22194837..22194856,22195329..22195430,
FT                   22195583..22195699,22196342..22196418,22196497..>22196675))
FT                   /codon_start=1
FT                   /gene="Ptgds"
FT                   /locus_tag="mCG_18746"
FT                   /product="prostaglandin D2 synthase (brain), isoform CRA_b"
FT                   /note="gene_id=mCG18746.1 transcript_id=mCT190164.0
FT                   protein_id=mCP111157.0 isoform=CRA_b"
FT                   /protein_id="EDL08249.1"
FT                   /translation="GAHGADPGIHWSQFLGRWYSAGLASNSSWFREKKAVLYMCKTVVA
FT                   PSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYA
FT                   LLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQ
FT                   E"
FT   gene            complement(22218374..22220959)
FT                   /gene="Lcn12"
FT                   /locus_tag="mCG_18730"
FT                   /note="gene_id=mCG18730.1"
FT   mRNA            complement(join(22218374..22218480,22219519..22219637,
FT                   22219769..22219891,22219959..22220035,22220750..22220959))
FT                   /gene="Lcn12"
FT                   /locus_tag="mCG_18730"
FT                   /product="lipocalin 12"
FT                   /note="gene_id=mCG18730.1 transcript_id=mCT15026.1 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22218427..22218480,22219519..22219637,
FT                   22219769..22219891,22219959..22220035,22220750..22220892))
FT                   /codon_start=1
FT                   /gene="Lcn12"
FT                   /locus_tag="mCG_18730"
FT                   /product="lipocalin 12"
FT                   /note="gene_id=mCG18730.1 transcript_id=mCT15026.1
FT                   protein_id=mCP19640.2"
FT                   /protein_id="EDL08252.1"
FT                   /translation="MQFQGEWFVLGLADNTFRREHRALLNFFTTLFELKEKSQFQVTNS
FT                   MTRGKHCNTWSYTLIPATKPGQFTRDNRGSGPGADRENIQVIETDYITFALVLSLRQTS
FT                   SQNITRVSLLGRNWRLSHKTIDKFICLTRTQNLTKDNFLFPDLSGNGLHATGYRIHKSA
FT                   EEGTGSCQ"
FT   gene            complement(22226169..22229247)
FT                   /gene="C8g"
FT                   /locus_tag="mCG_18738"
FT                   /note="gene_id=mCG18738.2"
FT   mRNA            complement(join(22226169..22226345,22226427..22226465,
FT                   22226536..22226637,22226920..22227027,22227111..22227181,
FT                   22227361..22227497,22227616..22228106))
FT                   /gene="C8g"
FT                   /locus_tag="mCG_18738"
FT                   /product="complement component 8, gamma subunit, transcript
FT                   variant mCT15034"
FT                   /note="gene_id=mCG18738.2 transcript_id=mCT15034.2 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(22226173..22226345,22226427..22226465,
FT                   22226536..22226637,22226920..22227027,22227111..22227181,
FT                   22227361..22227497,22229050..22229247))
FT                   /gene="C8g"
FT                   /locus_tag="mCG_18738"
FT                   /product="complement component 8, gamma subunit, transcript
FT                   variant mCT173772"
FT                   /note="gene_id=mCG18738.2 transcript_id=mCT173772.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22226332..22226345,22226427..22226465,
FT                   22226536..22226637,22226920..22227027,22227111..22227181,
FT                   22227361..22227497,22229050..22229085))
FT                   /codon_start=1
FT                   /gene="C8g"
FT                   /locus_tag="mCG_18738"
FT                   /product="complement component 8, gamma subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18738.2 transcript_id=mCT173772.0
FT                   protein_id=mCP96691.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9DAC2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002968"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:88237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAC2"
FT                   /protein_id="EDL08254.1"
FT                   /translation="MPSPMLQGTGRQFAGTWLLVAVGSSCRFLQEQGHRAEATTLHAAP
FT                   QGAAMAVSTFRKLDGICWQVRQLFENTGVPGRFLFQVSRARGPVHMVVAETDYQSFAIL
FT                   YLEQGRKLSVKLYVRSLPVNDSVLDVFERRVREANLTEDQILFFPKYGFCETADQLHIL
FT                   NEVPR"
FT   CDS             complement(join(22226332..22226345,22226427..22226465,
FT                   22226536..22226637,22226920..22227027,22227111..22227181,
FT                   22227361..22227497,22227616..22227753))
FT                   /codon_start=1
FT                   /gene="C8g"
FT                   /locus_tag="mCG_18738"
FT                   /product="complement component 8, gamma subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18738.2 transcript_id=mCT15034.2
FT                   protein_id=mCP19455.2 isoform=CRA_a"
FT                   /protein_id="EDL08253.1"
FT                   /translation="MLSPGAVLFFTLLLTASSLGQRTRKPIGSTSPISTIQAQVNFSAQ
FT                   KFAGTWLLVAVGSSCRFLQEQGHRAEATTLHAAPQGAAMAVSTFRKLDGICWQVRQLFE
FT                   NTGVPGRFLFQVSRARGPVHMVVAETDYQSFAILYLEQGRKLSVKLYVRSLPVNDSVLD
FT                   VFERRVREANLTEDQILFFPKYGFCETADQLHILNEVPR"
FT   gene            22228337..22232992
FT                   /gene="Fbxw5"
FT                   /locus_tag="mCG_18762"
FT                   /note="gene_id=mCG18762.2"
FT   mRNA            join(22228337..22228408,22229458..22229673,
FT                   22230393..22230567,22230647..22230795,22230959..22231388,
FT                   22231702..22231849,22231939..22232151,22232232..22232992)
FT                   /gene="Fbxw5"
FT                   /locus_tag="mCG_18762"
FT                   /product="F-box and WD-40 domain protein 5, transcript
FT                   variant mCT173777"
FT                   /note="gene_id=mCG18762.2 transcript_id=mCT173777.0 created
FT                   on 27-SEP-2002"
FT   mRNA            join(22228338..22228408,22229458..22229673,
FT                   22229923..22230080,22230393..22230567,22230647..22230795,
FT                   22230959..22231388,22231702..22231849,22231939..22232151,
FT                   22232232..22232989)
FT                   /gene="Fbxw5"
FT                   /locus_tag="mCG_18762"
FT                   /product="F-box and WD-40 domain protein 5, transcript
FT                   variant mCT15159"
FT                   /note="gene_id=mCG18762.2 transcript_id=mCT15159.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22229481..22229673,22229923..22230080,
FT                   22230393..22230567,22230647..22230795,22230959..22231388,
FT                   22231702..22231849,22231939..22232151,22232232..22232487)
FT                   /codon_start=1
FT                   /gene="Fbxw5"
FT                   /locus_tag="mCG_18762"
FT                   /product="F-box and WD-40 domain protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG18762.2 transcript_id=mCT15159.1
FT                   protein_id=mCP19691.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QXW2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1354731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QXW2"
FT                   /protein_id="EDL08255.1"
FT                   /translation="MDEGGLPLLPDSLVYQIFLSLGPADVLAAGLVCRQWQAVSRDEFL
FT                   WKEQFYRYYQVARDVPRHPAATSWYEEFRRLYDMVPCVEVQTLKEHTDQVLHLSFSHSG
FT                   YQFASCSKDCTVKIWNNDLTISLLHSADMRPYNWSYTQFSQFNQDDSLLLASGVFLGPH
FT                   NSSSGEIAVISLDSFALLSRVRNKPYDVFGCWLTETSLISGNLHRIGDITSCSVLWLNN
FT                   AFQDVESENVNVVKRLFKIQNLNASTIRTVMVADCSRFDSPDLLLDASDQAGLPCRVFD
FT                   LGGDTEEEATDPGLHTSGSDHVKKGLRRVFDSVLDGHGQLSDCALETKVAELLAQGHTK
FT                   PPECNDADTRNKYLIFTTGCLTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALD
FT                   HVIDVHGHIIGMGLSPDNRYLYVNSRAWPPGSVVADPMQPPPIAEEIDLLVFDLKTMRE
FT                   VKRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLAKLRHEDVVN
FT                   SVAFSPQEQELLLTASDDATIKAWRSPRIVRVLQAPRPRPRPRPRPFFSWFASHRR"
FT   CDS             join(22229554..22229673,22230393..22230567,
FT                   22230647..22230795,22230959..22231388,22231702..22231849,
FT                   22231939..22232151,22232232..22232487)
FT                   /codon_start=1
FT                   /gene="Fbxw5"
FT                   /locus_tag="mCG_18762"
FT                   /product="F-box and WD-40 domain protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG18762.2 transcript_id=mCT173777.0
FT                   protein_id=mCP96696.0 isoform=CRA_b"
FT                   /protein_id="EDL08256.1"
FT                   /translation="MCWLLGWYAANGRLCPGMSSYGRSNSTATTRWLEMCPATQIWNND
FT                   LTISLLHSADMRPYNWSYTQFSQFNQDDSLLLASGVFLGPHNSSSGEIAVISLDSFALL
FT                   SRVRNKPYDVFGCWLTETSLISGNLHRIGDITSCSVLWLNNAFQDVESENVNVVKRLFK
FT                   IQNLNASTIRTVMVADCSRFDSPDLLLDASDQAGLPCRVFDLGGDTEEEATDPGLHTSG
FT                   SDHVKKGLRRVFDSVLDGHGQLSDCALETKVAELLAQGHTKPPECNDADTRNKYLIFTT
FT                   GCLTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDVHGHIIGMGLSPDN
FT                   RYLYVNSRAWPPGSVVADPMQPPPIAEEIDLLVFDLKTMREVKRALRAHRAYTPNDECF
FT                   FIFLDVSRDFVASGAEDRHGYIWDRHYNICLAKLRHEDVVNSVAFSPQEQELLLTASDD
FT                   ATIKAWRSPRIVRVLQAPRPRPRPRPRPFFSWFASHRR"
FT   gene            complement(22246362..22274434)
FT                   /gene="Traf2"
FT                   /locus_tag="mCG_18745"
FT                   /note="gene_id=mCG18745.1"
FT   mRNA            complement(join(22246362..22247125,22247825..22247973,
FT                   22251838..22252015,22252365..22252646,22254981..22255055,
FT                   22255739..22255813,22257794..22257955,22264175..22264273,
FT                   22264570..22264648,22266363..22266581,22274366..22274434))
FT                   /gene="Traf2"
FT                   /locus_tag="mCG_18745"
FT                   /product="Tnf receptor-associated factor 2"
FT                   /note="gene_id=mCG18745.1 transcript_id=mCT15144.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22246907..22247125,22247825..22247973,
FT                   22251838..22252015,22252365..22252646,22254981..22255055,
FT                   22255739..22255813,22257794..22257955,22264175..22264273,
FT                   22264570..22264648,22266363..22266550))
FT                   /codon_start=1
FT                   /gene="Traf2"
FT                   /locus_tag="mCG_18745"
FT                   /product="Tnf receptor-associated factor 2"
FT                   /note="gene_id=mCG18745.1 transcript_id=mCT15144.2
FT                   protein_id=mCP19718.2"
FT                   /db_xref="GOA:Q3U8L1"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR012227"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR027133"
FT                   /db_xref="MGI:MGI:101835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8L1"
FT                   /protein_id="EDL08257.1"
FT                   /translation="MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPF
FT                   QAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLP
FT                   AVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSC
FT                   QHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVG
FT                   CSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIAT
FT                   FENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQ
FT                   KVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGD
FT                   GTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQR
FT                   PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL"
FT   gene            complement(22282099..22282302)
FT                   /pseudo
FT                   /locus_tag="mCG_52131"
FT                   /note="gene_id=mCG52131.1"
FT   mRNA            complement(22282099..22282302)
FT                   /pseudo
FT                   /locus_tag="mCG_52131"
FT                   /note="gene_id=mCG52131.1 transcript_id=mCT52314.1 created
FT                   on 25-NOV-2002"
FT   gene            22285667..22289849
FT                   /locus_tag="mCG_18760"
FT                   /note="gene_id=mCG18760.0"
FT   mRNA            join(22285667..22285796,22287918..22287969,
FT                   22288307..22288467,22288736..22288829,22289618..22289849)
FT                   /locus_tag="mCG_18760"
FT                   /product="mCG18760"
FT                   /note="gene_id=mCG18760.0 transcript_id=mCT15154.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22285719..22285796,22287918..22287969,
FT                   22288307..22288467,22288736..22288829,22289618..22289679)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18760"
FT                   /product="mCG18760"
FT                   /note="gene_id=mCG18760.0 transcript_id=mCT15154.1
FT                   protein_id=mCP19669.1"
FT                   /protein_id="EDL08258.1"
FT                   /translation="MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWA
FT                   AGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQ
FT                   VIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK"
FT   gene            complement(22290923..>22298984)
FT                   /locus_tag="mCG_18765"
FT                   /note="gene_id=mCG18765.2"
FT   mRNA            complement(join(22290923..22291136,22291299..22291474,
FT                   22291933..22292041,22292119..22292246,22292343..22292477,
FT                   22292592..22292738,22292863..22292953,22293047..22293165,
FT                   22293251..22293388,22293478..22293697,22293787..22293923,
FT                   22294013..22294147,22294219..22294335,22294479..22294590,
FT                   22294671..22294795,22294894..22295025,22295120..22295248,
FT                   22295353..22295541,22295626..22295710,22295952..22296125,
FT                   22296225..22296313,22296397..22296534,22296726..22296851,
FT                   22296996..22297080,22297153..22297283,22297461..22297586,
FT                   22297674..22297847,22297924..22298034,22298939..>22298984))
FT                   /locus_tag="mCG_18765"
FT                   /product="mCG18765"
FT                   /note="gene_id=mCG18765.2 transcript_id=mCT15164.2 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(22291074..22291136,22291299..22291474,
FT                   22291933..22292041,22292119..22292246,22292343..22292477,
FT                   22292592..22292738,22292863..22292953,22293047..22293165,
FT                   22293251..22293388,22293478..22293697,22293787..22293923,
FT                   22294013..22294147,22294219..22294335,22294479..22294590,
FT                   22294671..22294795,22294894..22295025,22295120..22295248,
FT                   22295353..22295541,22295626..22295710,22295952..22296125,
FT                   22296225..22296313,22296397..22296534,22296726..22296851,
FT                   22296996..22297080,22297153..22297283,22297461..22297586,
FT                   22297674..22297847,22297924..22298034,22298939..22298984))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18765"
FT                   /product="mCG18765"
FT                   /note="gene_id=mCG18765.2 transcript_id=mCT15164.2
FT                   protein_id=mCP19537.2"
FT                   /protein_id="EDL08259.1"
FT                   /translation="MCLPSHLLSTWVLFMAAQSLGKTWLPNHCRSPIKAVCNFVCDCGD
FT                   CSDETQCGFHGASTIPSTSFTCNFEQDSCGWQDISTSGYRWLRDRAGAVLHGPGPHSDH
FT                   THGTDLGWYMAVGTHSGKEPSTATLRSPVMREAAPTCELRLWYHIASRDVAELRLDLTH
FT                   GVETLTLWQTSGPWGPGWQELAVNTGRIQGDFKVTFSATRNATHRGAVALDDVEFRDCG
FT                   LPIPQARCPLGHHHCQNKACVEPHQLCDGEDNCGDRSDEDPLICSHHMATDFETGLGPW
FT                   NQLEGWTRNHSAGSMVSPAWPHRDHSRNSAYGFFLISVAKPGTTAVLYSPEFQGSVSNN
FT                   CSFTFYYYLHGSEASHFQLFLQAQGLNTPQVPVLLRSRHGELGTAWVRDRVDIQSAHPF
FT                   RILLAGETGPGGVVGLDDLIMSSHCMLVPAMSTLQSSLSGPVPLALYPQTSIKLPQQTC
FT                   EPGHLSCGDLCVPPEQLCDFQKHCAEGEDEHKCGTTDFESASAGGWEDISVGKLQWQWV
FT                   EAQEKSKPAGDANRDAPGHFLSLQKAWGQLRSEARALTPALGPSGPHCELHMAYYFQSH
FT                   PQGFLALVVVENGFRELLWQAPGGGSGSWTEEKIILGARRRPFQLEFVSLVDLDGPGQQ
FT                   GAGVDNVTLRDCNPMVTTESDQELSCNFERDSCSWHTGHLTDAHWHRIKSHGSQLDHTT
FT                   GQGFFMFLDPTDPPARGQGALLLTRPQVPVVPKECLSFWYRLYGPQIGTLCLAMRRERE
FT                   EDILLWSRSGTHGNRWHQAWVTLHHQPEASTKYQLLFEGLRNGYHGTMALDDIAVRPGP
FT                   CWAPKSCSFEDSDCGFSPGGWGLWTHQSNASGLASWGPWIDHTTGTAQGHYMVVDTSPN
FT                   VLPKGHVAALTSEEHQPLSQPACLTFWYHMSVPNPGTLRVHVEESTRRQELSISAHGRS
FT                   AWRLGSVNVQAEQAWKVVFEAVAAGVEYSYMALDDISLQDGPCPQPGSCDFETGLCGWS
FT                   HLPWPSLGGYSWDWSSGATPSRYPQPSVDHTLGTEAGHFAFFETSVLGPGGQAAWLRSE
FT                   PLPATTVSCLRFWYYMGFPEHFYKGELRVLLSSARGQLAVWYQGGHLRDQWLQVQIELS
FT                   NSEEFQIVFEATLGGQPALGPIAIDDVQYLAGQQCKQPSPSQGEVAAPVSVPVAVGGAL
FT                   LFFMFLVLMGLGGWHWLQKQHCPGQRSTDAAASGFANILFNADHVTLPESITSNPQSPP
FT                   DLA"
FT   gene            complement(22301190..22302641)
FT                   /gene="Phpt1"
FT                   /locus_tag="mCG_18741"
FT                   /note="gene_id=mCG18741.1"
FT   mRNA            complement(join(22301190..22301460,22301949..22302073,
FT                   22302444..22302641))
FT                   /gene="Phpt1"
FT                   /locus_tag="mCG_18741"
FT                   /product="phosphohistidine phosphatase 1"
FT                   /note="gene_id=mCG18741.1 transcript_id=mCT15037.1 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22301368..22301460,22301949..22302073,
FT                   22302444..22302600))
FT                   /codon_start=1
FT                   /gene="Phpt1"
FT                   /locus_tag="mCG_18741"
FT                   /product="phosphohistidine phosphatase 1"
FT                   /note="gene_id=mCG18741.1 transcript_id=mCT15037.1
FT                   protein_id=mCP19684.1"
FT                   /protein_id="EDL08260.1"
FT                   /translation="MAADLGQIPDVDIDSDGVFKYVLIRVHLAEPSGDPAKECKEIVRG
FT                   YKWAEYHADIYDKVSGELQRNGYDCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVS
FT                   TEKIKAKYPDYEVTWADDGY"
FT   gene            complement(<22306253..22309960)
FT                   /locus_tag="mCG_18757"
FT                   /note="gene_id=mCG18757.2"
FT   mRNA            complement(join(<22306253..22308304,22309775..22309960))
FT                   /locus_tag="mCG_18757"
FT                   /product="mCG18757"
FT                   /note="gene_id=mCG18757.2 transcript_id=mCT15153.2 created
FT                   on 07-OCT-2002"
FT   CDS             complement(<22306253..22308078)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18757"
FT                   /product="mCG18757"
FT                   /note="gene_id=mCG18757.2 transcript_id=mCT15153.2
FT                   protein_id=mCP19426.2"
FT                   /protein_id="EDL08261.1"
FT                   /translation="MTRTDPPDLLVSTVYQDIKVVDPGLTSKRQPCERSVARPAAPTPF
FT                   NKRHCRSFDFLEALDEPTMETHPEPPPPEPAPPRARPRDSEPRRRTRSKSAPRASQGLA
FT                   TAPASPPVLQRRGREAQRAVRVEGSPRREPSYPALRALANELHPIKLQPQRGGPGRIAP
FT                   LCATPGRCAPPEPPSGPVPHVRCRLDIKPDEAVLQHAARSSRSCAPRETTSWARTAPQF
FT                   HGLTVPGPRHVALSRTPTPSDLYCTDPRTLYCDGPLPGPRDYLEHRSQPFTTPPGPTQF
FT                   FYTEEPEGYAGSFTTSPGLPFDGYCSRPYLSEEPPRPSPRRGGSYYAGEVRTFPIQEPP
FT                   SRSYYGETTRAYGMPFVPRYVPEEPRAHPGARTFYTEDFGRYRERDVLARTYPHPRSSP
FT                   PWADWGPRPYRTLQVMPPPAPGPLLASWHGGTGTSPPRLATDSRHYSRSWDNILAPGPR
FT                   REDPLGRGRSYENLLGREVRDTRGSSPEGRRPPVVVNLSTSPRRYAALSLSETSLTEKG
FT                   RAGESLGRNWYVTPEITITDNDLRSVDRPTAKGWELPGGRPRQPVSTVPEGPASSRQRS
FT                   LEQLDELITDLVIDSRSPAQAPEPAAEGLGRQL"
FT   gene            complement(22311202..>22336664)
FT                   /locus_tag="mCG_131080"
FT                   /note="gene_id=mCG131080.2"
FT   mRNA            complement(join(22311202..22312177,22312292..22312350,
FT                   22312965..22313133,22313497..22313725,22313813..22314022,
FT                   22315058..22315208,22315465..22315817,22316799..22316902,
FT                   22320488..22320593,22320957..22321097,22324623..22324714,
FT                   22326336..22326388,22329542..22329589,22330612..22330746,
FT                   22336312..22336653))
FT                   /locus_tag="mCG_131080"
FT                   /product="mCG131080, transcript variant mCT132408"
FT                   /note="gene_id=mCG131080.2 transcript_id=mCT132408.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(22311980..22312177,22312292..22312350,
FT                   22312965..22313133,22313497..22313725,22313813..22314022,
FT                   22315058..22315208,22315465..22315817,22316799..22316902,
FT                   22320488..22320593,22320957..22321097,22324623..22324714,
FT                   22326336..22326388,22329542..22329589,22330612..22330746,
FT                   22336312..22336441))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131080"
FT                   /product="mCG131080, isoform CRA_a"
FT                   /note="gene_id=mCG131080.2 transcript_id=mCT132408.1
FT                   protein_id=mCP50774.1 isoform=CRA_a"
FT                   /protein_id="EDL08262.1"
FT                   /translation="MFSALKKLVGSEQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMK
FT                   IVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDK
FT                   GKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNCNGVVMMFDITKQWTFNYVLRELP
FT                   KVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNSFGLKY
FT                   LHKFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQNYSIFLEMMEARSRG
FT                   HASPLAANGQSPSSGSQSPVVPPSAVSTGSSSPSTPQPAPQLSLGVSSTCPSAPSPVPS
FT                   LEAMPSSVHSSAPAPTPAPAPAPAQRRSIISRLFGTSPAAEVTPSPPEPAPALEAPARV
FT                   QNVEDFVPEDGLDRSFLEDTSVPKDKKVGAKGPQQDSDSDDGEALGGNPMVAGFQDDVD
FT                   IEDQTHGKSLLPSDPMPSKNISLSSEEEAEGLAGHPRVAPQQCSEPETKWSSTKVSHPQ
FT                   KKGAPTRGTPPWSDGLTTDDSERPQEGKDKQVSSESDPEGPIAAQMLSFVMDDPDFESD
FT                   ESDTQRRMGRFPVREDLSDVTDEDTGPAQPPPPSKLPGAFRLKNDSDLFGLGLEEMGPK
FT                   ESSDEDRDSKLPSKEKKKKKKKSKEEEEKTTKKKSKHKKSKDKEESKEDRKKKRKPPRS
FT                   KEQKAADELEAFLGGGAPGSRHPGGGDYEEL"
FT   mRNA            complement(join(<22312965..22313133,22313497..22313725,
FT                   22313813..22314022,22315058..22315208,22315465..22315817,
FT                   22316799..22316902,22320488..22320593,22320957..22321097,
FT                   22324623..22324714,22326336..22326383,22329542..22329589,
FT                   22330612..22330746,22336312..>22336664))
FT                   /locus_tag="mCG_131080"
FT                   /product="mCG131080, transcript variant mCT190115"
FT                   /note="gene_id=mCG131080.2 transcript_id=mCT190115.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<22312965..22313133,22313497..22313725,
FT                   22313813..22314022,22315058..22315208,22315465..22315817,
FT                   22316799..22316902,22320488..22320593,22320957..22321097,
FT                   22324623..22324714,22326336..22326383,22329542..>22329550))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131080"
FT                   /product="mCG131080, isoform CRA_b"
FT                   /note="gene_id=mCG131080.2 transcript_id=mCT190115.0
FT                   protein_id=mCP111087.0 isoform=CRA_b"
FT                   /protein_id="EDL08263.1"
FT                   /translation="LTKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNCNGVVMMFD
FT                   ITKQWTFNYVLRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYF
FT                   RYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQ
FT                   NYSIFLEMMEARSRGHASPLAANGQSPSSGSQSPVVPPSAVSTGSSSPSTPQPAPQLSL
FT                   GVSSTCPSAPSPVPSLEAMPSSVHSSAPAPTPAPAPAPAQRRSIISRLFGTSPAAEVTP
FT                   SPPEPAPALEAPARVQNVEDFVPEDGLDRSFLEDTSVPKDKKVGAKGPQQDSDSDDGEA
FT                   LGGNPMVAGFQDDVDIEDQTHGKSLLPSDPMPSKNISLSSEEEAEGLAGHPRVAPQQCS
FT                   EPETKWSSTKVSHPQKKGAPTRGTPPWSDGLTTDDSERPQEGKDKQVSSESDPEGPIAA
FT                   QMLSFVMDDPDFESDESDTQRRMGRFPVREDLSDVTDEDTGPAQPPPPSKLPGAFRLKN
FT                   DSDLFGLGLEEMGPKESSDE"
FT   gene            complement(22336865..22345933)
FT                   /locus_tag="mCG_141208"
FT                   /note="gene_id=mCG141208.0"
FT   mRNA            complement(join(22336865..22337555,22337630..22337740,
FT                   22337824..22337992,22338744..22338904,22339720..22339820,
FT                   22340206..22340260,22340343..22340468,22341832..22341954,
FT                   22343683..22344883,22345258..22345379,22345807..22345933))
FT                   /locus_tag="mCG_141208"
FT                   /product="mCG141208"
FT                   /note="gene_id=mCG141208.0 transcript_id=mCT173773.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(join(22337394..22337555,22337630..22337740,
FT                   22337824..22337992,22338744..22338904,22339720..22339820,
FT                   22340206..22340260,22340343..22340468,22341832..22341879))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141208"
FT                   /product="mCG141208"
FT                   /note="gene_id=mCG141208.0 transcript_id=mCT173773.0
FT                   protein_id=mCP96693.0"
FT                   /protein_id="EDL08264.1"
FT                   /translation="MTVMSQDAMMITDEVKRNMRQGEATFIEERRARENRLNQQKKLID
FT                   KIHTKETSEKYRRGRRDLDFPSNLMTMENVKVKKRKTSVADIQYQTKVTTLVERVKSAV
FT                   QCSHLWDIAGRFLAQKNTEENLELQMEDCEERRTQLEALMKKLELEEAVLKFHQTPSAV
FT                   GFNSIQKKMKNMLEEEEARLKQAQNNMNKGQQLLLVIQTGIDNLYIRLIGITLPTFQKE
FT                   IAVSNTLDVYGKLDYCEGKLIYLAERMQTLSRNEEVDTKVRDTLESSTLKEKHNTRITF
FT                   EDPEEDMIGEALHAGHRKMEKDDKNNSCN"
FT   gene            <22344280..>22360146
FT                   /locus_tag="mCG_146088"
FT                   /note="gene_id=mCG146088.0"
FT   mRNA            join(<22344280..22344453,22344858..22345460,
FT                   22353634..22353684,22355653..22355729,22356017..22356070,
FT                   22357380..22357472,22359061..22359170,22359583..22359650,
FT                   22360027..>22360146)
FT                   /locus_tag="mCG_146088"
FT                   /product="mCG146088"
FT                   /note="gene_id=mCG146088.0 transcript_id=mCT186191.0
FT                   created on 14-JUL-2003"
FT   gene            complement(22348423..22350323)
FT                   /locus_tag="mCG_141207"
FT                   /note="gene_id=mCG141207.0"
FT   mRNA            complement(join(22348423..22348850,22349386..22349493,
FT                   22349695..22349778,22349928..22349994,22350254..22350323))
FT                   /locus_tag="mCG_141207"
FT                   /product="mCG141207"
FT                   /note="gene_id=mCG141207.0 transcript_id=mCT173774.0
FT                   created on 27-SEP-2002"
FT   CDS             complement(join(22348837..22348850,22349386..22349493,
FT                   22349695..22349778,22349928..22349994,22350254..22350307))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141207"
FT                   /product="mCG141207"
FT                   /note="gene_id=mCG141207.0 transcript_id=mCT173774.0
FT                   protein_id=mCP96692.0"
FT                   /protein_id="EDL08266.1"
FT                   /translation="MVNLGLSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGAT
FT                   FGLLMFIKRKFPYPVQWSFLVSAIAGSVASYRVTSMECQKCSNLWLFLETGQLPKDIST
FT                   DPHD"
FT   gene            complement(22353029..22356377)
FT                   /gene="Fcna"
FT                   /locus_tag="mCG_18758"
FT                   /note="gene_id=mCG18758.2"
FT   mRNA            complement(join(22353029..22353451,22354641..22354655,
FT                   22355005..22355040,22355331..22355366,22355638..22355691,
FT                   22355796..22355909,22356110..22356377))
FT                   /gene="Fcna"
FT                   /locus_tag="mCG_18758"
FT                   /product="ficolin A, transcript variant mCT174070"
FT                   /note="gene_id=mCG18758.2 transcript_id=mCT174070.0 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(22353031..22353451,22353577..22353711,
FT                   22353798..22353927,22354376..22354503,22354620..22354655,
FT                   22355005..22355040,22355331..22355366,22355638..22355691,
FT                   22355796..22355909,22356110..22356377))
FT                   /gene="Fcna"
FT                   /locus_tag="mCG_18758"
FT                   /product="ficolin A, transcript variant mCT15156"
FT                   /note="gene_id=mCG18758.2 transcript_id=mCT15156.1 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(22353204..22353451,22354641..22354655,
FT                   22355005..22355040,22355331..22355366,22355638..22355691,
FT                   22355796..22355909,22356110..22356197))
FT                   /codon_start=1
FT                   /gene="Fcna"
FT                   /locus_tag="mCG_18758"
FT                   /product="ficolin A, isoform CRA_a"
FT                   /note="gene_id=mCG18758.2 transcript_id=mCT174070.0
FT                   protein_id=mCP96989.0 isoform=CRA_a"
FT                   /protein_id="EDL08267.1"
FT                   /translation="MQWPTLWAFSGLLCLCPSQALGQERGACPDVKVVGLGAQDKVVVI
FT                   QSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTG
FT                   AAPSLGEKELGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYL
FT                   SGSHESYADGINWGTGQGHHYSYKVAEMKIRAS"
FT   CDS             complement(join(22353204..22353451,22353577..22353711,
FT                   22353798..22353927,22354376..22354503,22354620..22354655,
FT                   22355005..22355040,22355331..22355366,22355638..22355691,
FT                   22355796..22355909,22356110..22356197))
FT                   /codon_start=1
FT                   /gene="Fcna"
FT                   /locus_tag="mCG_18758"
FT                   /product="ficolin A, isoform CRA_b"
FT                   /note="gene_id=mCG18758.2 transcript_id=mCT15156.1
FT                   protein_id=mCP19645.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJM1"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="MGI:MGI:1340905"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJM1"
FT                   /protein_id="EDL08268.1"
FT                   /translation="MQWPTLWAFSGLLCLCPSQALGQERGACPDVKVVGLGAQDKVVVI
FT                   QSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTG
FT                   AAPSLGEKELGDTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGW
FT                   TVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGK
FT                   GSYAKYSSFQVSEEQEKYKLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAAL
FT                   FHGAWWYHNCHQSNLNGRYLSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS"
FT   CDS             join(<22355711..22355729,22356017..22356070,
FT                   22357380..22357472,22359061..22359170,22359583..22359650,
FT                   22360027..>22360146)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146088"
FT                   /product="mCG146088"
FT                   /note="gene_id=mCG146088.0 transcript_id=mCT186191.0
FT                   protein_id=mCP107423.0"
FT                   /protein_id="EDL08265.1"
FT                   /translation="TGSHLLGCPSKMSHLLLPHVQAYAGLNPEVHRSSQLSNSNGFPHL
FT                   QLQQAEHSPGVLYPAGGLYCSSFWLSLQFPTPCRGTGTHAQLLLVFYILSGNLKYWLQT
FT                   QACLPLQGAECLYKLALRSVQCVASTCAAGAVTLVRSVLECAFNKPTLFN"
FT   gene            22381431..22384530
FT                   /gene="Lcn8"
FT                   /locus_tag="mCG_18729"
FT                   /note="gene_id=mCG18729.1"
FT   mRNA            join(22381431..22381545,22382474..22382604,
FT                   22383058..22383128,22383428..22383532,22383612..22383701,
FT                   22383795..22383820,22384416..22384530)
FT                   /gene="Lcn8"
FT                   /locus_tag="mCG_18729"
FT                   /product="lipocalin 8"
FT                   /note="gene_id=mCG18729.1 transcript_id=mCT15025.1 created
FT                   on 27-SEP-2002"
FT   CDS             join(22381453..22381545,22382474..22382604,
FT                   22383058..22383128,22383428..22383532,22383612..22383701,
FT                   22383795..22383820,22384416..22384427)
FT                   /codon_start=1
FT                   /gene="Lcn8"
FT                   /locus_tag="mCG_18729"
FT                   /product="lipocalin 8"
FT                   /note="gene_id=mCG18729.1 transcript_id=mCT15025.1
FT                   protein_id=mCP19636.2"
FT                   /protein_id="EDL08269.1"
FT                   /translation="MEARLLSNVCGFFLVFLLQAESTRVELVPEKIAGFWKEVAVASDQ
FT                   KLVLKAQRRVEGLFLTFSGGNVTVKAVYNSSGSCVTESSLGSERDTVGEFAFPGNREIH
FT                   VLDTDYERYTILKLTLLWQGRNFHVLKYFTRSLENEDEPGFWLFREMTADQGLYMLARH
FT                   GRCAELLKEGLV"
FT   gene            <22386315..22389958
FT                   /gene="Lcn5"
FT                   /locus_tag="mCG_18752"
FT                   /note="gene_id=mCG18752.1"
FT   mRNA            join(<22386315..22386410,22386631..22386767,
FT                   22388370..22388449,22388949..22389053,22389208..22389309,
FT                   22389395..22389420,22389856..22389958)
FT                   /gene="Lcn5"
FT                   /locus_tag="mCG_18752"
FT                   /product="lipocalin 5"
FT                   /note="gene_id=mCG18752.1 transcript_id=mCT15149.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(22386315..22386410,22386631..22386767,
FT                   22388370..22388449,22388949..22389053,22389208..22389309,
FT                   22389395..22389420,22389856..22389867)
FT                   /codon_start=1
FT                   /gene="Lcn5"
FT                   /locus_tag="mCG_18752"
FT                   /product="lipocalin 5"
FT                   /note="gene_id=mCG18752.1 transcript_id=mCT15149.1
FT                   protein_id=mCP19607.1"
FT                   /protein_id="EDL08270.1"
FT                   /translation="MESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASK
FT                   MGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRIS
FT                   GEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFS
FT                   ETDIHILKHDLTCVNALQLGQI"
FT   gene            22404977..>22405414
FT                   /locus_tag="mCG_131107"
FT                   /note="gene_id=mCG131107.0"
FT   mRNA            join(22404977..22405101,22405275..>22405414)
FT                   /locus_tag="mCG_131107"
FT                   /product="mCG131107"
FT                   /note="gene_id=mCG131107.0 transcript_id=mCT132435.0
FT                   created on 07-OCT-2002"
FT   CDS             join(22405009..22405101,22405275..>22405414)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131107"
FT                   /product="mCG131107"
FT                   /note="gene_id=mCG131107.0 transcript_id=mCT132435.0
FT                   protein_id=mCP50989.1"
FT                   /protein_id="EDL08271.1"
FT                   /translation="MKVILLTAALLALVSIPWLQAVWLGRLDPKQLLGPWYVLAVASRA
FT                   KDFMVEKDMKNVEGVVVTLTPDNKLRVESSRHG"
FT   gene            22407459..22409794
FT                   /locus_tag="mCG_18768"
FT                   /note="gene_id=mCG18768.2"
FT   mRNA            join(22407459..22408320,22408899..22409009,
FT                   22409129..22409230,22409364..22409469,22409646..22409794)
FT                   /locus_tag="mCG_18768"
FT                   /product="mCG18768"
FT                   /note="gene_id=mCG18768.2 transcript_id=mCT15165.2 created
FT                   on 12-FEB-2003"
FT   CDS             join(22408215..22408320,22408899..22409009,
FT                   22409129..22409230,22409364..22409469,22409646..22409760)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18768"
FT                   /product="mCG18768"
FT                   /note="gene_id=mCG18768.2 transcript_id=mCT15165.2
FT                   protein_id=mCP19485.2"
FT                   /db_xref="GOA:A2AJC1"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:3045364"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJC1"
FT                   /protein_id="EDL08272.1"
FT                   /translation="MTLRGPSHIFPRPGGCHQSTVELLKQESRWVFENPSLGILDYRVL
FT                   GTNFKDYAVVFTQLEFGDEVFNTVSLYSRTEMASHEAMQLFTKWSQGLGFLSQQQAQLQ
FT                   KDLSSTEACGWDPGNCYSPILTTGSLLLQSLVHTRSSSECHTLDIAPQHPGILVEVGRH
FT                   GLCTVAGGTGADWLLS"
FT   gene            <22411696..22414278
FT                   /gene="Lcn10"
FT                   /locus_tag="mCG_18740"
FT                   /note="gene_id=mCG18740.1"
FT   mRNA            join(<22411696..22411847,22412226..22412296,
FT                   22412493..22412600,22413240..22413338,22413757..22414278)
FT                   /gene="Lcn10"
FT                   /locus_tag="mCG_18740"
FT                   /product="lipocalin 10"
FT                   /note="gene_id=mCG18740.1 transcript_id=mCT15036.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(22411696..22411847,22412226..22412296,
FT                   22412493..22412600,22413240..22413338,22413757..22413785)
FT                   /codon_start=1
FT                   /gene="Lcn10"
FT                   /locus_tag="mCG_18740"
FT                   /product="lipocalin 10"
FT                   /note="gene_id=mCG18740.1 transcript_id=mCT15036.1
FT                   protein_id=mCP19477.0"
FT                   /protein_id="EDL08273.1"
FT                   /translation="MPRQFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRV
FT                   VIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNY
FT                   KSLLLFNRQNISSFLSLREFLDTCHILQLTKQATILPKDDSCAHTILP"
FT   gene            22428229..22431482
FT                   /gene="Lcn13"
FT                   /locus_tag="mCG_131106"
FT                   /note="gene_id=mCG131106.0"
FT   mRNA            join(22428229..22428333,22428866..22428999,
FT                   22429235..22429305,22429718..22429831,22430333..22430434,
FT                   22430886..22430909,22431319..22431482)
FT                   /gene="Lcn13"
FT                   /locus_tag="mCG_131106"
FT                   /product="lipocalin 13"
FT                   /note="gene_id=mCG131106.0 transcript_id=mCT132434.0
FT                   created on 07-OCT-2002"
FT   CDS             join(22428247..22428333,22428866..22428999,
FT                   22429235..22429305,22429718..22429831,22430333..22430434,
FT                   22430886..22430908)
FT                   /codon_start=1
FT                   /gene="Lcn13"
FT                   /locus_tag="mCG_131106"
FT                   /product="lipocalin 13"
FT                   /note="gene_id=mCG131106.0 transcript_id=mCT132434.0
FT                   protein_id=mCP50971.1"
FT                   /protein_id="EDL08274.1"
FT                   /translation="MKSLLLTILLLGLVAVLKAQEAPPDDLVDYSGIWYAKAMVHNGTL
FT                   PSHKIPSIVFPVRIIALEEGDLETTVVFWNNGHCREFKFVMKKTEEPGKYTAFHNTKVI
FT                   HVEKTSVNEHYIFYCEGRHNGTSSFGMGKLMGRDSGENPEAMEEFKNFIKRMNLRLENM
FT                   FVPEIGDKCVESD"
FT   gene            22434995..22436051
FT                   /gene="Bmyc"
FT                   /locus_tag="mCG_1029890"
FT                   /note="gene_id=mCG1029890.1"
FT   mRNA            22434995..22436051
FT                   /gene="Bmyc"
FT                   /locus_tag="mCG_1029890"
FT                   /product="brain expressed myelocytomatosis oncogene"
FT                   /note="gene_id=mCG1029890.1 transcript_id=mCT147594.1
FT                   created on 09-OCT-2002"
FT   CDS             22435082..22435594
FT                   /codon_start=1
FT                   /gene="Bmyc"
FT                   /locus_tag="mCG_1029890"
FT                   /product="brain expressed myelocytomatosis oncogene"
FT                   /note="gene_id=mCG1029890.1 transcript_id=mCT147594.1
FT                   protein_id=mCP50980.0"
FT                   /db_xref="GOA:A0PJL6"
FT                   /db_xref="InterPro:IPR002418"
FT                   /db_xref="InterPro:IPR012682"
FT                   /db_xref="MGI:MGI:88184"
FT                   /db_xref="UniProtKB/TrEMBL:A0PJL6"
FT                   /protein_id="EDL08275.1"
FT                   /translation="MPLHVSLANGNRDLDYDSVQPYFMCDDEEEDVHHQQPPQPPAPSE
FT                   DIWKKFELLPTPRPSPGHAGLYSPPCEAVAVSFAPRDHDGDSFSIADLPELPGGDAVKQ
FT                   SFVCDPDDETFVKNIILQDCMWNGFSASAKLVSKLDPYQAVRKEGTGVSLAADVEPATP
FT                   PDCTCNT"
FT   gene            <22463283..22465571
FT                   /locus_tag="mCG_131109"
FT                   /note="gene_id=mCG131109.1"
FT   mRNA            join(<22463283..22463369,22463887..22464020,
FT                   22464225..22464295,22464754..22464864,22465451..22465571)
FT                   /locus_tag="mCG_131109"
FT                   /product="mCG131109"
FT                   /note="gene_id=mCG131109.1 transcript_id=mCT132437.1
FT                   created on 07-OCT-2002"
FT   CDS             join(22463283..22463369,22463887..22464020,
FT                   22464225..22464295,22464754..22464864,22465451..22465569)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131109"
FT                   /product="mCG131109"
FT                   /note="gene_id=mCG131109.1 transcript_id=mCT132437.1
FT                   protein_id=mCP51003.1"
FT                   /protein_id="EDL08276.1"
FT                   /translation="MKSLLLTILLLGLVAVLKAQEAPPDDLEDFSGIWYTQAMVSDRNH
FT                   TDGKRPMKVFPMTVIALEGGSLEAQLTFWDNGHCHMKKILMHKTDEPHKYTAFKGKKTI
FT                   YIQETSVKGYYILYCEGQRHGRSHRKGKLIGTNSEKNPEAMEEFKKFAMSKGFREENII
FT                   VPEQLGERRL"
FT   gene            22491663..22494194
FT                   /gene="Lcn3"
FT                   /locus_tag="mCG_18750"
FT                   /note="gene_id=mCG18750.0"
FT   mRNA            join(22491663..22491771,22492134..22492255,
FT                   22492431..22492501,22492728..22492838,22493603..22493704,
FT                   22493880..22493906,22494052..22494194)
FT                   /gene="Lcn3"
FT                   /locus_tag="mCG_18750"
FT                   /product="lipocalin 3"
FT                   /note="gene_id=mCG18750.0 transcript_id=mCT15042.0 created
FT                   on 01-OCT-2002"
FT   CDS             join(22491667..22491771,22492134..22492255,
FT                   22492431..22492501,22492728..22492838,22493603..22493704,
FT                   22493880..22493906,22494052..22494077)
FT                   /codon_start=1
FT                   /gene="Lcn3"
FT                   /locus_tag="mCG_18750"
FT                   /product="lipocalin 3"
FT                   /note="gene_id=mCG18750.0 transcript_id=mCT15042.0
FT                   protein_id=mCP19593.0"
FT                   /db_xref="GOA:Q14AJ3"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002450"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:102669"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AJ3"
FT                   /protein_id="EDL08277.1"
FT                   /translation="MQTLEMRALLLIISFCLVAVLQAQDSSFLAFNNGNFSGKWFLKAL
FT                   VSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKT
FT                   HLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAEN
FT                   LVILEQMEKCEPESFYELPSRPSE"
FT   gene            22503146..22506377
FT                   /locus_tag="mCG_18743"
FT                   /note="gene_id=mCG18743.1"
FT   mRNA            join(22503146..22503226,22503792..22503928,
FT                   22504163..22504236,22505087..22505194,22505346..22505447,
FT                   22506262..22506377)
FT                   /locus_tag="mCG_18743"
FT                   /product="mCG18743"
FT                   /note="gene_id=mCG18743.1 transcript_id=mCT15039.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(22503155..22503226,22503792..22503928,
FT                   22504163..22504236,22505087..22505194,22505346..22505447,
FT                   22506262..22506281)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18743"
FT                   /product="mCG18743"
FT                   /note="gene_id=mCG18743.1 transcript_id=mCT15039.1
FT                   protein_id=mCP19688.2"
FT                   /protein_id="EDL08278.1"
FT                   /translation="MKLLLLLSVGLGLTWALQDFHPEQVTGPWHTLKLASTDRSLIEEG
FT                   GAYRCFMTDIVLLDNGNLNVTYFHRKDGKCVKEFYIAEKTDTPGQYTFEYQGRNSLTFV
FT                   HVTEDFAIMDLENQSEGGTTIVIEFHGRSLSTDELGWERYLVHTRRRGIAPENIVDLSL
FT                   SRRCDTH"
FT   gene            complement(22510038..>22520821)
FT                   /locus_tag="mCG_18736"
FT                   /note="gene_id=mCG18736.2"
FT   mRNA            complement(join(22510038..22510264,22511713..22511829,
FT                   22520541..>22520821))
FT                   /locus_tag="mCG_18736"
FT                   /product="mCG18736"
FT                   /note="gene_id=mCG18736.2 transcript_id=mCT15032.2 created
FT                   on 07-OCT-2002"
FT   gene            <22510714..>22513121
FT                   /locus_tag="mCG_146090"
FT                   /note="gene_id=mCG146090.0"
FT   mRNA            join(<22510714..22510784,22511672..22511767,
FT                   22512691..>22513121)
FT                   /locus_tag="mCG_146090"
FT                   /product="mCG146090"
FT                   /note="gene_id=mCG146090.0 transcript_id=mCT186193.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(22511801..22511829,22520541..>22520820))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18736"
FT                   /product="mCG18736"
FT                   /note="gene_id=mCG18736.2 transcript_id=mCT15032.2
FT                   protein_id=mCP19431.2"
FT                   /protein_id="EDL08279.1"
FT                   /translation="LTDKYLDPFLQSASKFFMPGYRVIFYIMVDKYLQLQEMEHNPLQS
FT                   FQVLKIGKERWWSNFDLMRMKILSEHIRDHIRYEVDFLFSMNINMVFQNWMKKGGAP"
FT   CDS             <22512846..>22513121
FT                   /codon_start=1
FT                   /locus_tag="mCG_146090"
FT                   /product="mCG146090"
FT                   /note="gene_id=mCG146090.0 transcript_id=mCT186193.0
FT                   protein_id=mCP107424.0"
FT                   /protein_id="EDL08280.1"
FT                   /translation="ALPALPFLTHFLSVVINPTKHKNRHPRLPAWSMAEWMFWRLERRR
FT                   ANLCVQKTPHSCTQKCFLRDEEWPRGQDACPTHSRPSLVASKRSNLN"
FT   gene            22542701..22545089
FT                   /gene="Lcn9"
FT                   /locus_tag="mCG_18728"
FT                   /note="gene_id=mCG18728.1"
FT   mRNA            join(22542701..22542807,22543112..22543248,
FT                   22543532..22543605,22543985..22544095,22544221..22544322,
FT                   22544452..22544496,22544823..22545089)
FT                   /gene="Lcn9"
FT                   /locus_tag="mCG_18728"
FT                   /product="lipocalin 9"
FT                   /note="gene_id=mCG18728.1 transcript_id=mCT15024.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(22542712..22542807,22543112..22543248,
FT                   22543532..22543605,22543985..22544095,22544221..22544322,
FT                   22544452..22544468)
FT                   /codon_start=1
FT                   /gene="Lcn9"
FT                   /locus_tag="mCG_18728"
FT                   /product="lipocalin 9"
FT                   /note="gene_id=mCG18728.1 transcript_id=mCT15024.1
FT                   protein_id=mCP19456.1"
FT                   /protein_id="EDL08281.1"
FT                   /translation="MVLLLVLGLVLSLATAQFNLHTAVRRDYNLARISGTWYLDSIASD
FT                   NMTRIEENGDLRLFIRNIKLLNNGSLQFDFHFMLQGECVAVTMVCEKTKNNGEFSVAYE
FT                   GKNKVLLLETDYSMYIIFYMQNIKNGTKTQVLALYGRSILLDKTHQREFENICNLYGLD
FT                   SQNIIDMTKKDFCFL"
FT   gene            complement(22562498..22565856)
FT                   /gene="Sohlh1"
FT                   /locus_tag="mCG_52547"
FT                   /note="gene_id=mCG52547.2"
FT   mRNA            complement(join(22562498..22562855,22563420..22563496,
FT                   22563982..22564168,22564758..22564891,22565149..22565273,
FT                   22565705..22565856))
FT                   /gene="Sohlh1"
FT                   /locus_tag="mCG_52547"
FT                   /product="spermatogenesis and oogenesis specific basic
FT                   helix-loop-helix 1"
FT                   /note="gene_id=mCG52547.2 transcript_id=mCT52730.2 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(22562653..22562855,22563420..22563496,
FT                   22563982..22564168,22564758..22564891,22565149..22565273,
FT                   22565705..22565782))
FT                   /codon_start=1
FT                   /gene="Sohlh1"
FT                   /locus_tag="mCG_52547"
FT                   /product="spermatogenesis and oogenesis specific basic
FT                   helix-loop-helix 1"
FT                   /note="gene_id=mCG52547.2 transcript_id=mCT52730.2
FT                   protein_id=mCP39846.2"
FT                   /protein_id="EDL08282.1"
FT                   /translation="MASVLEMSVYFLQLAHSMDPSWEQLSVPQPPQEMWHMWQGDVLQV
FT                   TLANQIADSKPDSGIAKPSAVSRVQDPPCFGMLDTDQSQATERESELLERPSSCPGHRQ
FT                   SALSFSEPESSSLGPGLPPWIPHSWQPATPEASDIVPGGSHQVASLAGDPESSGMLAEE
FT                   ANLVLASVPDARYTTGAGSDVVDGAPFLMTTNPDWWLGSVEGRGGPALARSSPVDGAEP
FT                   SFIGDPELCSQELQAGPGELWGLDFGSPGLALKDEADSIFPDFFP"
FT   gene            22584098..22639317
FT                   /gene="Kcnt1"
FT                   /locus_tag="mCG_18756"
FT                   /note="gene_id=mCG18756.1"
FT   mRNA            join(22584098..22584296,22597516..22597671,
FT                   22601832..22601873,22607705..22607784,22608395..22608494,
FT                   22610483..22610539,22610825..22610873,22611825..22611884,
FT                   22612101..22612175,22612241..22612324,22612896..22612990,
FT                   22614038..22614218,22617181..22617345,22620428..22620592,
FT                   22620856..22620992,22622385..22622448,22622534..22622642,
FT                   22623051..22623159,22623371..22623520,22623914..22624152,
FT                   22625517..22625751,22627432..22627537,22628822..22628994,
FT                   22629448..22629519,22629689..22629823,22630218..22630329,
FT                   22631378..22631479,22631767..22631850,22631988..22632110,
FT                   22632440..22632460,22633205..22633535,22634834..22634896,
FT                   22637960..22638047,22638178..22639317)
FT                   /gene="Kcnt1"
FT                   /locus_tag="mCG_18756"
FT                   /product="potassium channel, subfamily T, member 1"
FT                   /note="gene_id=mCG18756.1 transcript_id=mCT15152.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(22584202..22584296,22597516..22597671,
FT                   22601832..22601873,22607705..22607784,22608395..22608494,
FT                   22610483..22610539,22610825..22610873,22611825..22611884,
FT                   22612101..22612175,22612241..22612324,22612896..22612990,
FT                   22614038..22614218,22617181..22617345,22620428..22620592,
FT                   22620856..22620992,22622385..22622448,22622534..22622642,
FT                   22623051..22623159,22623371..22623520,22623914..22624152,
FT                   22625517..22625751,22627432..22627537,22628822..22628994,
FT                   22629448..22629519,22629689..22629823,22630218..22630329,
FT                   22631378..22631479,22631767..22631850,22631988..22632110,
FT                   22632440..22632460,22633205..22633535,22634834..22634896,
FT                   22637960..22638047,22638178..22638298)
FT                   /codon_start=1
FT                   /gene="Kcnt1"
FT                   /locus_tag="mCG_18756"
FT                   /product="potassium channel, subfamily T, member 1"
FT                   /note="gene_id=mCG18756.1 transcript_id=mCT15152.2
FT                   protein_id=mCP19476.2"
FT                   /protein_id="EDL08283.1"
FT                   /translation="MNDLDTEVLPLPPRYRFRDLLLGDQPFPNDDRMARAKLPRSPSEG
FT                   KAGPGDTPAGAAAPEEPHGLSPLLPARGGGSVGSDVGQRLHVEDFSLDSSLSQVQVEFY
FT                   VNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDNPDQGIGCWGCTK
FT                   YNYTFNGSSSEFHWAPILWVERKMALWVIQVIVATISFLETMLIIYLSYKGNIWEQIFH
FT                   VSFVLEMINTLPFIITVFWPPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMF
FT                   NQVLILFCTLLCLVFTGTCGIQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPKIWPS
FT                   QLLVVILICVTLVVLPLQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPKIWPSQLLV
FT                   VILICVTLVVLPLQFEELVYLWMERQKSGGNYSRHRARTEKHVVLCVSSLKIDLLMDFL
FT                   NEFYAHPRLQDYYVVILCPSEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDN
FT                   GEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVC
FT                   EEECKYAMLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRTYGRCSGNEVYHIRMG
FT                   DSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKREENKSILLNPGPRHILAASDTCFYIN
FT                   ITKEENSAFIFKQEEKQKRRGLAGQALYEGPSRLPVHSIIASMGTVAMDLQNTDCRPSQ
FT                   GGSGGDGTKLTLPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGL
FT                   SVVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLI
FT                   IVSAETAGNGLYNFIVPLRAYYRSRRELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGS
FT                   VDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTEL
FT                   THPSNMRFMQFRAKDSYSLALSKLEKQERENGSNLAFMFRLPFAAGRVFSISMLDTLLY
FT                   QSFVKDYMITITRLLLGLDTTPGSGYLCAMKVTEDDLWIRTYGRLFQKLCSSSAEIPIG
FT                   IYRTECHVFSEPHDVRAQSQISVNMEDCEDTREAKGPWGTRAASGSGSTHGRHGGSADP
FT                   VEHPLLRRKSLQWARKLSRKSTKQAGKAPVATDWITQQRLSLYRRSERQELSELVKNRM
FT                   KHLGLPTTGYEDVANLTASDVMNRVNLGYLQDEMNDHHQNTLSYVLINPPPDTRLEPND
FT                   IVYLIRSDPLAHVASSSQSRKSSCSNKLSSCNPETRDETQL"
FT   gene            complement(22649193..22705207)
FT                   /locus_tag="mCG_131096"
FT                   /note="gene_id=mCG131096.0"
FT   mRNA            complement(join(22649193..22652244,22655790..22655914,
FT                   22656425..22656540,22657775..22657877,22658163..22658371,
FT                   22658828..22658964,22660243..22662610,22663162..22663246,
FT                   22663675..22663766,22666725..22666902,22667241..22667337,
FT                   22667433..22667572,22674984..22675125,22678553..22678633,
FT                   22687889..22688050,22688913..22689175,22705012..22705207))
FT                   /locus_tag="mCG_131096"
FT                   /product="mCG131096"
FT                   /note="gene_id=mCG131096.0 transcript_id=mCT132424.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(22651945..22652244,22655790..22655914,
FT                   22656425..22656540,22657775..22657877,22658163..22658371,
FT                   22658828..22658964,22660243..22662610,22663162..22663246,
FT                   22663675..22663766,22666725..22666902,22667241..22667337,
FT                   22667433..22667572,22674984..22675125,22678553..22678633,
FT                   22687889..22688050,22688913..22689175,22705012..22705171))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131096"
FT                   /product="mCG131096"
FT                   /note="gene_id=mCG131096.0 transcript_id=mCT132424.1
FT                   protein_id=mCP51220.1"
FT                   /protein_id="EDL08284.1"
FT                   /translation="MVDAGGRCAAEGWRRMEAPPEGCRPGAAGPLRRGAGPRSPPTCSG
FT                   SVLKAYGLDNIPEDLRDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVATL
FT                   QGHQSVIQALSRKGIYVMESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIE
FT                   KVVASVKRFSTFSASKELPYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQK
FT                   VRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMAD
FT                   SLYNIRLLREFSNEHLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQP
FT                   RDIQELKDAKTVLQQKSSRPPVPISNATKRSFLGSPAAMSPADQPPSTQPLAEGSHRYH
FT                   LHSEEPECLGKGASTFSPSHPLLPLRQKQQKVSQTEEIPDQRHRSNSLTRVDGQPRGAI
FT                   GAWPDKKNRPVSQPTSFALHHAASCDVDPSSGDSVSLARSISKDSLASNIIHLTPQNQP
FT                   HPSAGKSNGKSLLSNVNIEDEDEELVAIIRTDVSPPSPQMPRTSPQAPGLVASIRSPQR
FT                   QADTLESKPDSFYLEPLMPAVLRPAKEKQITTKEDERGEGRPRTIMAKRPSEGSQPMVR
FT                   KKVSGGHGSRDLNRTFTPIPCSEFAASIDLAEVGPQSAEATGEGQPLALGRFDTLPQGQ
FT                   AADGFFLHVGRAEEDEGRWYVGSQSPSSHDSEPWTILRQDSDSDVVDVEDTEQDFIGED
FT                   HPVVIPRYAGEEESAKLQEDMKVKEHEDKDDASGRSSPCLSTTSQLSSMSMASGSVKMT
FT                   SFAERKLQRLNSCETKSSTSSSQKTTPDASESCPAPLTTWRQKREQSPGRHSKDPASLL
FT                   ASELVQLHMQLEEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKKGKADGAPQPLRP
FT                   EHFTKEFTQHNGEDLDDGTCKTEGFLVKEEQRDLSDAQDVAFVQLHKPRDPAALHDGEK
FT                   HRMISTALLEDSVGEVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLMKSPTVPTP
FT                   GTKNNCQDQKIKAPVHFVEPLSPTGVPGHRKPPRLGQGRNSRSGRPAELKVPKDRQQGC
FT                   SRSKTPTPSVETLPQSRSLPPSTHPRSPSDPGGELPEKCLFDSYRLHDESNHRTFVLSS
FT                   CKDANIVSEQVNFKEGLDTSVKEAGLSSSTITGKEHTPVEEPLRSKASLIEVDLSDLKA
FT                   PDEDGEVVGHESSVELGGDSDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEAR
FT                   ARKQQLEAEVELKRDEARRKAEEDRLRKEEEKARRELIKQEYLRRKQQQALEEQGLGKP
FT                   KSKPKKPRPKSVHREESYSDSGTKCSSTPDNLSQTHSGSSLSLASAATTEPESVYSGGT
FT                   PSHRVESLEALPILSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPII
FT                   HNAISHCCLAGKVNEPHKNSILEASLEKCDANHYIILFRDAGCQFRALYCYQPDTEEIY
FT                   KLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPTVPK
FT                   KTQTRK"
FT   gene            complement(22716714..22717417)
FT                   /pseudo
FT                   /locus_tag="mCG_1029932"
FT                   /note="gene_id=mCG1029932.1"
FT   mRNA            complement(22716714..22717417)
FT                   /pseudo
FT                   /locus_tag="mCG_1029932"
FT                   /note="gene_id=mCG1029932.1 transcript_id=mCT147636.1
FT                   created on 05-FEB-2003"
FT   gene            complement(22720544..22743897)
FT                   /gene="Ubadc1"
FT                   /locus_tag="mCG_18759"
FT                   /note="gene_id=mCG18759.2"
FT   mRNA            complement(join(22720544..22721282,22727474..22727612,
FT                   22728675..22728761,22729867..22730101,22731019..22731127,
FT                   22731319..22731421,22732680..22732787,22737050..22737123,
FT                   22738454..22738574,22743555..22743885))
FT                   /gene="Ubadc1"
FT                   /locus_tag="mCG_18759"
FT                   /product="ubiquitin associated domain containing 1,
FT                   transcript variant mCT15157"
FT                   /note="gene_id=mCG18759.2 transcript_id=mCT15157.1 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(22720756..22721282,22727474..22727612,
FT                   22728675..22728761,22729867..22729994,22732718..22732787,
FT                   22737050..22737123,22738454..22738574,22743555..22743897))
FT                   /gene="Ubadc1"
FT                   /locus_tag="mCG_18759"
FT                   /product="ubiquitin associated domain containing 1,
FT                   transcript variant mCT173776"
FT                   /note="gene_id=mCG18759.2 transcript_id=mCT173776.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22721167..22721282,22727474..22727612,
FT                   22728675..22728761,22729867..22729994,22732718..22732787,
FT                   22737050..22737123,22738454..22738574,22743555..22743692))
FT                   /codon_start=1
FT                   /gene="Ubadc1"
FT                   /locus_tag="mCG_18759"
FT                   /product="ubiquitin associated domain containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18759.2 transcript_id=mCT173776.0
FT                   protein_id=mCP96695.0 isoform=CRA_b"
FT                   /protein_id="EDL08286.1"
FT                   /translation="MFVQEEKIFAGKVLRLHICAADGAEWLEEATEDTSVEKLKESCLK
FT                   HGAHGSLEDPKNVTHHKLIHAASERVLSDSKTILEENIQDQDVLLLIKKRVPSPLPKMA
FT                   DVSAEEKKKQEQKAPDKDAILRATANLPACTTTSSTSSEAAVGTSVEDEESRDELTEIF
FT                   KKIRRKKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELD
FT                   QGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQIS
FT                   RIFQTLNRT"
FT   CDS             complement(join(22721167..22721282,22727474..22727612,
FT                   22728675..22728761,22729867..22730101,22731019..22731127,
FT                   22731319..22731421,22732680..22732787,22737050..22737123,
FT                   22738454..22738574,22743555..22743692))
FT                   /codon_start=1
FT                   /gene="Ubadc1"
FT                   /locus_tag="mCG_18759"
FT                   /product="ubiquitin associated domain containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18759.2 transcript_id=mCT15157.1
FT                   protein_id=mCP19434.1 isoform=CRA_a"
FT                   /protein_id="EDL08285.1"
FT                   /translation="MFVQEEKIFAGKVLRLHICAADGAEWLEEATEDTSVEKLKESCLK
FT                   HGAHGSLEDPKNVTHHKLIHAASERVLSDSKTILEENIQDQDVLLLIKKRVPSPLPKMA
FT                   DVSAEEKKKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRDFQTELRKILVSLIEVA
FT                   QKLLALNPDAVELFKKANAMLDEDEDERVDETALRQLTEMGFPESRASKALRLNHMSVP
FT                   QAMEWLIEHSEDPAIDTPLPGHAAQAGASAAATTSSTSSEAAVGTSVEDEESRDELTEI
FT                   FKKIRRKKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEEL
FT                   DQGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQI
FT                   SRIFQTLNRT"
FT   gene            complement(<22776055..22780369)
FT                   /locus_tag="mCG_147223"
FT                   /note="gene_id=mCG147223.0"
FT   mRNA            complement(join(<22776055..22776407,22776440..22780369))
FT                   /locus_tag="mCG_147223"
FT                   /product="mCG147223"
FT                   /note="gene_id=mCG147223.0 transcript_id=mCT187486.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<22776055..22776407,22776440..22776542))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147223"
FT                   /product="mCG147223"
FT                   /note="gene_id=mCG147223.0 transcript_id=mCT187486.0
FT                   protein_id=mCP109105.0"
FT                   /protein_id="EDL08287.1"
FT                   /translation="MCISVLHVCTAPSIPCPYPFKEEAGVLAGFARPFGLQKVGLGDMI
FT                   DPLKSLSPILLHCSQEGQPLPTSLRGTLMWLWTEPSLPRRKDSLCHYNSACERTWATYR
FT                   GTFTNERKVRRWEGMNGFNPSKGRQVSVSMRPAWSPERVPRWLGLRET"
FT   gene            complement(22782417..22845449)
FT                   /gene="Btbd14a"
FT                   /locus_tag="mCG_18749"
FT                   /note="gene_id=mCG18749.1"
FT   mRNA            complement(join(22782417..22782989,22784089..22784186,
FT                   22784708..22784813,22786970..22787134,22812207..22813146,
FT                   22845352..22845449))
FT                   /gene="Btbd14a"
FT                   /locus_tag="mCG_18749"
FT                   /product="BTB (POZ) domain containing 14A"
FT                   /note="gene_id=mCG18749.1 transcript_id=mCT15147.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(22782478..22782989,22784089..22784186,
FT                   22784708..22784813,22786970..22787134,22812207..22813086))
FT                   /codon_start=1
FT                   /gene="Btbd14a"
FT                   /locus_tag="mCG_18749"
FT                   /product="BTB (POZ) domain containing 14A"
FT                   /note="gene_id=mCG18749.1 transcript_id=mCT15147.0
FT                   protein_id=mCP19589.1"
FT                   /protein_id="EDL08288.1"
FT                   /translation="MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHR
FT                   AVLAASSLYFRDLFSGNSKSAFELPGTVPPACFQQILSFCYTGKLTMAASEQLVVMYTA
FT                   GFLQIQHIVERGTDLMFKVSSPHCDSQTAMIEDASSEPQSPCNQLQPATAAYVTSPSVP
FT                   IPLLTRVKHEAMEMPPASGPGLASKRPLETGPRDGVAVATGAAGTPGTAPLKLPRVSYY
FT                   GVPSLATLIPSIQQVPYPPGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVEEQY
FT                   GQMYIKATGNYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDP
FT                   GEKLELVAGSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSST
FT                   SDPSRKPLDSRVLNAVKLYCQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLP
FT                   EGVEMYRSVMGASAASLPLDPEFPSAAPQVFEQRIYAERRSDAATIVALRTDAVNVDLS
FT                   TSANPAFEANEEVDGGGSVIQEVAAPEQLPADGQSSPQAFEQGNTSSSRPQTPVATATR
FT                   RPEGTYAGTL"
FT   gene            22861052..22862051
FT                   /locus_tag="mCG_147243"
FT                   /note="gene_id=mCG147243.0"
FT   mRNA            join(22861052..22861447,22861872..22862051)
FT                   /locus_tag="mCG_147243"
FT                   /product="mCG147243"
FT                   /note="gene_id=mCG147243.0 transcript_id=mCT187506.0
FT                   created on 13-JAN-2004"
FT   CDS             22861294..22861401
FT                   /codon_start=1
FT                   /locus_tag="mCG_147243"
FT                   /product="mCG147243"
FT                   /note="gene_id=mCG147243.0 transcript_id=mCT187506.0
FT                   protein_id=mCP109125.0"
FT                   /protein_id="EDL08289.1"
FT                   /translation="MGMTGIGPGRQCCFAVAVQCPDGQHRCHQRLGALS"
FT   gene            complement(22909244..22914194)
FT                   /locus_tag="mCG_147240"
FT                   /note="gene_id=mCG147240.0"
FT   mRNA            complement(join(22909244..22911155,22914136..22914194))
FT                   /locus_tag="mCG_147240"
FT                   /product="mCG147240"
FT                   /note="gene_id=mCG147240.0 transcript_id=mCT187503.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22909632..22909841)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147240"
FT                   /product="mCG147240"
FT                   /note="gene_id=mCG147240.0 transcript_id=mCT187503.0
FT                   protein_id=mCP109122.0"
FT                   /protein_id="EDL08290.1"
FT                   /translation="MELTENKGEVDSSFQVSLPAAPGSLMGVSAQDRLVLKDCSISFIS
FT                   DQEEPTPIRAELPAFPERYHEGLG"
FT   gene            complement(22922741..22930792)
FT                   /locus_tag="mCG_18748"
FT                   /note="gene_id=mCG18748.2"
FT   mRNA            complement(join(22922741..22924026,22924609..22924777,
FT                   22924865..22925016,22925489..22925691,22926465..22926636,
FT                   22928858..22929054))
FT                   /locus_tag="mCG_18748"
FT                   /product="mCG18748, transcript variant mCT174069"
FT                   /note="gene_id=mCG18748.2 transcript_id=mCT174069.0 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(22922819..22924026,22924609..22924777,
FT                   22924865..22925016,22925489..22925691,22926465..22926636,
FT                   22930615..22930792))
FT                   /locus_tag="mCG_18748"
FT                   /product="mCG18748, transcript variant mCT15146"
FT                   /note="gene_id=mCG18748.2 transcript_id=mCT15146.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(22923608..22924026,22924609..22924777,
FT                   22924865..22925016,22925489..22925691,22926465..22926636,
FT                   22930615..22930702))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18748"
FT                   /product="mCG18748, isoform CRA_a"
FT                   /note="gene_id=mCG18748.2 transcript_id=mCT15146.2
FT                   protein_id=mCP19570.2 isoform=CRA_a"
FT                   /protein_id="EDL08291.1"
FT                   /translation="MLLEAELDCHRERPGAPGASALCTFSRTPEIPMCAGCDQHILDRF
FT                   ILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQ
FT                   VVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRP
FT                   RTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDA
FT                   GRQRWGQYFRNMKRSRGSSKSDKEGIQEGQDSDAEVSFTDEPSMADMGPANGLYSSLGE
FT                   PAPALGRPVGGLGSFTLDHGGLTGPEQYRELRPGSPYGIPPSPAAPQSLPGPQPLLSSL
FT                   VYPDTNLSLVPSGPPGGPPPMRVLAGNGPSSDLSTESSSGYPDFPASPASWLDEVDHAQ
FT                   F"
FT   CDS             complement(join(22923608..22924026,22924609..22924777,
FT                   22924865..22925016,22925489..22925691,22926465..22926636,
FT                   22928858..22928951))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18748"
FT                   /product="mCG18748, isoform CRA_b"
FT                   /note="gene_id=mCG18748.2 transcript_id=mCT174069.0
FT                   protein_id=mCP96988.0 isoform=CRA_b"
FT                   /protein_id="EDL08292.1"
FT                   /translation="MEARGELDPSRESAGGDLLLALLARRADLRREIPMCAGCDQHILD
FT                   RFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPP
FT                   TQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAK
FT                   RPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK
FT                   DAGRQRWGQYFRNMKRSRGSSKSDKEGIQEGQDSDAEVSFTDEPSMADMGPANGLYSSL
FT                   GEPAPALGRPVGGLGSFTLDHGGLTGPEQYRELRPGSPYGIPPSPAAPQSLPGPQPLLS
FT                   SLVYPDTNLSLVPSGPPGGPPPMRVLAGNGPSSDLSTESSSGYPDFPASPASWLDEVDH
FT                   AQF"
FT   gene            complement(22931402..>22959965)
FT                   /gene="Qscn6l1"
FT                   /locus_tag="mCG_18753"
FT                   /note="gene_id=mCG18753.2"
FT   mRNA            complement(join(22931402..22933965,22936506..22936694,
FT                   22940158..22940308,22941098..22941220,22943119..22943248,
FT                   22943398..22943532,22944710..22944855,22947331..22947421,
FT                   22947639..22947744,22948728..22948776,22950828..22950928,
FT                   22959603..>22959965))
FT                   /gene="Qscn6l1"
FT                   /locus_tag="mCG_18753"
FT                   /product="quiescin Q6-like 1, transcript variant mCT15150"
FT                   /note="gene_id=mCG18753.2 transcript_id=mCT15150.2 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(22931644..22932306,22933780..22933965,
FT                   22936506..22936694,22940158..22940308,22941098..22941220,
FT                   22943119..22943248,22943398..22943532,22944710..22944855,
FT                   22947331..22947421,22947639..22947744,22948728..22948776,
FT                   22950828..22950928,22959603..>22959965))
FT                   /gene="Qscn6l1"
FT                   /locus_tag="mCG_18753"
FT                   /product="quiescin Q6-like 1, transcript variant mCT175263"
FT                   /note="gene_id=mCG18753.2 transcript_id=mCT175263.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(22932104..22932306,22933780..22933965,
FT                   22936506..22936694,22940158..22940308,22941098..22941220,
FT                   22943119..22943248,22943398..22943532,22944710..22944855,
FT                   22947331..22947421,22947639..22947744,22948728..22948776,
FT                   22950828..22950928,22959603..>22959867))
FT                   /codon_start=1
FT                   /gene="Qscn6l1"
FT                   /locus_tag="mCG_18753"
FT                   /product="quiescin Q6-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG18753.2 transcript_id=mCT175263.0
FT                   protein_id=mCP98182.0 isoform=CRA_b"
FT                   /protein_id="EDL08294.1"
FT                   /translation="RQPPSLRAARLPRLLFLLAVVAAVGPREGGGARLYREGSDAVWLL
FT                   DSGSVRSATGNSSAAWLVQFHSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEE
FT                   KNQDVCRTYDIHFYPTFRYFKAFTKEFTTGENFKGPDRELRTVRQTMIDFLQNHTEGTW
FT                   PPACPPLDPIQSSDILSFMDSHSGQYHAIVFESNGSYVGREVILDLIPYENIMVSRALD
FT                   TDKAFLGTLGITSVPSCYLIYPNGSHGLVNVAKPLRSFFSSHLKSLPDVRKKSLFLPEK
FT                   SNKEEKSEVVVWKEFDRAKLYIADLESGLHYLLRVELAAHRSLAGAQLKTFRDFVTVVA
FT                   KLFPGRPAVKKLLETLQEWLANLPLDKIPYNAILDLVNNKMQISGIFLTSHVKWVGCQG
FT                   SRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFGCKEC
FT                   GEHFEEMAKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPA
FT                   CHEEIKGLDSWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV
FT                   NLLPHFPVEEVSSLKPGVLCLKTNKPRSSLGVSKDEHSWSVSLRIGPI"
FT   CDS             complement(join(22933418..22933965,22936506..22936694,
FT                   22940158..22940308,22941098..22941220,22943119..22943248,
FT                   22943398..22943532,22944710..22944855,22947331..22947421,
FT                   22947639..22947744,22948728..22948776,22950828..22950928,
FT                   22959603..>22959942))
FT                   /codon_start=1
FT                   /gene="Qscn6l1"
FT                   /locus_tag="mCG_18753"
FT                   /product="quiescin Q6-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG18753.2 transcript_id=mCT15150.2
FT                   protein_id=mCP19414.2 isoform=CRA_a"
FT                   /protein_id="EDL08293.1"
FT                   /translation="KVNAPAALPTWLPPGLWRGIQELLRRQPPSLRAARLPRLLFLLAV
FT                   VAAVGPREGGGARLYREGSDAVWLLDSGSVRSATGNSSAAWLVQFHSSWCGHCIGYAPT
FT                   WRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFKAFTKEFTTGENFK
FT                   GPDRELRTVRQTMIDFLQNHTEGTWPPACPPLDPIQSSDILSFMDSHSGQYHAIVFESN
FT                   GSYVGREVILDLIPYENIMVSRALDTDKAFLGTLGITSVPSCYLIYPNGSHGLVNVAKP
FT                   LRSFFSSHLKSLPDVRKKSLFLPEKSNKEEKSEVVVWKEFDRAKLYIADLESGLHYLLR
FT                   VELAAHRSLAGAQLKTFRDFVTVVAKLFPGRPAVKKLLETLQEWLANLPLDKIPYNAIL
FT                   DLVNNKMQISGIFLTSHVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTG
FT                   FEGHPQAVLQAIRRYIRTFFGCKECGEHFEEMAKESMDSVKTPDQAVLWLWRKHNMVNS
FT                   RLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGLDSWNEGQVLLFLKQHYSRDNLVDAYS
FT                   VDQGSPGEWEAQGREQEEGKGLNPSGKSWRHHDTGSLRPPHILGPRTDLSKSLHHRLDL
FT                   RLQSPQGPQALKEAKAVVPFLGVGFSSLDMSLCVVLYVASSLFLMIMYFFFRVRSKRWK
FT                   VRLYHPAV"
FT   gene            complement(22964172..>22966758)
FT                   /locus_tag="mCG_1030136"
FT                   /note="gene_id=mCG1030136.1"
FT   mRNA            complement(join(22964172..22964211,22966439..>22966758))
FT                   /locus_tag="mCG_1030136"
FT                   /product="mCG1030136"
FT                   /note="gene_id=mCG1030136.1 transcript_id=mCT147840.1
FT                   created on 08-OCT-2002"
FT   CDS             complement(join(22964188..22964211,22966439..>22966756))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030136"
FT                   /product="mCG1030136"
FT                   /note="gene_id=mCG1030136.1 transcript_id=mCT147840.1
FT                   protein_id=mCP50740.1"
FT                   /protein_id="EDL08295.1"
FT                   /translation="TPRGCLKSARMCTCVCVHVYTWVCVPTHLSPTLHFLTVPCLLMVL
FT                   TLHLLGPIVSHAWLCLYSPHLLSLLLTPSPLSFALVLFLTHKNYAYCQAVVVHAFNPSA
FT                   QEAEVGRSM"
FT   gene            complement(22994444..23017148)
FT                   /gene="4932418E24Rik"
FT                   /locus_tag="mCG_18744"
FT                   /note="gene_id=mCG18744.3"
FT   mRNA            complement(join(22994444..22994735,22998259..22998430,
FT                   22998704..22999064,22999214..22999283,23002717..23002814,
FT                   23003270..23004408,23010492..23010584,23012288..23012386,
FT                   23015928..23016433,23016831..23017148))
FT                   /gene="4932418E24Rik"
FT                   /locus_tag="mCG_18744"
FT                   /product="RIKEN cDNA 4932418E24"
FT                   /note="gene_id=mCG18744.3 transcript_id=mCT15040.3 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(22994540..22994735,22998259..22998430,
FT                   22998704..22999064,22999214..22999283,23002717..23002814,
FT                   23003270..23004408,23010492..23010584,23012288..23012386,
FT                   23015928..23016433,23016831..23016973))
FT                   /codon_start=1
FT                   /gene="4932418E24Rik"
FT                   /locus_tag="mCG_18744"
FT                   /product="RIKEN cDNA 4932418E24"
FT                   /note="gene_id=mCG18744.3 transcript_id=mCT15040.3
FT                   protein_id=mCP19712.3"
FT                   /protein_id="EDL08296.1"
FT                   /translation="MTTPLMGVMPTSLRATLQNCSRGNQQEGLFSPKAMGRMAGQKDST
FT                   KPRDEVFHPHAAKDSLLATTLRWPVLSQQLSPPQTVPYVAWSGNIKDPSPYMKGCSLPM
FT                   WSPCLDTKDVDSSVSSGRMSGSSGGHESCTLSHGPWKERPPLILGPQRQPRKSDPRLEQ
FT                   LRDKIRAQAQWQASCASLGTSAPSSASCLYKTSTMLRRKTPKVTNALPVPAFPGSGVLR
FT                   TAEHRGKDRASLSLRRELSKVPQHHTSVPRTNFKKVKNASCKREISKSSILRRTAKGRG
FT                   SDRKAAAVKASPAHTWLCKPMSAHSDQQVSKHTPSLAFQDQSATIHGAMETLQDLRQQI
FT                   QAGLELTRSPRVDRKLSLSKPKPQNLVGKRDRGLQSTQDMQGSSKTAWTVTEGKNSSLH
FT                   RAGNLHSQQHRKKALAEHESCPRRTWTGQGQDSSFPRPGSTPEKPRFFSQRPWSALARQ
FT                   TYPQRTWDAQGQDISVQKSGSSLKKPSPFSQRPWSALAGRAYSACEDREVFEPSPWNSL
FT                   SRPHSALQDPWSNSFVQRSSPSSKGKSAVPPPSKVKPAWPEPSQDLLQSKPAKEQDTPC
FT                   PRPRGSLGQQHSSESLRDFMRQKAQARRQQALEQKALAAHTLELRNQRLQEVYRKQREA
FT                   VLGKDIPVVSQRRPGIVTFVPMQSGGMEAPGSLGSPREQTWSKVTSGMVLGDQEAPDSF
FT                   CLCLNKPWNRIETQDTGRPLEGYKQARLQALETMAEALRQRVDILTTKLDKPTSPDTSG
FT                   DLASDVLPLCPSTAPATPTLVPPSYLRTLMSKGGRESPRDLVDSQAEPLLLSTCFQDGE
FT                   MLPWSPSWELPNPNLGTHIESQPQGPVSSTPASVSQVIPHTQSCPAGSSSHGALSKEAI
FT                   QGLEKKLQREMATLQALGACMKSSLGMPDAPDPTRGSLWQEEMPEVKKEGLVTPWTTRS
FT                   CGKGEPADRPWAGWSGGQGGLPWASSTA"
FT   gene            23038195..23066478
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /note="gene_id=mCG18763.2"
FT   mRNA            join(23038195..23038331,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23058099..23058278,
FT                   23062296..23062452,23062845..23063053,23064502..23065931)
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), transcript variant mCT174287"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174287.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(<23038201..23038331,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23062296..23062452,
FT                   23062845..23063053,23064502..23065931)
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), transcript variant mCT190102"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT190102.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23038201..23038331,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23062296..23062452,
FT                   23062845..23063053,23064502..23064708)
FT                   /codon_start=1
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), isoform CRA_c"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT190102.0
FT                   protein_id=mCP111111.0 isoform=CRA_c"
FT                   /protein_id="EDL08299.1"
FT                   /translation="ADRQADGRRAGRCSCSARPRLMASPAPPVAEELPGPASRRLYSRM
FT                   EASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLKEYA
FT                   RALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAIVCCQRHLDIAQEQGDK
FT                   VGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRETLHRASEFYERNLSLVKELGD
FT                   RAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHIFLG
FT                   RFDVAAEHYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLVIAQEL
FT                   ADRVGEGRACWSLGNAYVSMGSPAQALTFAKKHLQISQEIGDRNGELTARMNIAHLQLA
FT                   LGRLTSPAAAEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLDRGIPRAPSSDEECFF
FT                   DLLSKFQSSRMDDQRCPLEEGQAGAAEATAAPSVEDRAAQSSVTASPQTEEFFDLIASS
FT                   QSRRLDDQRASVGSLPGLRITLNNVGHLRGDGDAQEPGDEFFNMLIKYQSSRIDDQRCP
FT                   PPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGSPEQEASGLPDPQQQCPPGAS"
FT   CDS             join(23038264..23038331,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23058099..23058278,
FT                   23062296..23062452,23062845..23063053,23064502..23064708)
FT                   /codon_start=1
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), isoform CRA_e"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174287.0
FT                   protein_id=mCP97207.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q6IR34"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024804"
FT                   /db_xref="MGI:MGI:1915089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6IR34"
FT                   /protein_id="EDL08301.1"
FT                   /translation="MASPAPPVAEELPGPASRRLYSRMEASCLELALEGERLCKAGDFK
FT                   AGVAFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLKEYARALQFHKHDLLLARTIGDRMG
FT                   EAKASGNLGNTLKVLGRFDEAIVCCQRHLDIAQEQGDKVGEARALYNIGNVYHAKGKQL
FT                   SWNAAQDPGHLPPDVRETLHRASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNF
FT                   TEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHIFLGRFDVAAEHYKKTLQLSRQLRD
FT                   QAVEAQACYSLGNTYTLLQDYERAAEYHLRHLVIAQELADRVGEGRACWSLGNAYVSMG
FT                   SPAQALTFAKKHLQISQEIGDRNGELTARMNIAHLQLALGRLTSPAAAEKPDLAGYEAQ
FT                   GARPKRTQRLSAETWDLLRLPLDREQNGETHHTGDWRGPGRDSLPLPMRSRKYQEGPDA
FT                   IERRPREGSHSPLDSADVRVQVPRTGIPRAPSSDEECFFDLLSKFQSSRMDDQRCPLEE
FT                   GQAGAAEATAAPSVEDRAAQSSVTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRI
FT                   TLNNVGHLRGDGDAQEPGDEFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLI
FT                   QRVQAKRMDEQRVDLAGSPEQEASGLPDPQQQCPPGAS"
FT   mRNA            join(23042725..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23049164..23049272,23050242..23050365,
FT                   23057330..23057400,23058099..23058278,23062296..23062452,
FT                   23062845..23063053,23064502..23065931)
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), transcript variant mCT174288"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174288.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(23042729..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23058099..23058278,
FT                   23062296..23062452,23062845..23063053,23064502..23066478)
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), transcript variant mCT15160"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT15160.1 created
FT                   on 08-OCT-2002"
FT   mRNA            join(23042729..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047802,23064725..23065931)
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), transcript variant mCT174286"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174286.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(23042813..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047802,23064725..23064753)
FT                   /codon_start=1
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), isoform CRA_a"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174286.0
FT                   protein_id=mCP97205.0 isoform=CRA_a"
FT                   /protein_id="EDL08297.1"
FT                   /translation="MLASAMEGQPLALSLAEKAVCKVVYGAPRPRPLLLPVGLELWLYV
FT                   QKMRNLQRKRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTEDLKTLSAIYSQL
FT                   GNAYFYLKEYARALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAIVCCQR
FT                   HLDIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRETLHRASEFYE
FT                   RNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAY
FT                   TSHTLLWTL"
FT   CDS             join(23042813..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23048287..23048442,23049164..23049272,
FT                   23050242..23050365,23057330..23057400,23058099..23058278,
FT                   23062296..23062452,23062845..23063053,23064502..23064708)
FT                   /codon_start=1
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), isoform CRA_d"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT15160.1
FT                   protein_id=mCP19517.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q6IR34"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024804"
FT                   /db_xref="MGI:MGI:1915089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6IR34"
FT                   /protein_id="EDL08300.1"
FT                   /translation="MLASAMEGQPLALSLAEKAVCKVVYGAPRPRPLLLPVGLELWLYV
FT                   QKMRNLQRKRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTEDLKTLSAIYSQL
FT                   GNAYFYLKEYARALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAIVCCQR
FT                   HLDIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRETLHRASEFYE
FT                   RNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAY
FT                   SNLGNAHIFLGRFDVAAEHYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEY
FT                   HLRHLVIAQELADRVGEGRACWSLGNAYVSMGSPAQALTFAKKHLQISQEIGDRNGELT
FT                   ARMNIAHLQLALGRLTSPAAAEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLDREQN
FT                   GETHHTGDWRGPGRDSLPLPMRSRKYQEGPDAIERRPREGSHSPLDSADVRVQVPRTGI
FT                   PRAPSSDEECFFDLLSKFQSSRMDDQRCPLEEGQAGAAEATAAPSVEDRAAQSSVTASP
FT                   QTEEFFDLIASSQSRRLDDQRASVGSLPGLRITLNNVGHLRGDGDAQEPGDEFFNMLIK
FT                   YQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGSPEQEASGLP
FT                   DPQQQCPPGAS"
FT   CDS             join(23042813..23042976,23045364..23045585,
FT                   23046458..23046593,23046839..23046981,23047363..23047486,
FT                   23047748..23047863,23049164..23049272,23050242..23050365,
FT                   23057330..23057400,23058099..23058278,23062296..23062452,
FT                   23062845..23063053,23064502..23064708)
FT                   /codon_start=1
FT                   /gene="Gpsm1"
FT                   /locus_tag="mCG_18763"
FT                   /product="G-protein signalling modulator 1 (AGS3-like, C.
FT                   elegans), isoform CRA_b"
FT                   /note="gene_id=mCG18763.2 transcript_id=mCT174288.0
FT                   protein_id=mCP97206.0 isoform=CRA_b"
FT                   /protein_id="EDL08298.1"
FT                   /translation="MLASAMEGQPLALSLAEKAVCKVVYGAPRPRPLLLPVGLELWLYV
FT                   QKMRNLQRKRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTEDLKTLSAIYSQL
FT                   GNAYFYLKEYARALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAIVCCQR
FT                   HLDIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRETLHRASEFYE
FT                   RNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAY
FT                   SNLGNAHIFLGRFDVAAEHYKVGEGRACWSLGNAYVSMGSPAQALTFAKKHLQISQEIG
FT                   DRNGELTARMNIAHLQLALGRLTSPAAAEKPDLAGYEAQGARPKRTQRLSAETWDLLRL
FT                   PLDREQNGETHHTGDWRGPGRDSLPLPMRSRKYQEGPDAIERRPREGSHSPLDSADVRV
FT                   QVPRTGIPRAPSSDEECFFDLLSKFQSSRMDDQRCPLEEGQAGAAEATAAPSVEDRAAQ
FT                   SSVTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITLNNVGHLRGDGDAQEPGDE
FT                   FFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGSPE
FT                   QEASGLPDPQQQCPPGAS"
FT   gene            complement(23067087..23077200)
FT                   /locus_tag="mCG_128376"
FT                   /note="gene_id=mCG128376.0"
FT   mRNA            complement(join(23067087..23068253,23069030..23069169,
FT                   23069468..23069552,23070181..23070257,23070637..23070710,
FT                   23072053..23072086,23072526..23072567,23073029..23073220,
FT                   23073245..23073337,23074454..23074579,23074881..23075024,
FT                   23075161..23075340,23075499..23075656,23076455..23076592,
FT                   23077005..23077200))
FT                   /locus_tag="mCG_128376"
FT                   /product="mCG128376"
FT                   /note="gene_id=mCG128376.0 transcript_id=mCT129672.0
FT                   created on 08-OCT-2002"
FT   CDS             complement(join(23068100..23068253,23069030..23069169,
FT                   23069468..23069552,23070181..23070257,23070637..23070710,
FT                   23072053..23072086,23072526..23072567,23073029..23073220,
FT                   23073245..23073337,23074454..23074579,23074881..23075024,
FT                   23075161..23075340,23075499..23075656,23076455..23076592,
FT                   23077005..23077188))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128376"
FT                   /product="mCG128376"
FT                   /note="gene_id=mCG128376.0 transcript_id=mCT129672.0
FT                   protein_id=mCP50835.1"
FT                   /protein_id="EDL08302.1"
FT                   /translation="MSDYENDDECWSTLESFRVKLISVIDPSRITPYLRQCKVLNPDDE
FT                   EQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYRKVTGKEPARVFS
FT                   MIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVDR
FT                   LRHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKDLLQARVQELQVSVQEG
FT                   KLDRNSPYIQVLEEDWRQALQEHQKQVSTIFSLRKDLRQAETLRARCTEEKEMFELQCL
FT                   ALRKDAKMYKDRIEAILLQMEEVSIERDQQFQPYTRVVDVQPGPELPNESQEHQPGPLL
FT                   RAMASREELHAQCTQSFQDKDKLRKLVRELGEKADELQLQLFQTESRLLAAEGRLKQQQ
FT                   LDMLILSSDLEDSSPRNSQEDLEEDAQLSDKGVLADRESPEQPFMALNKEHLSLTHGMG
FT                   PSSSEPPEKERRRLKESFENYRSSSSAPGSGRAAALGRVEADHYQLVYTCKVCGTRSSK
FT                   RISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLKGKRNIEEILAARGEEVRRVSGDG
FT                   ALELILEAAVPPDTPEGDEDPPNPGKMGQS"
FT   gene            complement(23080408..23098303)
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /note="gene_id=mCG128370.1"
FT   mRNA            complement(join(23080408..23080661,23081279..23081433,
FT                   23082261..23083678,23084050..23084077,23084832..23084942,
FT                   23085376..23085446,23085785..23086049,23086780..23087253,
FT                   23087553..23087632,23088427..23088521,23090386..23090480,
FT                   23090628..23090734,23090972..23091119,23091674..23091838,
FT                   23092145..23092217,23092296..23092400,23093261..23093342,
FT                   23093808..23093886,23094253..23094378,23094522..23094689,
FT                   23095674..23095720,23096147..23096289,23098200..23098303))
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, transcript variant mCT129666"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT129666.1
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(23080415..23080661,23081279..23081409,
FT                   23082261..23083678,23084050..23084077,23084832..23084942,
FT                   23085376..23085446,23085785..23086049,23086780..23087253,
FT                   23087553..23087632,23088427..23088521,23090386..23090480,
FT                   23090628..23090734,23090972..23091119,23091674..23091838,
FT                   23092145..23092217,23092296..23092400,23093261..23093342,
FT                   23093808..23093886,23094253..23094378,23094522..23094689,
FT                   23095674..23095720,23095814..23095932,23096147..23096289,
FT                   23098200..>23098270))
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, transcript variant mCT190155"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT190155.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(23080416..23080661,23081279..23081409,
FT                   23082261..23083678,23084050..23084077,23084832..23084942,
FT                   23085376..23085446,23085785..23086049,23086780..23087253,
FT                   23087553..23087632,23088427..23088521,23090386..23090480,
FT                   23090628..23090734,23090972..23091119,23091674..23091838,
FT                   23092145..23092217,23092296..23092400,23093261..23093342,
FT                   23093808..23093886,23094253..23094378,23094522..23094689,
FT                   23095674..23095720,23096147..23096289,23098200..>23098271))
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, transcript variant mCT190156"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT190156.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23081299..23081409,23082261..23083678,
FT                   23084050..23084077,23084832..23084942,23085376..23085446,
FT                   23085785..23086049,23086780..23087253,23087553..23087632,
FT                   23088427..23088521,23090386..23090480,23090628..23090734,
FT                   23090972..23091119,23091674..23091838,23092145..23092217,
FT                   23092296..23092400,23093261..23093342,23093808..23093886,
FT                   23094253..23094378,23094522..23094689,23095674..23095720,
FT                   23096147..23096289,23098200..>23098222))
FT                   /codon_start=1
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, isoform CRA_c"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT190156.0
FT                   protein_id=mCP111139.0 isoform=CRA_c"
FT                   /protein_id="EDL08305.1"
FT                   /translation="SLEGMPRRQAEAMDIDAEREKITQEIQELERILYPGSTSVHFEVS
FT                   ESSLSSDSEADSLPDEDLETAGAPILEEEGSSESSNDEEDPKDKALPEDPETCLQLNMV
FT                   YQEVIREKLAEVSQLLAQNQEQQEEILFDLSGTKCPKVKDGRSLPSYMYIGHFLKPYFK
FT                   DKVTGVGPPANEETREKATQGIKAFEQLLVTKWKHWEKALLRKSVMSDRLQRLLQPKLL
FT                   KLEYLHEKQSRVSSELERQALEKQIKEAEKEIQDINQLPEEALLGNRLDSHDWEKISNI
FT                   NFEGARSAEEIRKFWQSSEHPSISKQEWSTEEVERLKAIAATHGHLEWHLVAEELGTSR
FT                   SAFQCLQKFQQYNKTLKRKEWTEEEDHMLTQLVQEMRVGNHIPYRKIVYFMEGRDSMQL
FT                   IYRWTKSLDPSLKRGFWAPEEDAKLLQAVAKYGAQDWFKIREEVPGRSDAQCRDRYIRR
FT                   LHFSLKKGRWNAKEEQQLIQLIEKYGVGHWARIASELPHRSGSQCLSKWKILARKKQHL
FT                   QRKRGQRPRHSSQWSSSGSSSSSSEDYGSSSGSDGSSGSENSDVELEASLEKSRALTPQ
FT                   QYRVPDIDLWVPTRLITSQSQREGTGCYPQHPAVSCCTQDASQNHHKEGSTTVSAAEKN
FT                   QLQVPYETHSTVPRGDRFLHFSDTHSASLKDPACKSHTLMKERPKQPLLPSSRSGSDPG
FT                   NNTAGPHLRQLWHGTYQNKQRRKRQALHRRLLKHRLLLAVIPWVGDINLACTQAPRRPA
FT                   TVQTKADSIRMQLECARLASTPVFTLLIQLLQIDTAGCMEVVRERKSQPPALLQPGTRN
FT                   TQPHLLQASSNAKNNTGCLPSMTGEQTAKRASHKGRPRLGSCRTEATPFQVPVAAPRGL
FT                   RPKPKTVSELLREKRLRESHAKKATQALGLNSQLLVSSPVILQPPLLPVPHGSPVVGPA
FT                   TSSVELSVPVAPVMVSSSPSGSWPVGGISATDKQPPNLQTISLNPPHKGTQVAAPAAFR
FT                   SLALAPGQVPTGGHLSTLGQTSTTSQKQSLPKVLPILRAAPSLTQLSVQPPVSGQPLAT
FT                   KSSLPVNWVLTTQKLLSVQVPAVVGLPQSVMTPETIGLQAKQLPSPAKTPAFLEQPPAS
FT                   TDTEPKGPQGQEIPPTPGPEKAALDLSLLSQESEAAIVTWLKGCQGAFVPPLGSRMPYH
FT                   PPSLCSLRALSSLLLQKQDLEQKASSLAASQAAGAQPDPKAGALQASLELVQRQFRDNP
FT                   AYLLLKTRFLAIFSLPAFLATLPPNSIPTTLSPDVAVVSESDSEDLGDLELKDRARQLD
FT                   CMACRVQASPAAPDPVQRAPSPGEVSAPSPLDASDGLDDLNVLRTRRARHSRR"
FT   CDS             complement(join(23081299..23081433,23082261..23083678,
FT                   23084050..23084077,23084832..23084942,23085376..23085446,
FT                   23085785..23086049,23086780..23087253,23087553..23087632,
FT                   23088427..23088521,23090386..23090480,23090628..23090734,
FT                   23090972..23091119,23091674..23091838,23092145..23092217,
FT                   23092296..23092400,23093261..23093342,23093808..23093886,
FT                   23094253..23094378,23094522..23094689,23095674..23095720,
FT                   23096147..23096289,23098200..23098210))
FT                   /codon_start=1
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, isoform CRA_a"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT129666.1
FT                   protein_id=mCP51109.1 isoform=CRA_a"
FT                   /protein_id="EDL08303.1"
FT                   /translation="MPRRQAEAMDIDAEREKITQEIQELERILYPGSTSVHFEVSESSL
FT                   SSDSEADSLPDEDLETAGAPILEEEGSSESSNDEEDPKDKALPEDPETCLQLNMVYQEV
FT                   IREKLAEVSQLLAQNQEQQEEILFDLSGTKCPKVKDGRSLPSYMYIGHFLKPYFKDKVT
FT                   GVGPPANEETREKATQGIKAFEQLLVTKWKHWEKALLRKSVMSDRLQRLLQPKLLKLEY
FT                   LHEKQSRVSSELERQALEKQIKEAEKEIQDINQLPEEALLGNRLDSHDWEKISNINFEG
FT                   ARSAEEIRKFWQSSEHPSISKQEWSTEEVERLKAIAATHGHLEWHLVAEELGTSRSAFQ
FT                   CLQKFQQYNKTLKRKEWTEEEDHMLTQLVQEMRVGNHIPYRKIVYFMEGRDSMQLIYRW
FT                   TKSLDPSLKRGFWAPEEDAKLLQAVAKYGAQDWFKIREEVPGRSDAQCRDRYIRRLHFS
FT                   LKKGRWNAKEEQQLIQLIEKYGVGHWARIASELPHRSGSQCLSKWKILARKKQHLQRKR
FT                   GQRPRHSSQWSSSGSSSSSSEDYGSSSGSDGSSGSENSDVELEASLEKSRALTPQQYRV
FT                   PDIDLWVPTRLITSQSQREGTGCYPQHPAVSCCTQDASQNHHKEGSTTVSAAEKNQLQV
FT                   PYETHSTVPRGDRFLHFSDTHSASLKDPACKSHTLMKERPKQPLLPSSRSGSDPGNNTA
FT                   GPHLRQLWHGTYQNKQRRKRQALHRRLLKHRLLLAVIPWVGDINLACTQAPRRPATVQT
FT                   KADSIRMQLECARLASTPVFTLLIQLLQIDTAGCMEVVRERKSQPPALLQPGTRNTQPH
FT                   LLQASSNAKNNTGCLPSMTGEQTAKRASHKGRPRLGSCRTEATPFQVPVAAPRGLRPKP
FT                   KTVSELLREKRLRESHAKKATQALGLNSQLLVSSPVILQPPLLPVPHGSPVVGPATSSV
FT                   ELSVPVAPVMVSSSPSGSWPVGGISATDKQPPNLQTISLNPPHKGTQVAAPAAFRSLAL
FT                   APGQVPTGGHLSTLGQTSTTSQKQSLPKVLPILRAAPSLTQLSVQPPVSGQPLATKSSL
FT                   PVNWVLTTQKLLSVQVPAVVGLPQSVMTPETIGLQAKQLPSPAKTPAFLEQPPASTDTE
FT                   PKGPQGQEIPPTPGPEKAALDLSLLSQESEAAIVTWLKGCQGAFVPPLGSRMPYHPPSL
FT                   CSLRALSSLLLQKQDLEQKASSLAASQAAGAQPDPKAGALQASLELVQRQFRDNPAYLL
FT                   LKTRFLAIFSLPAFLATLPPNSIPTTLSPDVAVVSESDSEDLGDLELKDRARQLDCMAC
FT                   RVQASPAAPDPVQSHLVSPGQRAPSPGEVSAPSPLDASDGLDDLNVLRTRRARHSRR"
FT   CDS             complement(join(23081299..23081409,23082261..23083678,
FT                   23084050..23084077,23084832..23084942,23085376..23085446,
FT                   23085785..23086049,23086780..23087253,23087553..23087632,
FT                   23088427..23088521,23090386..23090480,23090628..23090734,
FT                   23090972..23091119,23091674..23091838,23092145..23092217,
FT                   23092296..23092400,23093261..23093342,23093808..23093886,
FT                   23094253..23094378,23094522..23094689,23095674..23095720,
FT                   23095814..>23095907))
FT                   /codon_start=1
FT                   /gene="Snapc4"
FT                   /locus_tag="mCG_128370"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   4, isoform CRA_b"
FT                   /note="gene_id=mCG128370.1 transcript_id=mCT190155.0
FT                   protein_id=mCP111138.0 isoform=CRA_b"
FT                   /protein_id="EDL08304.1"
FT                   /translation="ILVGRRGPRAQPINLNSLHGPDTQNFVPEHSNSLPDEDLETAGAP
FT                   ILEEEGSSESSNDEEDPKDKALPEDPETCLQLNMVYQEVIREKLAEVSQLLAQNQEQQE
FT                   EILFDLSGTKCPKVKDGRSLPSYMYIGHFLKPYFKDKVTGVGPPANEETREKATQGIKA
FT                   FEQLLVTKWKHWEKALLRKSVMSDRLQRLLQPKLLKLEYLHEKQSRVSSELERQALEKQ
FT                   IKEAEKEIQDINQLPEEALLGNRLDSHDWEKISNINFEGARSAEEIRKFWQSSEHPSIS
FT                   KQEWSTEEVERLKAIAATHGHLEWHLVAEELGTSRSAFQCLQKFQQYNKTLKRKEWTEE
FT                   EDHMLTQLVQEMRVGNHIPYRKIVYFMEGRDSMQLIYRWTKSLDPSLKRGFWAPEEDAK
FT                   LLQAVAKYGAQDWFKIREEVPGRSDAQCRDRYIRRLHFSLKKGRWNAKEEQQLIQLIEK
FT                   YGVGHWARIASELPHRSGSQCLSKWKILARKKQHLQRKRGQRPRHSSQWSSSGSSSSSS
FT                   EDYGSSSGSDGSSGSENSDVELEASLEKSRALTPQQYRVPDIDLWVPTRLITSQSQREG
FT                   TGCYPQHPAVSCCTQDASQNHHKEGSTTVSAAEKNQLQVPYETHSTVPRGDRFLHFSDT
FT                   HSASLKDPACKSHTLMKERPKQPLLPSSRSGSDPGNNTAGPHLRQLWHGTYQNKQRRKR
FT                   QALHRRLLKHRLLLAVIPWVGDINLACTQAPRRPATVQTKADSIRMQLECARLASTPVF
FT                   TLLIQLLQIDTAGCMEVVRERKSQPPALLQPGTRNTQPHLLQASSNAKNNTGCLPSMTG
FT                   EQTAKRASHKGRPRLGSCRTEATPFQVPVAAPRGLRPKPKTVSELLREKRLRESHAKKA
FT                   TQALGLNSQLLVSSPVILQPPLLPVPHGSPVVGPATSSVELSVPVAPVMVSSSPSGSWP
FT                   VGGISATDKQPPNLQTISLNPPHKGTQVAAPAAFRSLALAPGQVPTGGHLSTLGQTSTT
FT                   SQKQSLPKVLPILRAAPSLTQLSVQPPVSGQPLATKSSLPVNWVLTTQKLLSVQVPAVV
FT                   GLPQSVMTPETIGLQAKQLPSPAKTPAFLEQPPASTDTEPKGPQGQEIPPTPGPEKAAL
FT                   DLSLLSQESEAAIVTWLKGCQGAFVPPLGSRMPYHPPSLCSLRALSSLLLQKQDLEQKA
FT                   SSLAASQAAGAQPDPKAGALQASLELVQRQFRDNPAYLLLKTRFLAIFSLPAFLATLPP
FT                   NSIPTTLSPDVAVVSESDSEDLGDLELKDRARQLDCMACRVQASPAAPDPVQRAPSPGE
FT                   VSAPSPLDASDGLDDLNVLRTRRARHSRR"
FT   gene            <23083135..23088621
FT                   /locus_tag="mCG_145918"
FT                   /note="gene_id=mCG145918.0"
FT   mRNA            join(<23083135..23083348,23085617..23085929,
FT                   23087242..23088621)
FT                   /locus_tag="mCG_145918"
FT                   /product="mCG145918"
FT                   /note="gene_id=mCG145918.0 transcript_id=mCT186026.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<23083135..23083348,23085617..23085795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145918"
FT                   /product="mCG145918"
FT                   /note="gene_id=mCG145918.0 transcript_id=mCT186026.0
FT                   protein_id=mCP107419.0"
FT                   /protein_id="EDL08306.1"
FT                   /translation="VCPRVLRWPPVGTCPGAKARLLKAAGAATWVPLWGGFREMVCRLG
FT                   GCLSVAEIPPTGQEPEGLELTITGATGRVAQLLVLKLFRDSPACPSQTCPPKDPFRILC
FT                   YGSRSGTCSHPGSRKFPKVLWAVPLV"
FT   gene            complement(23100358..23106983)
FT                   /locus_tag="mCG_18732"
FT                   /note="gene_id=mCG18732.2"
FT   mRNA            complement(join(23100358..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106168..23106236,
FT                   23106592..23106741,23106825..23106983))
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, transcript variant mCT15029"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT15029.2 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(23100479..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106168..23106236,
FT                   23106825..>23106964))
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, transcript variant mCT190116"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT190116.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23100542..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106825..23106960))
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, transcript variant mCT174285"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT174285.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(23101274..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106168..23106236,
FT                   23106825..>23106903))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, isoform CRA_b"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT190116.0
FT                   protein_id=mCP111109.0 isoform=CRA_b"
FT                   /protein_id="EDL08308.1"
FT                   /translation="GAAMSGYARRQGAPPLSRTRSLVVPDGFGYGKGKCTNQGPSGAPE
FT                   TRFGGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPKEASRHPLGLEHSSPAS
FT                   QLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYL
FT                   SFFSNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISY
FT                   EALKDENSKLRRKLNEVQSFSETQTEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQN
FT                   LELMTKRAVKAENHVLKLKQEINLLQAQLSNLRRENEALRSGQGASLSVVKQNTDVALQ
FT                   NLHLVMNSAHASIKQLVSGADTLNLVAEILKSIDRISEVKDEVDS"
FT   CDS             complement(join(23101274..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106825..23106894))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, isoform CRA_a"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT174285.0
FT                   protein_id=mCP97204.0 isoform=CRA_a"
FT                   /protein_id="EDL08307.1"
FT                   /translation="MSGYARRQGAPPLSRTRSLVVPDGDKLEDLEEANPFSFKEFLKTK
FT                   NLSLSKEDTTTSRIYPKEASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEED
FT                   EDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSR
FT                   ISPASPAGSPNADFAAHEESLGDRHLRTLQISYEALKDENSKLRRKLNEVQSFSETQTE
FT                   MVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVLKLKQEINLLQ
FT                   AQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIKQLVSGADTLNLV
FT                   AEILKSIDRISEVKDEVDS"
FT   CDS             complement(join(23101274..23101370,23102358..23102497,
FT                   23102759..23102821,23103174..23103285,23103666..23103739,
FT                   23104580..23104987,23105232..23105347,23106168..23106236,
FT                   23106592..23106741,23106825..23106894))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18732"
FT                   /product="mCG18732, isoform CRA_c"
FT                   /note="gene_id=mCG18732.2 transcript_id=mCT15029.2
FT                   protein_id=mCP19659.2 isoform=CRA_c"
FT                   /protein_id="EDL08309.1"
FT                   /translation="MSGYARRQGAPPLSRTRSLVVPDAPAFYERRSCLPQLDCERPHGG
FT                   DLHPHLFGFRPTFMCYVPSPVLASVGDTGFGYGKGKCTNQGPSGAPETRFGGDKLEDLE
FT                   EANPFSFKEFLKTKNLSLSKEDTTTSRIYPKEASRHPLGLEHSSPASQLMGYGLESQQP
FT                   FFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACP
FT                   ESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEALKDENSKLRR
FT                   KLNEVQSFSETQTEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAE
FT                   NHVLKLKQEINLLQAQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHAS
FT                   IKQLVSGADTLNLVAEILKSIDRISEVKDEVDS"
FT   gene            23103228..>23105473
FT                   /locus_tag="mCG_142674"
FT                   /note="gene_id=mCG142674.0"
FT   mRNA            join(23103228..23103306,23104429..23104765,
FT                   23105274..>23105473)
FT                   /locus_tag="mCG_142674"
FT                   /product="mCG142674"
FT                   /note="gene_id=mCG142674.0 transcript_id=mCT181598.0
FT                   created on 26-MAR-2003"
FT   CDS             23105312..>23105473
FT                   /codon_start=1
FT                   /locus_tag="mCG_142674"
FT                   /product="mCG142674"
FT                   /note="gene_id=mCG142674.0 transcript_id=mCT181598.0
FT                   protein_id=mCP104520.0"
FT                   /protein_id="EDL08310.1"
FT                   /translation="MDWLLQGLQVCHLKKRTPQKTVKGPNILCYHHVSTVTQRTLQNMR
FT                   AAKEVREYA"
FT   gene            23107022..23114797
FT                   /gene="Pmpca"
FT                   /locus_tag="mCG_18769"
FT                   /note="gene_id=mCG18769.2"
FT   mRNA            join(23107022..23107108,23107612..23107814,
FT                   23107907..23107986,23108171..23108253,23108760..23108854,
FT                   23109542..23109642,23110088..23110351,23110582..23110674,
FT                   23110762..23110880,23110973..23111063,23111194..23111256,
FT                   23112701..23112845,23113095..23114797)
FT                   /gene="Pmpca"
FT                   /locus_tag="mCG_18769"
FT                   /product="peptidase (mitochondrial processing) alpha,
FT                   transcript variant mCT15167"
FT                   /note="gene_id=mCG18769.2 transcript_id=mCT15167.2 created
FT                   on 01-MAY-2003"
FT   mRNA            join(23107022..23107108,23107612..23107814,
FT                   23107907..23107986,23108171..23108253,23108760..23108854,
FT                   23109542..23109642,23110088..23110351,23110582..23110674,
FT                   23110762..23110880,23110973..23111063,23111194..23111618)
FT                   /gene="Pmpca"
FT                   /locus_tag="mCG_18769"
FT                   /product="peptidase (mitochondrial processing) alpha,
FT                   transcript variant mCT182085"
FT                   /note="gene_id=mCG18769.2 transcript_id=mCT182085.0 created
FT                   on 01-MAY-2003"
FT   CDS             join(23107041..23107108,23107612..23107814,
FT                   23107907..23107986,23108171..23108253,23108760..23108854,
FT                   23109542..23109642,23110088..23110351,23110582..23110674,
FT                   23110762..23110880,23110973..23111063,23111194..23111256,
FT                   23112701..23112845,23113095..23113264)
FT                   /codon_start=1
FT                   /gene="Pmpca"
FT                   /locus_tag="mCG_18769"
FT                   /product="peptidase (mitochondrial processing) alpha,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18769.2 transcript_id=mCT15167.2
FT                   protein_id=mCP19605.2 isoform=CRA_b"
FT                   /protein_id="EDL08312.1"
FT                   /translation="MATAVWAAARLLRGSAVLCARPRFGSPAHRRFSSGATYPNIPLSS
FT                   PLPGVPKPIFATVDGQEKFETKVTTLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYL
FT                   SGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGICDCQTSRDTTMYAVSADSKGLDTVV
FT                   DLLADVVLHPRLTDEEIEMTRMAVQFELEDLNMRPDPEPLLTEMIHEAAFRENTVGLHR
FT                   FCPVENIAKIDREVLHSYLKNYYTPDRMVLAGVGVEHEHLVECARKYLVGAEPAWGAPG
FT                   TVDVDRSVAQYTGGIIKVERDMSNVSLGPTPIPELTHIMVGLESCSFLEDDFIPFAVLN
FT                   MMMGGGGSFSAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQ
FT                   VREMVEIITKEFILMGRTVDLVELERAKTQLMSMLMMNLESRPVIFEDVGRQVLATHSR
FT                   KLPHELCTLIRNVKPEDIKRVASKMLRGKPAVAALGDLTDLPTYEHIQAALSSRNGHLP
FT                   RSYRLFR"
FT   CDS             join(23107041..23107108,23107612..23107814,
FT                   23107907..23107986,23108171..23108253,23108760..23108854,
FT                   23109542..23109642,23110088..23110351,23110582..23110674,
FT                   23110762..23110880,23110973..23111063,23111194..23111322)
FT                   /codon_start=1
FT                   /gene="Pmpca"
FT                   /locus_tag="mCG_18769"
FT                   /product="peptidase (mitochondrial processing) alpha,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18769.2 transcript_id=mCT182085.0
FT                   protein_id=mCP105007.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AIW9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="MGI:MGI:1918568"
FT                   /db_xref="UniProtKB/TrEMBL:A2AIW9"
FT                   /protein_id="EDL08311.1"
FT                   /translation="MATAVWAAARLLRGSAVLCARPRFGSPAHRRFSSGATYPNIPLSS
FT                   PLPGVPKPIFATVDGQEKFETKVTTLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYL
FT                   SGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGICDCQTSRDTTMYAVSADSKGLDTVV
FT                   DLLADVVLHPRLTDEEIEMTRMAVQFELEDLNMRPDPEPLLTEMIHEAAFRENTVGLHR
FT                   FCPVENIAKIDREVLHSYLKNYYTPDRMVLAGVGVEHEHLVECARKYLVGAEPAWGAPG
FT                   TVDVDRSVAQYTGGIIKVERDMSNVSLGPTPIPELTHIMVGLESCSFLEDDFIPFAVLN
FT                   MMMGGGGSFSAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQ
FT                   VREMVEIITKEFILMGRTVDLVRPGASCAPDVASHSAERATG"
FT   gene            complement(23113927..23126918)
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /note="gene_id=mCG18761.2"
FT   mRNA            complement(join(23113927..23115647,23116232..23116368,
FT                   23116909..23117250,23117712..23117819,23118562..23118686,
FT                   23119277..23119374,23119776..23119899,23125481..23126918))
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E,
FT                   transcript variant mCT185193"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT185193.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(23113927..23115647,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..23119374,
FT                   23119776..23119899,23125481..23126918))
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E,
FT                   transcript variant mCT15158"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT15158.2 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(23114733..23115647,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..23119461,
FT                   23119776..23119899,23125481..>23126898))
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E,
FT                   transcript variant mCT190100"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT190100.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23114977..23115600,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..23119374,
FT                   23119776..23119899,23125481..23126523,23126716..23126842))
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E,
FT                   transcript variant mCT185192"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT185192.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(23115515..23115647,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..23119374,
FT                   23119776..23119899,23125481..23126301))
FT                   /codon_start=1
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT15158.2
FT                   protein_id=mCP19496.2 isoform=CRA_c"
FT                   /protein_id="EDL08315.1"
FT                   /translation="MPSKSACLRHTEAPGQLEGRMLQGQPPNTEKKLIPTPGFLPASDS
FT                   QGSETNPMPPFSIPAKTSNQNPQTKANLITPQPPIRPKLERTLSLDDKGWRRRRFRGSQ
FT                   EDLTVQNGASPCRGSLQDSVAQSPAYSRPLPCLSTSLQEIPKSRRATGSEGGSPSLWSD
FT                   CLSGMISTSLDLLHRDAASGGPPSRLASLHASHTPPAMDLSIASSSLRTANKVDPEHTD
FT                   YKLRMQTRLVRAHSNLGPSRPRSPLAGDDHSIHSARSFSLLAPIRTKDIRSRSYLEGSL
FT                   LASGALLGAEELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIG
FT                   IQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTR
FT                   IVSQIKTKGALGVSFTFFGTSFLFITSHFTSGDGKVAERLLDYSRTIQALALPRNVPDT
FT                   NPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQKPEVDVLALLQHDQLTREM
FT                   KKGSIFRGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYKSRHKGDICPMKY
FT                   SSCPGIKTSDHRPVYGLFQVKVRPGRDNIPLAAGKFDRELYLIGIKRRISKEIQRQEAL
FT                   KSQSSSAVCTVS"
FT   CDS             complement(join(23115515..23115647,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..>23119416))
FT                   /codon_start=1
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT190100.0
FT                   protein_id=mCP111110.0 isoform=CRA_b"
FT                   /protein_id="EDL08314.1"
FT                   /translation="GNPAVLTVLWSSPQELPASLDEFLLPTEADYTQDLYVIGIQEGCS
FT                   DRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTRIVSQIK
FT                   TKGALGVSFTFFGTSFLFITSHFTSGDGKVAERLLDYSRTIQALALPRNVPDTNPYRSS
FT                   AGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQKPEVDVLALLQHDQLTREMKKGSIF
FT                   RGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYKSRHKGDICPMKYSSCPGI
FT                   KTSDHRPVYGLFQVKVRPGRDNIPLAAGKFDRELYLIGIKRRISKEIQRQEALKSQSSS
FT                   AVCTVS"
FT   CDS             complement(join(23115594..23115600,23116232..23116368,
FT                   23116909..23117024,23117089..23117250,23117712..23117819,
FT                   23118049..23118168,23118562..23118686,23119277..23119374,
FT                   23119776..23119899,23125481..23126301))
FT                   /codon_start=1
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT185192.0
FT                   protein_id=mCP106450.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AIX0"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:1927753"
FT                   /db_xref="UniProtKB/TrEMBL:A2AIX0"
FT                   /protein_id="EDL08313.1"
FT                   /translation="MPSKSACLRHTEAPGQLEGRMLQGQPPNTEKKLIPTPGFLPASDS
FT                   QGSETNPMPPFSIPAKTSNQNPQTKANLITPQPPIRPKLERTLSLDDKGWRRRRFRGSQ
FT                   EDLTVQNGASPCRGSLQDSVAQSPAYSRPLPCLSTSLQEIPKSRRATGSEGGSPSLWSD
FT                   CLSGMISTSLDLLHRDAASGGPPSRLASLHASHTPPAMDLSIASSSLRTANKVDPEHTD
FT                   YKLRMQTRLVRAHSNLGPSRPRSPLAGDDHSIHSARSFSLLAPIRTKDIRSRSYLEGSL
FT                   LASGALLGAEELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIG
FT                   IQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTR
FT                   IVSQIKTKGALGVSFTFFGTSFLFITSHFTSGDGKVAERLLDYSRTIQALALPRNVPDT
FT                   NPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQKPEVDVLALLQHDQLTREM
FT                   KKGSIFRGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYKSRHKGDICPMKY
FT                   SSCPGIKTSDHRPVYGLFQVKVRPGRDKN"
FT   CDS             complement(join(23117003..23117250,23117712..23117819,
FT                   23118562..23118686,23119277..23119374,23119776..23119899,
FT                   23125481..23126301))
FT                   /codon_start=1
FT                   /gene="Inpp5e"
FT                   /locus_tag="mCG_18761"
FT                   /product="inositol polyphosphate-5-phosphatase E, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG18761.2 transcript_id=mCT185193.0
FT                   protein_id=mCP106451.0 isoform=CRA_d"
FT                   /protein_id="EDL08316.1"
FT                   /translation="MPSKSACLRHTEAPGQLEGRMLQGQPPNTEKKLIPTPGFLPASDS
FT                   QGSETNPMPPFSIPAKTSNQNPQTKANLITPQPPIRPKLERTLSLDDKGWRRRRFRGSQ
FT                   EDLTVQNGASPCRGSLQDSVAQSPAYSRPLPCLSTSLQEIPKSRRATGSEGGSPSLWSD
FT                   CLSGMISTSLDLLHRDAASGGPPSRLASLHASHTPPAMDLSIASSSLRTANKVDPEHTD
FT                   YKLRMQTRLVRAHSNLGPSRPRSPLAGDDHSIHSARSFSLLAPIRTKDIRSRSYLEGSL
FT                   LASGALLGAEELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIG
FT                   IQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIWFCSAGDGKVAERL
FT                   LDYSRTIQALALPRNVPDTNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQ
FT                   KPEVDVLALLQHDQLTREMKKGEWPEEQHLRHGRPSLTLLCCRVHLQGL"
FT   gene            complement(23127146..>23157267)
FT                   /gene="AU024582"
FT                   /locus_tag="mCG_18731"
FT                   /note="gene_id=mCG18731.3"
FT   mRNA            complement(join(23127146..23128667,23130628..23130705,
FT                   23132163..23132237,23133099..23133193,23133426..23133563,
FT                   23133909..23134020,23134163..23134219,23134426..23134503,
FT                   23137451..23137600,23139204..23139286,23139838..23140083,
FT                   23141284..23141467,23141713..23141826,23142247..23142387,
FT                   23143024..23143129,23143306..23143417,23143597..23143714,
FT                   23143910..23143991,23144281..23144378,23145970..23146215,
FT                   23146645..23146783,23146892..23146953,23147204..23147346,
FT                   23147907..23148081,23148224..23148422,23148935..23149058,
FT                   23151160..23151257,23153745..23153881,23156224..23157136))
FT                   /gene="AU024582"
FT                   /locus_tag="mCG_18731"
FT                   /product="expressed sequence AU024582, transcript variant
FT                   mCT15027"
FT                   /note="gene_id=mCG18731.3 transcript_id=mCT15027.2 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(23127152..23128667,23130628..23130705,
FT                   23132163..23132237,23133099..23133193,23133426..23133563,
FT                   23133909..23134020,23134163..23134219,23134426..23134503,
FT                   23137451..23137600,23139204..23139286,23139838..23140083,
FT                   23141284..23141467,23141713..23141826,23142247..23142387,
FT                   23143024..23143129,23143306..23143417,23143597..23143714,
FT                   23143910..23143991,23144281..23144378,23145970..23146071,
FT                   23156617..>23157267))
FT                   /gene="AU024582"
FT                   /locus_tag="mCG_18731"
FT                   /product="expressed sequence AU024582, transcript variant
FT                   mCT190111"
FT                   /note="gene_id=mCG18731.3 transcript_id=mCT190111.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23128599..23128667,23130628..23130705,
FT                   23132163..23132237,23133099..23133193,23133426..23133563,
FT                   23133909..23134020,23134163..23134219,23134426..23134503,
FT                   23137451..23137600,23139204..23139286,23139838..23140083,
FT                   23141284..23141467,23141713..23141826,23142247..23142387,
FT                   23143024..23143129,23143306..23143417,23143597..23143714,
FT                   23143910..23143991,23144281..23144378,23145970..23146071,
FT                   23156617..>23157267))
FT                   /codon_start=1
FT                   /gene="AU024582"
FT                   /locus_tag="mCG_18731"
FT                   /product="expressed sequence AU024582, isoform CRA_b"
FT                   /note="gene_id=mCG18731.3 transcript_id=mCT190111.0
FT                   protein_id=mCP111108.0 isoform=CRA_b"
FT                   /protein_id="EDL08318.1"
FT                   /translation="QSYNLAQPINFSVSLLNPNEKNQSWGDAVVGERSIVSNNWALGGD
FT                   PEERAALSGVPASAVTGASLPSSIPQNCAPQGSGSSEMIASQSASWLVQQLSPQTPQSP
FT                   HPNAEKGPSEFVSSPAGNTSVMLVPPASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTL
FT                   ENPVRMYSPSPSDGPASQQPLPNHPRQSGPGLHNQDHFYQQVTKDAQDQHRLERAQLSF
FT                   LTDSQTVTTSVLEKETERFRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARV
FT                   MTRFANSLPINDPLQTVYQLMSGRMPAASTCCGDEKWGDWRPHLAMVLSNLNNNMDVES
FT                   RTMATMGDTLASKGLLDAAHFCYLMAQVGFGVYTKKTTKLVLIGSNHSLPFLKFATNEA
FT                   IQRTEAYEYAQSLGAHTCSLPNFQVFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPG
FT                   AYSPVLISQLTQMASQLRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQEGTVLWSQD
FT                   GTEPQQCRITSGSEVEQSDGPGLNQQAGPQADNPLLMPSTEPLMHGVQLLPTAPQTLPD
FT                   GQPAHLSRVPMFPVPMSRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLS
FT                   LQESGLPPQEAKSPDPEMVPRGSPVRHSPPELSQEEFGESFADPGSSRTAQDLETSPVW
FT                   DLGSSSLTRAPSLTSDSEGKKPAQAVKKEPKEPKKTESWFSRWLPGKKRTEAYLPDDKN
FT                   KSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAG
FT                   GSRARYVDVLNPSGTQRSEPALAPADFFAPLAPLPIPSNLFVPNPDAEEPQPADGTGCR
FT                   GQAPAGTQSKAESTLEPKVGSSTVSAPGPELLPSKPDGSQGGEAPGDHCPTGAPHGGSV
FT                   PFYNPAQLVQASVTSGNSRPGRIGQRKYAALN"
FT   CDS             complement(join(23128599..23128667,23130628..23130705,
FT                   23132163..23132237,23133099..23133193,23133426..23133563,
FT                   23133909..23134020,23134163..23134219,23134426..23134503,
FT                   23137451..23137600,23139204..23139286,23139838..23140083,
FT                   23141284..23141467,23141713..23141826,23142247..23142387,
FT                   23143024..23143129,23143306..23143417,23143597..23143714,
FT                   23143910..23143991,23144281..23144378,23145970..23146215,
FT                   23146645..23146783,23146892..23146953,23147204..23147346,
FT                   23147907..23148081,23148224..23148422,23148935..23149058,
FT                   23151160..23151257,23153745..23153881,23156224..23157021))
FT                   /codon_start=1
FT                   /gene="AU024582"
FT                   /locus_tag="mCG_18731"
FT                   /product="expressed sequence AU024582, isoform CRA_a"
FT                   /note="gene_id=mCG18731.3 transcript_id=mCT15027.2
FT                   protein_id=mCP19544.2 isoform=CRA_a"
FT                   /protein_id="EDL08317.1"
FT                   /translation="MIASQSASWLVQQLSPQTPQSPHPNAEKGPSEFVSSPAGNTSVML
FT                   VPPASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTLENPVRMYSPSPSDGPASQQPLPN
FT                   HPRQSGPGLHNQDHFYQQVTKDAQDQHRLERAQPELVPPRPQNSPQVPQASCPEPSNPE
FT                   SPPTQGQSESLAQPPASPASVNTGQLLPQPPQASSASVTSTNSSQAAVRSEQLWLHPPP
FT                   PNTFGPAPQDLASYYYYRPLYDAYQSQYPSPYPSDPGTASLYYQDMYGLYEPRYRPYDS
FT                   SASAYAENHRYSEPERPSSRASHYSDQLAPRQGYPEGYYNSKSGWSSHSDYYANYYSGQ
FT                   YDYGDPSRWDRYYGSRLRDPRTWDRRYWYDSEHDPYRKDHYAYSDRPEKCDDHWRYDPR
FT                   FTGSFDDDAEIHRDPYGEEADRRSIHSEHSARSLRSTHSLPSRRSSLSSHSHQSQIYRS
FT                   HHVTGGSFEAPHAPGSFHGDYAYGTYASNFSGAHGFPEYSYPADTSWPAVEQVPSRPTS
FT                   PEKFTVPHVCARFGPGGQLLKVIPNLPSEGQPALVEIHSLETLLQHTPEQEEMRSFPGP
FT                   LGKDDTHKVDVINFAQNKATKCLQNESLIDKESASLLWKFIILLCRQNGTVVGTDIAEL
FT                   LLRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTDSQTVTTSVLEKET
FT                   ERFRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQT
FT                   VYQLMSGRMPAASTCCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLASKGLL
FT                   DAAHFCYLMAQVGFGVYTKKTTKLVLIGSNHSLPFLKFATNEAIQRTEAYEYAQSLGAH
FT                   TCSLPNFQVFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPGAYSPVLISQLTQMASQ
FT                   LRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQEGTVLWSQDGTEPQQCRITSGSEVE
FT                   QSDGPGLNQQAGPQADNPLLMPSTEPLMHGVQLLPTAPQTLPDGQPAHLSRVPMFPVPM
FT                   SRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLSLQESGLPPQEAKSPDP
FT                   EMVPRGSPVRHSPPELSQEEFGESFADPGSSRTAQDLETSPVWDLGSSSLTRAPSLTSD
FT                   SEGKKPAQAVKKEPKEPKKTESWFSRWLPGKKRTEAYLPDDKNKSIVWDEKKNQWVNLN
FT                   EPEEEKKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAGGSRARYVDVLNPSGTQ
FT                   RSEPALAPADFFAPLAPLPIPSNLFVPNPDAEEPQPADGTGCRGQAPAGTQSKAESTLE
FT                   PKVGSSTVSAPGPELLPSKPDGSQGGEAPGDHCPTGAPHGGSVPFYNPAQLVQASVTSG
FT                   NSRPGRIGQRKYAALN"
FT   gene            <23163781..23177213
FT                   /locus_tag="mCG_145917"
FT                   /note="gene_id=mCG145917.0"
FT   mRNA            join(<23163781..23164037,23175507..23175646,
FT                   23176250..23177213)
FT                   /locus_tag="mCG_145917"
FT                   /product="mCG145917, transcript variant mCT186025"
FT                   /note="gene_id=mCG145917.0 transcript_id=mCT186025.0
FT                   created on 04-JUL-2003"
FT   mRNA            join(<23163792..23164037,23175507..23175828)
FT                   /locus_tag="mCG_145917"
FT                   /product="mCG145917, transcript variant mCT190103"
FT                   /note="gene_id=mCG145917.0 transcript_id=mCT190103.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<23163887..23164037,23175507..23175718)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145917"
FT                   /product="mCG145917, isoform CRA_b"
FT                   /note="gene_id=mCG145917.0 transcript_id=mCT190103.0
FT                   protein_id=mCP111098.0 isoform=CRA_b"
FT                   /protein_id="EDL08320.1"
FT                   /translation="RREARAWRPSPSNSIATPPGRARPKAHGGTLDLDQGCQQVCLSEQ
FT                   RLSGKGIQLASIRSTSLRGLHQLFWKLSSHLDALRCAASENGVSLWQPLYFCVREGLDL
FT                   VISVLGGPFSVTLPKK"
FT   gene            complement(23176172..23221734)
FT                   /gene="Notch1"
FT                   /locus_tag="mCG_11364"
FT                   /note="gene_id=mCG11364.2"
FT   mRNA            complement(join(23176172..23178810,23179982..23180079,
FT                   23180176..23180323,23181544..23181839,23182640..23182805,
FT                   23182897..23182984,23183184..23183400,23184301..23184449,
FT                   23185463..23185864,23186066..23186637,23187439..23187551,
FT                   23187635..23187892,23188108..23188240,23188656..23188840,
FT                   23188987..23189140,23189906..23190107,23190619..23190847,
FT                   23191516..23191668,23191966..23192085,23193916..23194029,
FT                   23194190..23194335,23194789..23194981,23195722..23195832,
FT                   23195912..23196145,23196449..23196562,23197289..23197402,
FT                   23197713..23197898,23198066..23198221,23198852..23199085,
FT                   23199449..23199571,23202146..23202484,23203065..23203327,
FT                   23219818..23219896,23221435..23221734))
FT                   /gene="Notch1"
FT                   /locus_tag="mCG_11364"
FT                   /product="Notch gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG11364.2 transcript_id=mCT12392.2 created
FT                   on 01-OCT-2002"
FT   CDS             <23176475..23176813
FT                   /codon_start=1
FT                   /locus_tag="mCG_145917"
FT                   /product="mCG145917, isoform CRA_a"
FT                   /note="gene_id=mCG145917.0 transcript_id=mCT186025.0
FT                   protein_id=mCP107418.0 isoform=CRA_a"
FT                   /protein_id="EDL08319.1"
FT                   /translation="EPRPRPGQSVCPQLDLDDAVWRDAQNSPGSVFSRRHHTLHGLLAQ
FT                   VVRKGTVGQGRGEVLPRPINTTTEHWSLQTHDWYWVVDSAHAEDTSSSPHWWLQKVYKP
FT                   HHLTCFLF"
FT   CDS             complement(join(23177365..23178810,23179982..23180079,
FT                   23180176..23180323,23181544..23181839,23182640..23182805,
FT                   23182897..23182984,23183184..23183400,23184301..23184449,
FT                   23185463..23185864,23186066..23186637,23187439..23187551,
FT                   23187635..23187892,23188108..23188240,23188656..23188840,
FT                   23188987..23189140,23189906..23190107,23190619..23190847,
FT                   23191516..23191668,23191966..23192085,23193916..23194029,
FT                   23194190..23194335,23194789..23194981,23195722..23195832,
FT                   23195912..23196145,23196449..23196562,23197289..23197402,
FT                   23197713..23197898,23198066..23198221,23198852..23199085,
FT                   23199449..23199571,23202146..23202484,23203065..23203327,
FT                   23219818..23219896,23221435..23221495))
FT                   /codon_start=1
FT                   /gene="Notch1"
FT                   /locus_tag="mCG_11364"
FT                   /product="Notch gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG11364.2 transcript_id=mCT12392.2
FT                   protein_id=mCP19526.2"
FT                   /db_xref="GOA:Q01705"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000800"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008297"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR010660"
FT                   /db_xref="InterPro:IPR011656"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR022362"
FT                   /db_xref="InterPro:IPR024600"
FT                   /db_xref="MGI:MGI:97363"
FT                   /db_xref="PDB:1YMP"
FT                   /db_xref="PDB:2QC9"
FT                   /db_xref="PDB:2RQZ"
FT                   /db_xref="PDB:2RR0"
FT                   /db_xref="PDB:2RR2"
FT                   /db_xref="PDB:3P3N"
FT                   /db_xref="PDB:3P3P"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01705"
FT                   /protein_id="EDL08321.1"
FT                   /translation="MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEA
FT                   CVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDN
FT                   ACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYI
FT                   CRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPC
FT                   SPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNC
FT                   RCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCA
FT                   SAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICT
FT                   CPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECIS
FT                   NPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCP
FT                   KGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH
FT                   YGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTG
FT                   PNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCE
FT                   DGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDIN
FT                   NNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG
FT                   YKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDIN
FT                   ECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAF
FT                   CDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTE
FT                   SSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCP
FT                   QGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQK
FT                   RGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGG
FT                   FSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDC
FT                   HPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNC
FT                   VQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGA
FT                   TCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGT
FT                   CEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQVDAGNK
FT                   VCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFD
FT                   CQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVL
FT                   LPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELRKHPIKRSTVGW
FT                   ATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALA
FT                   SLGSLNIPYKIEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQ
FT                   LWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRF
FT                   EEPVVLPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTP
FT                   LMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDA
FT                   AKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDARMHDGTTPLILA
FT                   ARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKE
FT                   ETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVR
FT                   SPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGSKEAKDLKAR
FT                   RKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLSHLPGMP
FT                   DTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNGTGAMNFT
FT                   VGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPLHSSLST
FT                   NTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQPPSQPHLSVSSAANGHLG
FT                   RSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPPSQHS
FT                   YSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMPSQI
FT                   THIPEAFK"
FT   gene            23275656..23276111
FT                   /pseudo
FT                   /locus_tag="mCG_1030002"
FT                   /note="gene_id=mCG1030002.1"
FT   mRNA            23275656..23276111
FT                   /pseudo
FT                   /locus_tag="mCG_1030002"
FT                   /note="gene_id=mCG1030002.1 transcript_id=mCT147706.1
FT                   created on 12-FEB-2003"
FT   gene            23298063..23309769
FT                   /gene="Egfl7"
FT                   /locus_tag="mCG_11354"
FT                   /note="gene_id=mCG11354.1"
FT   mRNA            join(23298063..23298215,23302676..23302766,
FT                   23306135..23306259,23306420..23306536,23307470..23307585,
FT                   23307747..23307842,23307989..23308153,23308754..23308818,
FT                   23309204..23309366,23309504..23309769)
FT                   /gene="Egfl7"
FT                   /locus_tag="mCG_11354"
FT                   /product="EGF-like domain 7, transcript variant mCT12381"
FT                   /note="gene_id=mCG11354.1 transcript_id=mCT12381.2 created
FT                   on 08-OCT-2002"
FT   mRNA            join(23300838..23301019,23302676..23302766,
FT                   23306135..23306259,23306420..23306536,23307470..23307585,
FT                   23307747..23307842,23307989..23308153,23308754..23308818,
FT                   23309204..23309327,23309504..23309767)
FT                   /gene="Egfl7"
FT                   /locus_tag="mCG_11354"
FT                   /product="EGF-like domain 7, transcript variant mCT174275"
FT                   /note="gene_id=mCG11354.1 transcript_id=mCT174275.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(23306168..23306259,23306420..23306536,
FT                   23307470..23307585,23307747..23307842,23307989..23308153,
FT                   23308754..23308818,23309204..23309366,23309504..23309526)
FT                   /codon_start=1
FT                   /gene="Egfl7"
FT                   /locus_tag="mCG_11354"
FT                   /product="EGF-like domain 7, isoform CRA_a"
FT                   /note="gene_id=mCG11354.1 transcript_id=mCT12381.2
FT                   protein_id=mCP19540.2 isoform=CRA_a"
FT                   /protein_id="EDL08322.1"
FT                   /translation="MQTMWGSGELLVAWFLVLAADGTTEHVYRPSRRVCTVGISGGSIL
FT                   ETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPG
FT                   ACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSY
FT                   WCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLV
FT                   LAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSCSCKKDL"
FT   CDS             join(23306168..23306259,23306420..23306536,
FT                   23307470..23307585,23307747..23307842,23307989..23308153,
FT                   23308754..23308818,23309204..23309327,23309504..23309526)
FT                   /codon_start=1
FT                   /gene="Egfl7"
FT                   /locus_tag="mCG_11354"
FT                   /product="EGF-like domain 7, isoform CRA_b"
FT                   /note="gene_id=mCG11354.1 transcript_id=mCT174275.0
FT                   protein_id=mCP97194.0 isoform=CRA_b"
FT                   /protein_id="EDL08323.1"
FT                   /translation="MQTMWGSGELLVAWFLVLAADGTTEHVYRPSRRVCTVGISGGSIL
FT                   ETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPG
FT                   ACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSY
FT                   WCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLV
FT                   LAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSSCKKDL"
FT   gene            complement(23310146..>23321747)
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /note="gene_id=mCG11366.2"
FT   mRNA            complement(join(23310146..23310848,23311983..23312055,
FT                   23313283..23313378,23313494..23313669,23314387..23314520,
FT                   23321357..23321556))
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), transcript
FT                   variant mCT12394"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT12394.2 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(23310174..23310848,23311983..23312055,
FT                   23313283..23313378,23313494..23313669,23314387..23314520,
FT                   23321452..>23321539))
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), transcript
FT                   variant mCT190124"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT190124.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23310673..23310848,23311983..23312055,
FT                   23313283..23313378,23313494..23313669,23314387..23314520,
FT                   23321357..23321538))
FT                   /codon_start=1
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT12394.2
FT                   protein_id=mCP19571.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q059U0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="MGI:MGI:1914762"
FT                   /db_xref="UniProtKB/TrEMBL:Q059U0"
FT                   /protein_id="EDL08324.1"
FT                   /translation="MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAAS
FT                   IVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDM
FT                   MGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKE
FT                   NLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGT
FT                   IKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ"
FT   CDS             complement(join(23310673..23310848,23311983..23312055,
FT                   23313283..23313378,23313494..23313669,23314387..23314520,
FT                   23321452..>23321477))
FT                   /codon_start=1
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT190124.0
FT                   protein_id=mCP111081.0 isoform=CRA_b"
FT                   /protein_id="EDL08325.1"
FT                   /translation="AAQPGSTPSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISN
FT                   HQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADL
FT                   GDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKT
FT                   KLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGV
FT                   LPAQ"
FT   mRNA            complement(join(23311701..23312055,23313283..23313378,
FT                   23313494..23313669,23314387..23314520,23321357..>23321747))
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), transcript
FT                   variant mCT190125"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT190125.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23311885..23312055,23313283..23313378,
FT                   23313494..23313669,23314387..23314520,23321357..>23321745))
FT                   /codon_start=1
FT                   /gene="Agpat2"
FT                   /locus_tag="mCG_11366"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 2
FT                   (lysophosphatidic acid acyltransferase, beta), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11366.2 transcript_id=mCT190125.0
FT                   protein_id=mCP111082.0 isoform=CRA_c"
FT                   /protein_id="EDL08326.1"
FT                   /translation="GVRVQDAAGRSGARCPPAGPGPEGREQGGTAAPSSGLPAWPALYP
FT                   RRSSKGARAAGGGRRRRRGWGAAAMDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCV
FT                   LCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVI
FT                   ISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVM
FT                   ADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYN
FT                   VKTKLFTSGEPSAHRSSQACRALSVTDLESGLYGLQADLM"
FT   gene            23345971..23354003
FT                   /gene="B230317C12Rik"
FT                   /locus_tag="mCG_11343"
FT                   /note="gene_id=mCG11343.1"
FT   mRNA            join(23345971..23346208,23350113..23350247,
FT                   23352297..23352404,23352496..23352672,23353048..23354003)
FT                   /gene="B230317C12Rik"
FT                   /locus_tag="mCG_11343"
FT                   /product="RIKEN cDNA B230317C12"
FT                   /note="gene_id=mCG11343.1 transcript_id=mCT12371.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(23346146..23346208,23350113..23350247,
FT                   23352297..23352404,23352496..23352672,23353048..23353860)
FT                   /codon_start=1
FT                   /gene="B230317C12Rik"
FT                   /locus_tag="mCG_11343"
FT                   /product="RIKEN cDNA B230317C12"
FT                   /note="gene_id=mCG11343.1 transcript_id=mCT12371.1
FT                   protein_id=mCP19618.2"
FT                   /protein_id="EDL08327.1"
FT                   /translation="MRRLRRLVHLVLLCPFSKGLQGRLPGLRVKYVLLVWLGIFVGSWM
FT                   VYVHYSSYSELCRGHVCQVVICDQYRKGIISGSVCQDLCELQKVEWRTCLSSAPGQQVY
FT                   SGLWQDKEVTIKCGIEEALNSKAWPDAAPRRELVLFDKPTRGTSIKEFREMTLSFLKAN
FT                   LGDLPSLPALVDQILLMADFNKDSRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLL
FT                   GYCGDLYLTEGIPHGSWHGAVLLPALRPLLPSVLHRALQQWFGPAWPWRAKIAIGLLEF
FT                   VEELFHGSYGTFYMCETTLANVGYTATYDFKMADLQQVAPEATVRRFLQGRHCEQSSDC
FT                   IYGRDCRAPCDRLMRQCKGDLIQPNLAKVCELLRDYLLPGAPAGLYEELGKQLRTCTTL
FT                   SGLASQIEAHHSLVLSHLKTLLWREISNTNYS"
FT   gene            complement(23354685..23357723)
FT                   /locus_tag="mCG_1030139"
FT                   /note="gene_id=mCG1030139.0"
FT   mRNA            complement(join(23354685..23355138,23355546..23355606,
FT                   23356924..23356952,23357533..23357723))
FT                   /locus_tag="mCG_1030139"
FT                   /product="mCG1030139, transcript variant mCT147843"
FT                   /note="gene_id=mCG1030139.0 transcript_id=mCT147843.1
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(23354754..23356952,23357533..>23357707))
FT                   /locus_tag="mCG_1030139"
FT                   /product="mCG1030139, transcript variant mCT190051"
FT                   /note="gene_id=mCG1030139.0 transcript_id=mCT190051.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23355093..23355138,23355546..23355606,
FT                   23356924..23356952,23357533..23357555))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030139"
FT                   /product="mCG1030139, isoform CRA_b"
FT                   /note="gene_id=mCG1030139.0 transcript_id=mCT147843.1
FT                   protein_id=mCP50771.1 isoform=CRA_b"
FT                   /protein_id="EDL08329.1"
FT                   /translation="MCSRLTAWKLACQKESACTGKLVTKVCLCQMPSNVQLRSRSQEEG
FT                   GLLGQHG"
FT   CDS             complement(23356216..>23356554)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030139"
FT                   /product="mCG1030139, isoform CRA_a"
FT                   /note="gene_id=mCG1030139.0 transcript_id=mCT190051.0
FT                   protein_id=mCP111052.0 isoform=CRA_a"
FT                   /protein_id="EDL08328.1"
FT                   /translation="NQVLGHSVVAHVSLIHQLGSRDCLKNNSGWKQGCICLSQGFYCYE
FT                   TPLPKSKLGRKGVIPHTLTLLLVAKGSQGGDHERVLSAPPVPACHRRPSEPVLDGGELG
FT                   IELSRQCS"
FT   gene            23357848..23363396
FT                   /locus_tag="mCG_128385"
FT                   /note="gene_id=mCG128385.1"
FT   mRNA            join(23357848..23361221,23361303..23361410,
FT                   23362956..23363396)
FT                   /locus_tag="mCG_128385"
FT                   /product="mCG128385"
FT                   /note="gene_id=mCG128385.1 transcript_id=mCT129681.1
FT                   created on 12-JUN-2003"
FT   CDS             join(23361209..23361221,23361303..23361410,
FT                   23362956..23363287)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128385"
FT                   /product="mCG128385"
FT                   /note="gene_id=mCG128385.1 transcript_id=mCT129681.1
FT                   protein_id=mCP51034.1"
FT                   /protein_id="EDL08330.1"
FT                   /translation="MFLTGWRHVIYIHFLPGKESAIAYFRGNMNYQYYQLLLLMGRTLR
FT                   PNPDAERIFKESVMSIMPQTGRIITPPHAGREGFPRPLSPFSSLRLVLWIFLLYTRNHM
FT                   NSIMFHSSSKFSGFCPSTEACVFVLDPQCTKGVLQYPCRKQEMGPG"
FT   gene            complement(23384976..23388584)
FT                   /gene="Lcn4"
FT                   /locus_tag="mCG_11361"
FT                   /note="gene_id=mCG11361.0"
FT   mRNA            complement(join(23384976..23385199,23385639..23385665,
FT                   23385867..23385968,23386648..23386758,23387598..23387668,
FT                   23387904..23388034,23388477..23388584))
FT                   /gene="Lcn4"
FT                   /locus_tag="mCG_11361"
FT                   /product="lipocalin 4"
FT                   /note="gene_id=mCG11361.0 transcript_id=mCT12389.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23385177..23385199,23385639..23385665,
FT                   23385867..23385968,23386648..23386758,23387598..23387668,
FT                   23387904..23388034,23388477..23388569))
FT                   /codon_start=1
FT                   /gene="Lcn4"
FT                   /locus_tag="mCG_11361"
FT                   /product="lipocalin 4"
FT                   /note="gene_id=mCG11361.0 transcript_id=mCT12389.0
FT                   protein_id=mCP19581.1"
FT                   /db_xref="GOA:Q24JQ8"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002450"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:102668"
FT                   /db_xref="UniProtKB/TrEMBL:Q24JQ8"
FT                   /protein_id="EDL08331.1"
FT                   /translation="MKSLLLTVTLSSLVATLQTYDDLPFISEEDKLSGVWFIKATVSQR
FT                   REVEGETLVAFPIKFTCPEEGTLELRHTLASKGECINVGIRLQRTEEPGQYSAFWGHTL
FT                   FYIYDLPVKDHYIIYCESHPFQKISQFGYLIGKYPEENQDTLEVFKEFIQHKGFLQEKI
FT                   GVPEQRDRCIPIHDSAHQDHKC"
FT   gene            complement(<23552919..23574718)
FT                   /gene="Abo"
FT                   /locus_tag="mCG_11360"
FT                   /note="gene_id=mCG11360.2"
FT   mRNA            complement(join(<23552919..23553606,23555688..23555822,
FT                   23556306..23556341,23557983..23558039,23558653..23558722,
FT                   23574610..23574718))
FT                   /gene="Abo"
FT                   /locus_tag="mCG_11360"
FT                   /product="ABO blood group (transferase A, alpha
FT                   1-3-N-acetylgalactosaminyltransferase, transferase B, alpha
FT                   1-3-galactosyltransferase)"
FT                   /note="gene_id=mCG11360.2 transcript_id=mCT12388.1 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23552919..23553606,23555688..23555822,
FT                   23556306..23556341,23557983..23558039,23558653..23558722,
FT                   23574610..23574622))
FT                   /codon_start=1
FT                   /gene="Abo"
FT                   /locus_tag="mCG_11360"
FT                   /product="ABO blood group (transferase A, alpha
FT                   1-3-N-acetylgalactosaminyltransferase, transferase B, alpha
FT                   1-3-galactosyltransferase)"
FT                   /note="gene_id=mCG11360.2 transcript_id=mCT12388.1
FT                   protein_id=mCP19400.1"
FT                   /db_xref="GOA:P38649"
FT                   /db_xref="InterPro:IPR005076"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2135738"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38649"
FT                   /protein_id="EDL08332.1"
FT                   /translation="MNLRGRPKCNFLHLGILPFAVFVLVFFGYLFLSFRSQNLGHPGAV
FT                   TRNAYLQPRVLKPTRKDVLVLTPWLAPIIWEGTFNIDILNEQFRIRNTTIGLTVFAIKK
FT                   YVVFLKLFLETAEQHFMVGHKVIYYVFTDRPADVPQVILGAGRQLVVLTVRNYTRWQDV
FT                   SMHRMEMISHFSERRFLREVDYLVCADADMKFSDHVGVEILSTFFGTLHPGFYSSSREA
FT                   FTYERRPQSQAYIPWDRGDFYYGGAFFGGSVLEVYHLTKACHEAMMEDKANGIEPVWHD
FT                   ESYLNKYLLYHKPTKVLSPEYLWDQQLLGWPSIMKKLRYVAVPKDHQAIRN"
FT   gene            complement(23598732..23612623)
FT                   /gene="Surf6"
FT                   /locus_tag="mCG_11356"
FT                   /note="gene_id=mCG11356.2"
FT   mRNA            complement(join(23598732..23599121,23602610..23602810,
FT                   23609081..23609169,23609473..23609676,23612438..23612623))
FT                   /gene="Surf6"
FT                   /locus_tag="mCG_11356"
FT                   /product="surfeit gene 6, transcript variant mCT174042"
FT                   /note="gene_id=mCG11356.2 transcript_id=mCT174042.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23599041..23599121,23602610..23602810,
FT                   23609081..23609169,23609473..23609676,23612438..23612531))
FT                   /codon_start=1
FT                   /gene="Surf6"
FT                   /locus_tag="mCG_11356"
FT                   /product="surfeit gene 6, isoform CRA_b"
FT                   /note="gene_id=mCG11356.2 transcript_id=mCT174042.0
FT                   protein_id=mCP96961.0 isoform=CRA_b"
FT                   /protein_id="EDL08334.1"
FT                   /translation="MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPK
FT                   KKRKKTQKKSPEQEQKAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGT
FT                   ARESVFALDFLRQRLHEKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAK
FT                   QQVAEAEKKEEPVEVTPKMACKELQESGLIFNKWTDCHSVLCALSHFSGDCNMENPEEA
FT                   "
FT   mRNA            complement(join(23600516..23602468,23602610..23602810,
FT                   23609081..23609169,23609473..23609676,23612438..23612623))
FT                   /gene="Surf6"
FT                   /locus_tag="mCG_11356"
FT                   /product="surfeit gene 6, transcript variant mCT12385"
FT                   /note="gene_id=mCG11356.2 transcript_id=mCT12385.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23601989..23602468,23602610..23602810,
FT                   23609081..23609169,23609473..23609676,23612438..23612531))
FT                   /codon_start=1
FT                   /gene="Surf6"
FT                   /locus_tag="mCG_11356"
FT                   /product="surfeit gene 6, isoform CRA_a"
FT                   /note="gene_id=mCG11356.2 transcript_id=mCT12385.2
FT                   protein_id=mCP19709.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V1X4"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="InterPro:IPR029190"
FT                   /db_xref="MGI:MGI:98447"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1X4"
FT                   /protein_id="EDL08333.1"
FT                   /translation="MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPK
FT                   KKRKKTQKKSPEQEQKAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGT
FT                   ARESVFALDFLRQRLHEKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAK
FT                   QQVAEAEKKEEPVEVTPKMACKELQESGLIFNKVEVTEEEPASKAQRKKEKRQKVKGNL
FT                   TPLTGRNYRQLLDRLQARQGRLDELRDQDAAKAQELEAKMKWTNLLYKAEGVKIRDDER
FT                   LLQEALKRKEKRRAQRQRKWEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQKAHK
FT                   KGRVLPQDLERAGLS"
FT   gene            <23614516..23614920
FT                   /locus_tag="mCG_1030141"
FT                   /note="gene_id=mCG1030141.1"
FT   mRNA            <23614516..23614920
FT                   /locus_tag="mCG_1030141"
FT                   /product="mCG1030141"
FT                   /note="gene_id=mCG1030141.1 transcript_id=mCT147845.1
FT                   created on 24-FEB-2003"
FT   CDS             <23614516..23614701
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030141"
FT                   /product="mCG1030141"
FT                   /note="gene_id=mCG1030141.1 transcript_id=mCT147845.1
FT                   protein_id=mCP50800.1"
FT                   /protein_id="EDL08335.1"
FT                   /translation="WKPPSGLFISIITVFSPDFDTCYYRDIFGPAPVPQPILPVIRGCL
FT                   PPQPHLRAAPNWSPSG"
FT   gene            complement(23615012..23620387)
FT                   /gene="Surf5"
FT                   /locus_tag="mCG_11352"
FT                   /note="gene_id=mCG11352.1"
FT   mRNA            complement(join(23615012..23618046,23618738..23618818,
FT                   23620038..23620387))
FT                   /gene="Surf5"
FT                   /locus_tag="mCG_11352"
FT                   /product="surfeit gene 5"
FT                   /note="gene_id=mCG11352.1 transcript_id=mCT12380.1 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(23617828..23618046,23618738..23618818,
FT                   23620038..23620160))
FT                   /codon_start=1
FT                   /gene="Surf5"
FT                   /locus_tag="mCG_11352"
FT                   /product="surfeit gene 5"
FT                   /note="gene_id=mCG11352.1 transcript_id=mCT12380.1
FT                   protein_id=mCP19701.1"
FT                   /protein_id="EDL08336.1"
FT                   /translation="MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDE
FT                   TQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQ
FT                   LRALQEECDRKLITLRDEVSIDLYELEEEYYSSRYK"
FT   gene            23620543..23623048
FT                   /locus_tag="mCG_11348"
FT                   /note="gene_id=mCG11348.1"
FT   mRNA            join(23620543..23620575,23620751..23620871,
FT                   23621167..23621316,23621764..23621904,23622111..23622190,
FT                   23622416..23622546,23622733..23622802,23622910..23623048)
FT                   /locus_tag="mCG_11348"
FT                   /product="mCG11348"
FT                   /note="gene_id=mCG11348.1 transcript_id=mCT12376.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(23620573..23620575,23620751..23620871,
FT                   23621167..23621316,23621764..23621904,23622111..23622190,
FT                   23622416..23622546,23622733..23622802,23622910..23623014)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11348"
FT                   /product="mCG11348"
FT                   /note="gene_id=mCG11348.1 transcript_id=mCT12376.1
FT                   protein_id=mCP19676.1"
FT                   /db_xref="GOA:Q58ET1"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ET1"
FT                   /protein_id="EDL08337.1"
FT                   /translation="MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDI
FT                   QPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRP
FT                   ETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDP
FT                   IELVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAI
FT                   RTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG"
FT   gene            complement(23623130..23626275)
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /note="gene_id=mCG11344.2"
FT   mRNA            complement(join(23623130..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623956,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..23626039))
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, transcript variant mCT190030"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190030.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23623133..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..23626275))
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, transcript variant mCT12372"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT12372.1 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(23623133..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..23625514,23625700..23625751,
FT                   23626002..>23626221))
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, transcript variant mCT190032"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190032.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23623181..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..23626172))
FT                   /codon_start=1
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT12372.1
FT                   protein_id=mCP19626.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2ALA6"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="MGI:MGI:98443"
FT                   /db_xref="UniProtKB/TrEMBL:A2ALA6"
FT                   /protein_id="EDL08338.1"
FT                   /translation="MIGDAHLTPQPPRETERRPGRKQISRSRKCSKMAAVMALAVLPRR
FT                   MTRWSQWAYAGRAQFCAVRRSVFGFSVRSGMVCRPRRCCSSTAETAAAKAEDDSFLQWF
FT                   LLLIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELKNLEYRPVKVRG
FT                   HFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAHVVTPFHCSDLGVTILVNRGFVPR
FT                   KKVNPETRQKGQVLGEVDLVGIVRLTENRKPFVPENSPERNHWYYRDLEAMAKITGADP
FT                   IFIDADFHSTAPGGPIGGQTRVTLRNEHMQYILTWYGLCAATSYLWFQKFVRRTPIM"
FT   mRNA            complement(join(<23623181..23623250,23623318..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..>23626076))
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, transcript variant mCT190031"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190031.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<23623181..23623250,23623318..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..23626076))
FT                   /codon_start=1
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, isoform CRA_c"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190031.0
FT                   protein_id=mCP111054.0 isoform=CRA_c"
FT                   /protein_id="EDL08340.1"
FT                   /translation="MAAVMALAVLPRRMTRWSQWAYAGRAQFCAVRRSVFGFSVRSGMV
FT                   CRPRRCCSSTAETAAAKAEDDSFLQWFLLLIPATAFGLGTWQVQRRKWKLKLIAELESR
FT                   VMAEPIPLPADPMELKNLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTE
FT                   SGAHVVTPFHCSDLGVTILVNRGFVPRKKVNPETRQKGQVLGEVDLVGIVRLTENRKPF
FT                   VPENSPERNHWYYRDLEAMAKITGADPIFIDADFHSTAPGGPIGGQTRVTLRNEHMQYI
FT                   LTWLVRTVCGHIIFVVPKICTSDTHHV"
FT   CDS             complement(join(23623181..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623956,23624452..23624640,
FT                   23625177..23625259,23625341..23625474,23625700..23625751,
FT                   23626002..23626037))
FT                   /codon_start=1
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190030.0
FT                   protein_id=mCP111053.0 isoform=CRA_b"
FT                   /protein_id="EDL08339.1"
FT                   /translation="MTRWSQWAYAGRAQFCAVRRSVFGFSVRSGMVCRPRRCCSSTAET
FT                   AAAKAEDDSFLQWFLLLIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPM
FT                   ELKNLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAHVVTPFHCSD
FT                   LGKKVNPETRQKGQVLGEVDLVGIVRLTENRKPFVPENSPERNHWYYRDLEAMAKITGA
FT                   DPIFIDADFHSTAPGGPIGGQTRVTLRNEHMQYILTWYGLCAATSYLWFQKFVRRTPIM
FT                   "
FT   CDS             complement(join(23623181..23623250,23623322..23623403,
FT                   23623658..23623820,23623920..23623992,23624452..23624640,
FT                   23625177..23625259,23625341..>23625505))
FT                   /codon_start=1
FT                   /gene="Surf1"
FT                   /locus_tag="mCG_11344"
FT                   /product="surfeit gene 1, isoform CRA_d"
FT                   /note="gene_id=mCG11344.2 transcript_id=mCT190032.0
FT                   protein_id=mCP111055.0 isoform=CRA_d"
FT                   /protein_id="EDL08341.1"
FT                   /translation="PHASVVKLPPGMVCRPRRCCSSTAETAAAKAEDDSFLQWFLLLIP
FT                   ATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELKNLEYRPVKVRGHFDHS
FT                   KELYIMPRTMVDPVREARDAGRLSSTESGAHVVTPFHCSDLGVTILVNRGFVPRKKVNP
FT                   ETRQKGQVLGEVDLVGIVRLTENRKPFVPENSPERNHWYYRDLEAMAKITGADPIFIDA
FT                   DFHSTAPGGPIGGQTRVTLRNEHMQYILTWYGLCAATSYLWFQKFVRRTPIM"
FT   gene            <23626166..23629911
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /note="gene_id=mCG11346.2"
FT   mRNA            join(<23626166..23626248,23626450..23626604,
FT                   23627173..23628800,23628937..23629103,23629472..23629911)
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, transcript variant mCT190042"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT190042.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<23626171..23626248,23626450..23626604,
FT                   23627173..23627276,23628618..23628800,23628937..23629103,
FT                   23629472..23629638)
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, transcript variant mCT12374"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT12374.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(23626171..23626248,23626450..23626604,
FT                   23627173..23627276,23628618..23628800,23628937..23629103,
FT                   23629472..23629558)
FT                   /codon_start=1
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, isoform CRA_c"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT12374.1
FT                   protein_id=mCP19655.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q4VAF7"
FT                   /db_xref="InterPro:IPR008833"
FT                   /db_xref="MGI:MGI:98444"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAF7"
FT                   /protein_id="EDL08344.1"
FT                   /translation="MDEPPSDVLAFLRQHPSLRLLPNTRKVRCSLTGHELPCRLPELQE
FT                   YTRGKKYQRLSSSFSNFDYAAFEPHIVPSTKNRHQLFCKLTLRHINKSPEHVLRHTQGR
FT                   RYQRALHQYEECQKQGVEYVPACLLHKRKKREDQTNSDELPGQRTGFWEPASSDEEDAL
FT                   SDDSMTDLYPPELFTKRELGKPKNDDTPEDFLTDQQDEKPEHSEEKSFREREEARVGHK
FT                   RGRKLRKKQLTSLTKKFKSYHHKPKNFSSFKQLGR"
FT   mRNA            join(23626453..23629103,23629348..23629911)
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, transcript variant mCT190043"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT190043.0 created
FT                   on 08-MAR-2004"
FT   CDS             23627057..23627371
FT                   /codon_start=1
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, isoform CRA_b"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT190043.0
FT                   protein_id=mCP111057.0 isoform=CRA_b"
FT                   /protein_id="EDL08343.1"
FT                   /translation="MQSIPADGSFVCSMQPWWSPQDWALGVHCPSIPTCLPFRHQLFCK
FT                   LTLRHINKSPEHVLRHTQGRRYQRALHQCKSPPRSSGLWMHAPCPQKARKVPWPSLILY
FT                   "
FT   CDS             join(<23628566..23628800,23628937..23629103,
FT                   23629472..23629558)
FT                   /codon_start=1
FT                   /gene="Surf2"
FT                   /locus_tag="mCG_11346"
FT                   /product="surfeit gene 2, isoform CRA_a"
FT                   /note="gene_id=mCG11346.2 transcript_id=mCT190042.0
FT                   protein_id=mCP111056.0 isoform=CRA_a"
FT                   /protein_id="EDL08342.1"
FT                   /translation="LSCAPRGYQCNELASLLDEECQKQGVEYVPACLLHKRKKREDQTN
FT                   SDELPGQRTGFWEPASSDEEDALSDDSMTDLYPPELFTKRELGKPKNDDTPEDFLTDQQ
FT                   DEKPEHSEEKSFREREEARVGHKRGRKLRKKQLTSLTKKFKSYHHKPKNFSSFKQLGR"
FT   gene            complement(23629783..23643172)
FT                   /gene="Surf4"
FT                   /locus_tag="mCG_11365"
FT                   /note="gene_id=mCG11365.1"
FT   mRNA            complement(join(23629783..23631916,23634090..23634276,
FT                   23634698..23634741,23635353..23635429,23636514..23636700,
FT                   23643020..23643172))
FT                   /gene="Surf4"
FT                   /locus_tag="mCG_11365"
FT                   /product="surfeit gene 4, transcript variant mCT12393"
FT                   /note="gene_id=mCG11365.1 transcript_id=mCT12393.1 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(23629786..23631916,23634090..23634276,
FT                   23634698..23634741,23636514..23636700,23643020..23643171))
FT                   /gene="Surf4"
FT                   /locus_tag="mCG_11365"
FT                   /product="surfeit gene 4, transcript variant mCT174043"
FT                   /note="gene_id=mCG11365.1 transcript_id=mCT174043.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23631650..23631916,23634090..23634276,
FT                   23634698..23634741,23635353..23635429,23636514..23636700,
FT                   23643020..23643067))
FT                   /codon_start=1
FT                   /gene="Surf4"
FT                   /locus_tag="mCG_11365"
FT                   /product="surfeit gene 4, isoform CRA_a"
FT                   /note="gene_id=mCG11365.1 transcript_id=mCT12393.1
FT                   protein_id=mCP19600.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q545Q2"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="MGI:MGI:98445"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Q2"
FT                   /protein_id="EDL08345.1"
FT                   /translation="MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMW
FT                   FQWSEQRDYIDTTWSCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQ
FT                   TIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRV
FT                   LLVLMFMTLLHFDASFFSIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAF
FT                   WTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW"
FT   CDS             complement(join(23631650..23631916,23634090..23634276,
FT                   23634698..23634702))
FT                   /codon_start=1
FT                   /gene="Surf4"
FT                   /locus_tag="mCG_11365"
FT                   /product="surfeit gene 4, isoform CRA_b"
FT                   /note="gene_id=mCG11365.1 transcript_id=mCT174043.0
FT                   protein_id=mCP96962.0 isoform=CRA_b"
FT                   /protein_id="EDL08346.1"
FT                   /translation="MRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGR
FT                   VLLVLMFMTLLHFDASFFSIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNA
FT                   FWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW"
FT   gene            <23643814..23663294
FT                   /gene="Gm711"
FT                   /locus_tag="mCG_145702"
FT                   /note="gene_id=mCG145702.0"
FT   mRNA            join(23643814..23643857,23645037..23645145,
FT                   23647726..23647770,23649716..23649790,23650756..23650860,
FT                   23652876..23652946,23653622..23653737,23655187..23655305,
FT                   23655509..23655672,23656342..23656478,23656989..23657072,
FT                   23659057..23659173,23659770..23659910,23660299..23660427,
FT                   23661165..23661293,23661367..23661495,23662396..23662536,
FT                   23662701..23662780,23663002..23663294)
FT                   /gene="Gm711"
FT                   /locus_tag="mCG_145702"
FT                   /product="gene model 711, (NCBI), transcript variant
FT                   mCT185248"
FT                   /note="gene_id=mCG145702.0 transcript_id=mCT185248.0
FT                   created on 13-JUN-2003"
FT   mRNA            join(<23643814..23643857,23645037..23645145,
FT                   23647726..23647770,23649716..23649790,23650756..23650860,
FT                   23652876..23652946,23653622..23653737,23655187..23655305,
FT                   23655509..23655672,23656342..23656472,23656989..23657072,
FT                   23659057..23659173,23659770..23659910,23660299..23660427,
FT                   23661165..23661293,23661367..23661495,23662396..23662536,
FT                   23662701..23662780,23663002..23663240)
FT                   /gene="Gm711"
FT                   /locus_tag="mCG_145702"
FT                   /product="gene model 711, (NCBI), transcript variant
FT                   mCT190109"
FT                   /note="gene_id=mCG145702.0 transcript_id=mCT190109.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<23645059..23645145,23647726..23647770,
FT                   23649716..23649790,23650756..23650860,23652876..23652946,
FT                   23653622..23653737,23655187..23655305,23655509..23655672,
FT                   23656342..23656472,23656989..23657072,23659057..23659173,
FT                   23659770..23659910,23660299..23660427,23661165..23661293,
FT                   23661367..23661495,23662396..23662536,23662701..23662780,
FT                   23663002..23663136)
FT                   /codon_start=1
FT                   /gene="Gm711"
FT                   /locus_tag="mCG_145702"
FT                   /product="gene model 711, (NCBI), isoform CRA_b"
FT                   /note="gene_id=mCG145702.0 transcript_id=mCT190109.0
FT                   protein_id=mCP111096.0 isoform=CRA_b"
FT                   /protein_id="EDL08348.1"
FT                   /translation="LLQMLNPGALGVNLVVEELETETKFLIKQVECIDEHHANKALEEL
FT                   MPLLKLQHPNLSLYHEMFIMWNNEISSLFLCLVMDYYSQGTFQNIMENKRKLKAVVDTE
FT                   WMHTMLSQVLDAIEYLHKLNIVHRNLKPSNIVLVNSGYCKLQDMSSQALMTHEAKWNVR
FT                   AEEDPCQKSWMAPEALKFSFSTKSDIWSLGCIILDMATCSFLNDTEAMQLRKAIRHHPG
FT                   SLKPILKTMEEKQIPGTDVYYLLLPFMLHINPSDRLAIKDVMQVTFMSNSFKSSSVALN
FT                   MQRQKVPIFITDVLLEGNMANILDVMQNFSSRPEVQLRAINKLLTMPEDQLGLPWPTEL
FT                   LEEVISIIKQHGRILDILLSTCSLLLRVLGQALAKDPEAEIPRSSLIISFLMDTLRSHP
FT                   NSERLVNVVYNVLAIISSQGQISEELEEEGLFQLAQENLEHFQEDRDICLSILSLLWSL
FT                   LVDVVTVDKEPLEQLSGMVTWVLATHPEDVEIAEAGCAVLWLLSLLGCIKESQFEQVVV
FT                   LLLRSIQLCPGRVLLVNNAFRGLASLAKVSELVAFRIVVLEEGSSGLHLIQDIYKLYKD
FT                   DPEVVENLCMLLAHLTSYKEILPEMESGGIKDLVQVIRGRFTSSLELISYADEILQVLE
FT                   ANAQPGLQEDQLEPPAGQEAPLQGEPLFRP"
FT   CDS             join(23645068..23645145,23647726..23647770,
FT                   23649716..23649790,23650756..23650860,23652876..23652946,
FT                   23653622..23653737,23655187..23655305,23655509..23655672,
FT                   23656342..23656478,23656989..23657072,23659057..23659173,
FT                   23659770..23659910,23660299..23660427,23661165..23661293,
FT                   23661367..23661495,23662396..23662536,23662701..23662780,
FT                   23663002..23663136)
FT                   /codon_start=1
FT                   /gene="Gm711"
FT                   /locus_tag="mCG_145702"
FT                   /product="gene model 711, (NCBI), isoform CRA_a"
FT                   /note="gene_id=mCG145702.0 transcript_id=mCT185248.0
FT                   protein_id=mCP106506.0 isoform=CRA_a"
FT                   /protein_id="EDL08347.1"
FT                   /translation="MLNPGALGVNLVVEELETETKFLIKQVECIDEHHANKALEELMPL
FT                   LKLQHPNLSLYHEMFIMWNNEISSLFLCLVMDYYSQGTFQNIMENKRKLKAVVDTEWMH
FT                   TMLSQVLDAIEYLHKLNIVHRNLKPSNIVLVNSGYCKLQDMSSQALMTHEAKWNVRAEE
FT                   DPCQKSWMAPEALKFSFSTKSDIWSLGCIILDMATCSFLNDTEAMQLRKAIRHHPGSLK
FT                   PILKTMEEKQIPGTDVYYLLLPFMLHINPSDRLAIKDVMQVTFMSNSFKSSSVALNMQR
FT                   QKVPIFITDVLLEGNMANILGDDVMQNFSSRPEVQLRAINKLLTMPEDQLGLPWPTELL
FT                   EEVISIIKQHGRILDILLSTCSLLLRVLGQALAKDPEAEIPRSSLIISFLMDTLRSHPN
FT                   SERLVNVVYNVLAIISSQGQISEELEEEGLFQLAQENLEHFQEDRDICLSILSLLWSLL
FT                   VDVVTVDKEPLEQLSGMVTWVLATHPEDVEIAEAGCAVLWLLSLLGCIKESQFEQVVVL
FT                   LLRSIQLCPGRVLLVNNAFRGLASLAKVSELVAFRIVVLEEGSSGLHLIQDIYKLYKDD
FT                   PEVVENLCMLLAHLTSYKEILPEMESGGIKDLVQVIRGRFTSSLELISYADEILQVLEA
FT                   NAQPGLQEDQLEPPAGQEAPLQGEPLFRP"
FT   gene            complement(23663303..>23673820)
FT                   /gene="Rexo4"
FT                   /locus_tag="mCG_11368"
FT                   /note="gene_id=mCG11368.1"
FT   mRNA            complement(join(23663303..23664341,23665240..23665314,
FT                   23669722..23669916,23670102..23670239,23671882..23672222,
FT                   23673551..>23673820))
FT                   /gene="Rexo4"
FT                   /locus_tag="mCG_11368"
FT                   /product="REX4, RNA exonuclease 4 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG11368.1 transcript_id=mCT12396.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(23665296..23665314,23669722..23669916,
FT                   23670102..23670239,23671882..23672222,23673551..>23673820))
FT                   /codon_start=1
FT                   /gene="Rexo4"
FT                   /locus_tag="mCG_11368"
FT                   /product="REX4, RNA exonuclease 4 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG11368.1 transcript_id=mCT12396.2
FT                   protein_id=mCP19554.2"
FT                   /protein_id="EDL08349.1"
FT                   /translation="EMCACAVAGVAVSSLVVPTAESGEMKTKATAPVPQPGPIRKLARK
FT                   KAKKKFRKSKALAGSGVPGSHPAAVAGRPPKAPENFSQNWKALQELLKQKSQAAEKPLV
FT                   SQMDDKMHPQIIQQNRKKASDKSKGDKQRTEKAKSTRGSVTSAPTDRKILVPPTDTSGT
FT                   EQKKGAKKRTYSDISSHQGALKPKWKATEAAVILNQPTPTEEDIWFDDVDPDDIEDAIG
FT                   PEAAMLVRKRLGQKKRTISLEKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQ
FT                   YGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGVDDRL"
FT   gene            <23683029..>23716063
FT                   /gene="Adamts13"
FT                   /locus_tag="mCG_1050963"
FT                   /note="gene_id=mCG1050963.0"
FT   mRNA            join(<23683029..23683145,23683421..23683490,
FT                   23685114..23685262,23687458..23687541,23687791..23687915,
FT                   23688043..23688189,23690562..23690708,23691156..23691318,
FT                   23692517..23692621,23693341..23693492,23693593..23693656,
FT                   23694918..23695044,23696021..23696169,23696484..23696604,
FT                   23697809..23697889,23698708..23698889,23699780..23699915,
FT                   23699996..23700125,23700732..23700917,23702345..23702537,
FT                   23703377..23703500,23705993..23706122,23706205..23706384,
FT                   23713999..23714203,23714421..23714733,23715432..23715578,
FT                   23715877..>23716063)
FT                   /gene="Adamts13"
FT                   /locus_tag="mCG_1050963"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 13"
FT                   /note="gene_id=mCG1050963.0 transcript_id=mCT194752.0
FT                   created on 27-JAN-2005"
FT   CDS             join(23683029..23683145,23683421..23683490,
FT                   23685114..23685262,23687458..23687541,23687791..23687915,
FT                   23688043..23688189,23690562..23690708,23691156..23691318,
FT                   23692517..23692621,23693341..23693492,23693593..23693656,
FT                   23694918..23695044,23696021..23696169,23696484..23696604,
FT                   23697809..23697889,23698708..23698889,23699780..23699915,
FT                   23699996..23700125,23700732..23700917,23702345..23702537,
FT                   23703377..23703500,23705993..23706122,23706205..23706384,
FT                   23713999..23714203,23714421..23714733,23715432..23715578,
FT                   23715877..>23716063)
FT                   /codon_start=1
FT                   /gene="Adamts13"
FT                   /locus_tag="mCG_1050963"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 13"
FT                   /note="gene_id=mCG1050963.0 transcript_id=mCT194752.0
FT                   protein_id=mCP115781.0"
FT                   /protein_id="EDL08350.1"
FT                   /translation="MSQLCLWLTCQPCYAVSVRGILTGAIFILGCWGLSDFQKSLLQDL
FT                   EPKDVSSYFGHHAAPFTGHPPSHLQRLRRRRTLEDILHLELLVAVGPDVSRAHQEDTER
FT                   YVLTNLNIGSELLRNPSLGVQFQVHLVKLITLSDSESTPNITANITSSLMSVCEWSQTI
FT                   NPHDDRDPSHADLILYITRFDLELPDGNQQVRGVTQLGGACSLSWSCLITEDTGFDLGV
FT                   TIAHEIGHSFGLDHDGAPGSGSTCKASGHVMAADGATPTGGTLEWSACSQRQLQHLLST
FT                   GQMHCFQDPPGLQSGLTRHQLMAQPGLYYSADDQCRVAFGSGAVACTFSREGLDVCQAL
FT                   SCHTDPLDQSSCSRLLVPLLDGTECGVEKWCSKARCRSLAELAPVAAVHGHWSSWGPHS
FT                   PCSRSCGGGVITRRRWCNNPRPAFGGRACVGEDLQAKMCNTQACEKTQLEFMSEQCAQT
FT                   DRQPLQLSQGTASFYHWDAAVQYSQGDTLCRHMCWAVGESFIVSRGDRFLDGTRCVPSG
FT                   PQDDGTLSLCLLGSCRTFGCDGRMDSQKVWDACQVCGGDNSTCSSRNGSFTAGRAREYV
FT                   TFLIVTPNMTNAHIVNRRPLFTHLAVRIQGHYIVAGKTSISPNTTYPSLLEDYRVEYRV
FT                   TLTEDQLPHLEEIHIRGPVRDDIEIQVYRRYGGEYGDLTHPDITFSYFQLKQQAAWVWT
FT                   AKRGPCSVSCGAGLRWVTYSCQDQAQDKWVKNAQCQGSPQPPAWQEPCVSAPCSPYWVA
FT                   GDFSPCSVSCGGGLRERSLRCVETQDGFLKTLPPARCRAVAQQPAAEVENCNSQPCPTR
FT                   WEVSDPGPCMSSACEAGLDSRNVTCVSRAGDPEKPETAGPCRTDEMSAMLEPCSRSLCS
FT                   PGLGQVDNTMSLGEEAPSPVGSDKPGAQAEHVWTPLVGLCSISCGRGLKELYFLCMDSV
FT                   LKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLD
FT                   RGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQL
FT                   DQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLG
FT                   PQAQVPVPANFCQHLPKPMTVRGCWAGPCAGQETSSSLPHKEATLPSQTQAAATVASLQ
FT                   WSQPRARTPTLFSASQSLGLQENLEEHGACGRQYLEPTGTIHMRDQGRLDCVVAIGRPL
FT                   GEVVTLQILESSLKCSAGEQLLLWGRFTWRKTCRKMPGMTFSTKTNTVVVKQHRVLPGG
FT                   GVLLRYWSQPAPGTFYKGMSG"
FT   gene            complement(23724006..23730604)
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /note="gene_id=mCG11371.1"
FT   mRNA            complement(join(23724006..23724710,23725360..23725505,
FT                   23725729..23725890,23726176..23726284,23726824..23726976,
FT                   23727226..23727434,23727864..23727963,23728542..23728748,
FT                   23729782..23729944,23730458..23730604))
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, transcript variant mCT12399"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT12399.2 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(23724006..23724710,23725360..23725505,
FT                   23725729..23725890,23726176..23727434,23727864..23727963,
FT                   23728542..23728748,23730458..>23730587))
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, transcript variant mCT190158"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT190158.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23724009..23724710,23725360..23725505,
FT                   23725729..23726284,23726824..23726976,23727226..23727434,
FT                   23727864..23727963,23728542..23728748,23729782..23729944,
FT                   23730458..>23730563))
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, transcript variant mCT190159"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT190159.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23724555..23724710,23725360..23725505,
FT                   23725729..23725890,23726176..23726284,23726824..23726976,
FT                   23727226..23727434,23727864..23727963,23728542..23728748,
FT                   23729782..23729944,23730458..23730546))
FT                   /codon_start=1
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, isoform CRA_a"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT12399.2
FT                   protein_id=mCP19608.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UDF0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2443286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UDF0"
FT                   /protein_id="EDL08351.1"
FT                   /translation="MQEPLLRTEGLDYDTFPEVPATPGERERAGALKNRRVFLATFAAV
FT                   LGNFSFGYALVYTSPVIPELKLSSDPALHLDKIQASWFGSVFTLGAAAGGLSAMLLNDL
FT                   LGRKLSIMFSAVPSAIGYAIMAGARGLWMLLLGRMLTGFAGGLTAACIPVYVSEIAPPD
FT                   VRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEGPVLIMILLLSFMPNSPRFLLS
FT                   KSRDEEALQALTWLRADSEVHWEFEQIQDNVRRQSSRVSWAEAREPRVYRPVLIAVLMR
FT                   FLQQLTGITPILVYLQTIFDNTSVVLPSQQDAAIVGAVRLLSVLIAAVTMDLAGRKVLL
FT                   YVSASVMFAANLTLGLYVQFVPRPLTPNSTVEIVTLGDTAFNYLTLIPLLATMLFIMGY
FT                   AMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVLTNYFLLAVNAFGLQVPFFFF
FT                   SAICLLSLLFTGCCVPETRGRSLEQIEAFFHTRRMSFRP"
FT   CDS             complement(join(23724555..23724710,23725360..23725505,
FT                   23725729..23725890,23726176..>23726353))
FT                   /codon_start=1
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, isoform CRA_b"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT190158.0
FT                   protein_id=mCP111134.0 isoform=CRA_b"
FT                   /protein_id="EDL08352.1"
FT                   /translation="CIRVRVGHGTLGQVSQPSALPPQPSQQDAAIVGAVRLLSVLIAAV
FT                   TMDLAGRKVLLYVSASVMFAANLTLGLYVQFVPRPLTPNSTVEIVTLGDTAFNYLTLIP
FT                   LLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVLTNYFLLAVN
FT                   AFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQIEAFFHTRRMSFRP"
FT   CDS             complement(join(23725985..23726284,23726824..23726976,
FT                   23727226..23727434,23727864..23727963,23728542..23728748,
FT                   23729782..23729944,23730458..>23730561))
FT                   /codon_start=1
FT                   /gene="Slc2a6"
FT                   /locus_tag="mCG_11371"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 6, isoform CRA_c"
FT                   /note="gene_id=mCG11371.1 transcript_id=mCT190159.0
FT                   protein_id=mCP111135.0 isoform=CRA_c"
FT                   /protein_id="EDL08353.1"
FT                   /translation="PSALAMQEPLLRTEGLDYDTFPEVPATPGERERAGALKNRRVFLA
FT                   TFAAVLGNFSFGYALVYTSPVIPELKLSSDPALHLDKIQASWFGSVFTLGAAAGGLSAM
FT                   LLNDLLGRKLSIMFSAVPSAIGYAIMAGARGLWMLLLGRMLTGFAGGLTAACIPVYVSE
FT                   IAPPDVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEGPVLIMILLLSFMPNSP
FT                   RFLLSKSRDEEALQALTWLRADSEVHWEFEQIQDNVRRQSSRVSWAEAREPRVYRPVLI
FT                   AVLMRFLQQLTGITPILVYLQTIFDNTSVVLPSQQDAAIVGAVRLLSVLIAAVTMDLAG
FT                   RKVLLYVSGECLHCNVHLLLLQPLQTLGHSQASLAHGPGPSKWQLLHTGLLMLQAQRSP
FT                   PTHPTQWCGRRP"
FT   gene            23737338..23738233
FT                   /pseudo
FT                   /locus_tag="mCG_11345"
FT                   /note="gene_id=mCG11345.1"
FT   mRNA            23737338..23738233
FT                   /pseudo
FT                   /locus_tag="mCG_11345"
FT                   /note="gene_id=mCG11345.1 transcript_id=mCT12373.1 created
FT                   on 11-NOV-2002"
FT   gene            23739925..>23743494
FT                   /locus_tag="mCG_147229"
FT                   /note="gene_id=mCG147229.0"
FT   mRNA            join(23739925..23739988,23740721..>23743494)
FT                   /locus_tag="mCG_147229"
FT                   /product="mCG147229"
FT                   /note="gene_id=mCG147229.0 transcript_id=mCT187492.0
FT                   created on 13-JAN-2004"
FT   CDS             23743103..>23743494
FT                   /codon_start=1
FT                   /locus_tag="mCG_147229"
FT                   /product="mCG147229"
FT                   /note="gene_id=mCG147229.0 transcript_id=mCT187492.0
FT                   protein_id=mCP109111.0"
FT                   /protein_id="EDL08354.1"
FT                   /translation="MQARKKLHLQGKYCFIEFSGPFCKHCGSASGFFPACLQGAPPGST
FT                   SREHQGALGSQMPELRKICALGELAVAQDGLGDFTRHVRESRSGAGWSFPPEAYRETVY
FT                   GYTRGYECLSMYICIYVCMRIIIHVYA"
FT   gene            complement(23764314..23775269)
FT                   /gene="1110002H13Rik"
FT                   /locus_tag="mCG_11357"
FT                   /note="gene_id=mCG11357.2"
FT   mRNA            complement(join(23764314..23764978,23765343..23765459,
FT                   23769349..23769497,23770411..23770525,23774939..23775269))
FT                   /gene="1110002H13Rik"
FT                   /locus_tag="mCG_11357"
FT                   /product="RIKEN cDNA 1110002H13"
FT                   /note="gene_id=mCG11357.2 transcript_id=mCT12386.1 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(23764829..23764978,23765343..23765459,
FT                   23769349..23769497,23770411..23770525,23774939..23775073))
FT                   /codon_start=1
FT                   /gene="1110002H13Rik"
FT                   /locus_tag="mCG_11357"
FT                   /product="RIKEN cDNA 1110002H13"
FT                   /note="gene_id=mCG11357.2 transcript_id=mCT12386.1
FT                   protein_id=mCP19565.1"
FT                   /protein_id="EDL08355.1"
FT                   /translation="MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVA
FT                   FSHACDGPGLSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTI
FT                   AVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGAL
FT                   ALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTLCCTCV"
FT   gene            <23782439..23812033
FT                   /gene="Adamtsl2"
FT                   /locus_tag="mCG_11370"
FT                   /note="gene_id=mCG11370.2"
FT   mRNA            join(23782439..23782631,23784762..23784852,
FT                   23785440..23785582,23786258..23786333,23787054..23787156,
FT                   23787835..23787980,23788109..23788244,23790269..23790349,
FT                   23792642..23792817,23796591..23796948,23798461..23798830,
FT                   23801664..23801761,23804665..23804791,23805827..23806040,
FT                   23806124..23806279,23806926..23807096,23807807..23807983,
FT                   23810453..23810597,23811379..23812033)
FT                   /gene="Adamtsl2"
FT                   /locus_tag="mCG_11370"
FT                   /product="ADAMTS-like 2, transcript variant mCT12398"
FT                   /note="gene_id=mCG11370.2 transcript_id=mCT12398.2 created
FT                   on 09-OCT-2002"
FT   mRNA            join(<23782439..23782631,23784762..23784852,
FT                   23785440..23785582,23786258..23786333,23787054..23787156,
FT                   23787835..23787980,23788109..23788232,23790269..23790349,
FT                   23792642..23792817,23796591..23796948,23798461..23798830,
FT                   23801664..23801761,23804665..23804791,23805827..23806040,
FT                   23806124..23806279,23806926..23807096,23807807..23807983,
FT                   23810453..23810597,23811379..23811671)
FT                   /gene="Adamtsl2"
FT                   /locus_tag="mCG_11370"
FT                   /product="ADAMTS-like 2, transcript variant mCT190154"
FT                   /note="gene_id=mCG11370.2 transcript_id=mCT190154.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23782621..23782631,23784762..23784852,
FT                   23785440..23785582,23786258..23786333,23787054..23787156,
FT                   23787835..23787980,23788109..23788232,23790269..23790349,
FT                   23792642..23792817,23796591..23796948,23798461..23798830,
FT                   23801664..23801761,23804665..23804791,23805827..23806040,
FT                   23806124..23806279,23806926..23807096,23807807..23807983,
FT                   23810453..23810597,23811379..23811497)
FT                   /codon_start=1
FT                   /gene="Adamtsl2"
FT                   /locus_tag="mCG_11370"
FT                   /product="ADAMTS-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG11370.2 transcript_id=mCT190154.0
FT                   protein_id=mCP111133.0 isoform=CRA_b"
FT                   /protein_id="EDL08357.1"
FT                   /translation="PWVRMDGRRQHPHWAWSLLAVAVVAGGAAPTEASDNSPTSNSLEG
FT                   GADTTAYWWGEWTKWTACSRSCGGGVTSQERHCLQQRRKSVPGTGNRTCVGTSKRYQLC
FT                   RVQECPPDGRSFREEQCVSFNSRVYDGRAYQWKPLYPDDYVHISSKPCDLHCSTVDGQR
FT                   QLTVPARDGTSCKLTDLRGVCVSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTG
FT                   NYRKGNNHLGYSLVTHIPAGARDIQIVERKKSADVLALADEAGFYFFNGNYKVDSPKNF
FT                   NIAGTVVKYRRPMDVYETGIEYIVAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQSPHM
FT                   HHLPPVYYSFSEAASQSTESTERQELDSARLLGFMQHNGSLYRQTSSERLGLNSQLFQP
FT                   PAPEVELGPSRGQESNEVCKQASGGVCEGPPRGKGFQDHNATGRAFSADKDDREISAHF
FT                   TSHELLSANTISDQLLGTGSESEEFSLNETMNSIFAQGAPRSSPAESLYVDYEENEGPA
FT                   AYLINGSYLELSSDRINTSSEAPFPNTSASPPNLAGNRTHKARTRPKARKQGVSPADMY
FT                   RWKLSSHEPCSATCTTGVMSTYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPR
FT                   WETSSWSECSRTCGEGHQFRIVRCWKMLSPGFDSSVYSDLCEATEAVRPEERKTCRNPA
FT                   CGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLCDPSTKPVGEKNCTGPPCDRQWTV
FT                   SDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQTETKPLAIHPCGDKNCPAHWLAQD
FT                   WERCNTTCGRGVKKRLVLCMELANGKPQIRSGPECGLARKPPEESTCFERPCFKWYTSP
FT                   WSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQP
FT                   GTNCALAIKVNLCGHWYYSKACCRSCRPPHS"
FT   CDS             join(23784763..23784852,23785440..23785582,
FT                   23786258..23786333,23787054..23787156,23787835..23787980,
FT                   23788109..23788244,23790269..23790349,23792642..23792817,
FT                   23796591..23796948,23798461..23798830,23801664..23801761,
FT                   23804665..23804791,23805827..23806040,23806124..23806279,
FT                   23806926..23807096,23807807..23807983,23810453..23810597,
FT                   23811379..23811497)
FT                   /codon_start=1
FT                   /gene="Adamtsl2"
FT                   /locus_tag="mCG_11370"
FT                   /product="ADAMTS-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG11370.2 transcript_id=mCT12398.2
FT                   protein_id=mCP19557.2 isoform=CRA_a"
FT                   /protein_id="EDL08356.1"
FT                   /translation="MDGRRQHPHWAWSLLAVAVVAGGAAPTEASDNSPTSNSLEGGADT
FT                   TAYWWGEWTKWTACSRSCGGGVTSQERHCLQQRRKSVPGTGNRTCVGTSKRYQLCRVQE
FT                   CPPDGRSFREEQCVSFNSRVYDGRAYQWKPLYPDDYVHISSKPCDLHCSTVDGQRQLTV
FT                   PARDGTSCKLTDLRGVCVSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRK
FT                   GNNHLGKGRCYSLVTHIPAGARDIQIVERKKSADVLALADEAGFYFFNGNYKVDSPKNF
FT                   NIAGTVVKYRRPMDVYETGIEYIVAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQSPHM
FT                   HHLPPVYYSFSEAASQSTESTERQELDSARLLGFMQHNGSLYRQTSSERLGLNSQLFQP
FT                   PAPEVELGPSRGQESNEVCKQASGGVCEGPPRGKGFQDHNATGRAFSADKDDREISAHF
FT                   TSHELLSANTISDQLLGTGSESEEFSLNETMNSIFAQGAPRSSPAESLYVDYEENEGPA
FT                   AYLINGSYLELSSDRINTSSEAPFPNTSASPPNLAGNRTHKARTRPKARKQGVSPADMY
FT                   RWKLSSHEPCSATCTTGVMSTYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPR
FT                   WETSSWSECSRTCGEGHQFRIVRCWKMLSPGFDSSVYSDLCEATEAVRPEERKTCRNPA
FT                   CGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLCDPSTKPVGEKNCTGPPCDRQWTV
FT                   SDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQTETKPLAIHPCGDKNCPAHWLAQD
FT                   WERCNTTCGRGVKKRLVLCMELANGKPQIRSGPECGLARKPPEESTCFERPCFKWYTSP
FT                   WSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQP
FT                   GTNCALAIKVNLCGHWYYSKACCRSCRPPHS"
FT   gene            complement(23815060..23845379)
FT                   /gene="C630035N08Rik"
FT                   /locus_tag="mCG_11372"
FT                   /note="gene_id=mCG11372.1"
FT   mRNA            complement(join(23815060..23815948,23816606..23816721,
FT                   23845064..23845379))
FT                   /gene="C630035N08Rik"
FT                   /locus_tag="mCG_11372"
FT                   /product="RIKEN cDNA C630035N08"
FT                   /note="gene_id=mCG11372.1 transcript_id=mCT12400.1 created
FT                   on 09-OCT-2002"
FT   CDS             complement(join(23815538..23815948,23816606..23816698))
FT                   /codon_start=1
FT                   /gene="C630035N08Rik"
FT                   /locus_tag="mCG_11372"
FT                   /product="RIKEN cDNA C630035N08"
FT                   /note="gene_id=mCG11372.1 transcript_id=mCT12400.1
FT                   protein_id=mCP19644.2"
FT                   /db_xref="GOA:B2RVN8"
FT                   /db_xref="InterPro:IPR029379"
FT                   /db_xref="MGI:MGI:1926106"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVN8"
FT                   /protein_id="EDL08358.1"
FT                   /translation="MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEE
FT                   EPDFAVHSHLPPLHSNRNLVLTNGPALYPAATTSFSQKSPQARALCRSCSHYEPPTFFL
FT                   QEPEDEDFEGVRNGGGRVAYKSISQEDVELPSASFGGLQALNPNRLSAMREAFSRSRSV
FT                   STDV"
FT   gene            complement(23847802..>23865609)
FT                   /locus_tag="mCG_145106"
FT                   /note="gene_id=mCG145106.0"
FT   mRNA            complement(join(23847802..23850409,23855615..23855842,
FT                   23859800..23859954,23863153..23863283,23864152..23864282,
FT                   23864490..23864761,23865113..>23865609))
FT                   /locus_tag="mCG_145106"
FT                   /product="mCG145106"
FT                   /note="gene_id=mCG145106.0 transcript_id=mCT184530.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(23864212..23864282,23864490..23864761,
FT                   23865113..>23865228))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145106"
FT                   /product="mCG145106"
FT                   /note="gene_id=mCG145106.0 transcript_id=mCT184530.0
FT                   protein_id=mCP105477.0"
FT                   /protein_id="EDL08359.1"
FT                   /translation="NPQKDPGPGRQSLQARPCVGGVQQSHVNLSGSPCISLQVTWRSTV
FT                   ISAITNSTAVFHPLPTQICQSKEVKLIPQGYPCCNCTGMIPQELGGQGQKSTREACDHP
FT                   QGASWFPRCHGIDIMFQWLYPIAGIGARNHLVVVFETGSLTGLESPSS"
FT   gene            23868136..23886111
FT                   /gene="Dbh"
FT                   /locus_tag="mCG_11363"
FT                   /note="gene_id=mCG11363.1"
FT   mRNA            join(23868136..23868770,23871077..23871223,
FT                   23873216..23873473,23874216..23874392,23875608..23875710,
FT                   23877729..23877895,23880222..23880365,23880628..23880666,
FT                   23881102..23881161,23883891..23884018,23884385..23884544,
FT                   23885580..23886111)
FT                   /gene="Dbh"
FT                   /locus_tag="mCG_11363"
FT                   /product="dopamine beta hydroxylase"
FT                   /note="gene_id=mCG11363.1 transcript_id=mCT12391.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(23868420..23868770,23871077..23871223,
FT                   23873216..23873473,23874216..23874392,23875608..23875710,
FT                   23877729..23877895,23880222..23880365,23880628..23880666,
FT                   23881102..23881161,23883891..23884018,23884385..23884544,
FT                   23885580..23885714)
FT                   /codon_start=1
FT                   /gene="Dbh"
FT                   /locus_tag="mCG_11363"
FT                   /product="dopamine beta hydroxylase"
FT                   /note="gene_id=mCG11363.1 transcript_id=mCT12391.1
FT                   protein_id=mCP19556.2"
FT                   /db_xref="GOA:Q64237"
FT                   /db_xref="InterPro:IPR000323"
FT                   /db_xref="InterPro:IPR000945"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="InterPro:IPR008977"
FT                   /db_xref="InterPro:IPR014783"
FT                   /db_xref="InterPro:IPR014784"
FT                   /db_xref="InterPro:IPR020611"
FT                   /db_xref="InterPro:IPR028460"
FT                   /db_xref="MGI:MGI:94864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64237"
FT                   /protein_id="EDL08360.1"
FT                   /translation="MQAHLSHQPCWSSLPSPSVREAASMYGTAVAIFLVILVAALRGSE
FT                   PPESPFPYHIPLDPEGILELSWNVSYVQEIIHFQLQVQGLRAGVLFGMSDRGEMENADL
FT                   IMLWTDGDRAYFADAWSDRKGQIHLDSQQDYQLLQAQRTRDGLSLLFKRPFVTCDPKDY
FT                   VIEDDTVHLVYGILEEPFQSLEAINTSGLHTGLQRVQLLKSEVPTPSMPEDVQTMDIRA
FT                   PDILIPDNETTYWCYITELPPRFPRHHIIMYEAIVTEGNEALVHHMEVFQCAAESEDFP
FT                   QFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHN
FT                   PRKIQGRQDSSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCT
FT                   QMALQDSGIHIFASQLHTHLTGRKVVTVLARDGQERKVVNRDNHYSPHFQEIRMLKKVV
FT                   TVYPGDVLITSCTYNTENKTLATVGGFGILEEMCVNYVHYYPQTELELCKSAVDDGFLQ
FT                   KYFHMVNRFSSEEVCTCPQASVPQQFSSVPWNSFNRDMLKALYDYAPISMHCNKTSAVR
FT                   FPGEWNLQPLPKITSTLEEPTPRCPIRQTQSPANPTVPITTEADAE"
FT   gene            complement(23891308..23950326)
FT                   /gene="Sardh"
FT                   /locus_tag="mCG_128379"
FT                   /note="gene_id=mCG128379.0"
FT   mRNA            complement(join(23891308..23892558,23894793..23894928,
FT                   23899563..23899731,23900443..23900605,23913924..23914017,
FT                   23917951..23918098,23921865..23921978,23923710..23923848,
FT                   23928036..23928149,23930144..23930227,23931311..23931452,
FT                   23933501..23933591,23933834..23933920,23937354..23937483,
FT                   23938541..23938645,23942430..23942530,23942678..23942801,
FT                   23944451..23944630,23945767..23945945,23947234..23947588,
FT                   23949738..23950326))
FT                   /gene="Sardh"
FT                   /locus_tag="mCG_128379"
FT                   /product="sarcosine dehydrogenase"
FT                   /note="gene_id=mCG128379.0 transcript_id=mCT129675.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(23892433..23892558,23894793..23894928,
FT                   23899563..23899731,23900443..23900605,23913924..23914017,
FT                   23917951..23918098,23921865..23921978,23923710..23923848,
FT                   23928036..23928149,23930144..23930227,23931311..23931452,
FT                   23933501..23933591,23933834..23933920,23937354..23937483,
FT                   23938541..23938645,23942430..23942530,23942678..23942801,
FT                   23944451..23944630,23945767..23945945,23947234..23947567))
FT                   /codon_start=1
FT                   /gene="Sardh"
FT                   /locus_tag="mCG_128379"
FT                   /product="sarcosine dehydrogenase"
FT                   /note="gene_id=mCG128379.0 transcript_id=mCT129675.1
FT                   protein_id=mCP50903.1"
FT                   /db_xref="GOA:Q3TWI2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="MGI:MGI:2183102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TWI2"
FT                   /protein_id="EDL08361.1"
FT                   /translation="MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRT
FT                   LKEEAQGASVVPQGPSQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTS
FT                   GTTWHTAGLLWQLRPSDVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRL
FT                   NEYKRLMSLGKAYGIESHVLSPAETKSLYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLT
FT                   RAAVARGAQVIENCAVTGIRVRTDDFGVRRVAAVETEHGSIQTPCVVNCAGVWASKVGR
FT                   MAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWE
FT                   EVSDKFAFGLFDLDWDVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAP
FT                   ELRGFFLGCGFNSAGMMLGGGCGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHTRWIR
FT                   ERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQET
FT                   AQVLDYDYYGAYGNQAHKDYTYSRLLGDEYTFDFPPHHHMIQKECLACRGAAAVFNMSY
FT                   FGKFYLLGVDARKAADWLFSADVNRPPGSTVYTCMLNQRGGTESDLTVSRLAPGTQASP
FT                   LVPAFEGDCYYLAVGGAVAQHNWSHINTVLQDQEFRCQLMDSSEDLGMLSIQGPASRDI
FT                   LQDVLDADLSNEAFPFSTHQLVRAAGHLVRAIRLSFVGELGWELHVPRASCLPVYRAVM
FT                   AAGARHGLVNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKTSVPFLGRE
FT                   ALEKQRATGLRRRLICLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTIAYGYI
FT                   RDPSGGPVSLDFVKNGEYALERMGVTYAAQVHLKSPFDPDNKRVKGIY"
FT   gene            complement(23966692..24129634)
FT                   /gene="Vav2"
FT                   /locus_tag="mCG_141249"
FT                   /note="gene_id=mCG141249.0"
FT   mRNA            complement(join(23966692..23967268,23970287..23970441,
FT                   23971208..23971294,23971956..23972079,23973185..23973272,
FT                   23974832..23974948,23976745..23976797,23978057..23978131,
FT                   23980273..23980400,23981654..23981675,23984941..23985046,
FT                   23985346..23985447,23986366..23986475,23988690..23988822,
FT                   23989496..23989581,23991663..23991749,23994407..23994475,
FT                   23994866..23994961,23995727..23995826,23999180..23999280,
FT                   24000725..24000793,24002431..24002529,24005065..24005167,
FT                   24022286..24022354,24040039..24040097,24089093..24089194,
FT                   24128878..24129634))
FT                   /gene="Vav2"
FT                   /locus_tag="mCG_141249"
FT                   /product="Vav2 oncogene, transcript variant mCT174048"
FT                   /note="gene_id=mCG141249.0 transcript_id=mCT174048.0
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(23966692..23967268,23970287..23970441,
FT                   23971208..23971294,23971956..23972079,23973185..23973272,
FT                   23974832..23974948,23976745..23976797,23978057..23978131,
FT                   23980273..23980400,23981654..23981675,23984940..23985046,
FT                   23985346..23985447,23986366..23986475,23988690..23988822,
FT                   23989496..23989581,23991663..23991749,23994407..23994475,
FT                   23994866..23994961,23995727..23995826,23999180..23999280,
FT                   24000725..24000793,24002431..24002529,24005065..24005167,
FT                   24022286..24022354,24040039..24040097,24089093..24089209,
FT                   24128878..>24129432))
FT                   /gene="Vav2"
FT                   /locus_tag="mCG_141249"
FT                   /product="Vav2 oncogene, transcript variant mCT190137"
FT                   /note="gene_id=mCG141249.0 transcript_id=mCT190137.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23967221..23967268,23970287..23970441,
FT                   23971208..23971294,23971956..23972079,23973185..23973272,
FT                   23974832..23974948,23976745..23976797,23978057..23978131,
FT                   23980273..23980400,23981654..23981675,23984941..23985046,
FT                   23985346..23985447,23986366..23986475,23988690..23988822,
FT                   23989496..23989581,23991663..23991749,23994407..23994475,
FT                   23994866..23994961,23995727..23995826,23999180..23999280,
FT                   24000725..24000793,24002431..24002529,24005065..24005167,
FT                   24022286..24022354,24040039..24040097,24089093..24089194,
FT                   24128878..24129081))
FT                   /codon_start=1
FT                   /gene="Vav2"
FT                   /locus_tag="mCG_141249"
FT                   /product="Vav2 oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG141249.0 transcript_id=mCT174048.0
FT                   protein_id=mCP96967.0 isoform=CRA_a"
FT                   /protein_id="EDL08362.1"
FT                   /translation="MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQ
FT                   LLHNLSPGSIDLKDINFRPQMSQNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVI
FT                   SAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEG
FT                   DDIYEDIIKVEVQQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRLVL
FT                   SPADMAAVFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHME
FT                   HAQSTLNQLLASREDFRQKVEECTLRVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHS
FT                   ADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKID
FT                   GELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIK
FT                   KWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
FT                   KTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSEYSAVDAPGAGPGPKM
FT                   VAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPC
FT                   PVDGRPPTGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAI
FT                   SIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYK
FT                   SRERTTSRASSRSPASCASYNFSFLSPQGLSFAPQAPSAPFWSVFTPRVIGTAVARYNF
FT                   AARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGVQ"
FT   CDS             complement(join(23981674..23981675,23984940..23985046,
FT                   23985346..23985447,23986366..23986475,23988690..23988822,
FT                   23989496..23989581,23991663..23991749,23994407..23994475,
FT                   23994866..23994961,23995727..23995826,23999180..23999280,
FT                   24000725..24000793,24002431..24002529,24005065..24005167,
FT                   24022286..24022354,24040039..24040097,24089093..24089209,
FT                   24128878..>24129432))
FT                   /codon_start=1
FT                   /gene="Vav2"
FT                   /locus_tag="mCG_141249"
FT                   /product="Vav2 oncogene, isoform CRA_b"
FT                   /note="gene_id=mCG141249.0 transcript_id=mCT190137.0
FT                   protein_id=mCP111094.0 isoform=CRA_b"
FT                   /protein_id="EDL08363.1"
FT                   /translation="GADREALRLQEAWSPGRSTSGLVCVKEGPRTLPRERRLAARGRER
FT                   RPASSPKRRRRKRRAVRPRSGDPGPPARSPAPAAEPRAGGRDAPRSPHFGRSATLSQLA
FT                   SGRSGERTGAAGAMEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQL
FT                   LHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDF
FT                   GKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPC
FT                   EDEGDDIYEDIIKVEVQQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPL
FT                   RLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYC
FT                   SHMEHAQSTLNQLLASREDFRQKVEECTLRVQDGKFKLQDLLVVPMQRVLKYHLLLKEL
FT                   LSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGR
FT                   PKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHN
FT                   KDIKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQM
FT                   YTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSEYSAV"
FT   gene            <24030056..24034656
FT                   /locus_tag="mCG_1030143"
FT                   /note="gene_id=mCG1030143.0"
FT   mRNA            join(<24030056..24030130,24034440..24034656)
FT                   /locus_tag="mCG_1030143"
FT                   /product="mCG1030143"
FT                   /note="gene_id=mCG1030143.0 transcript_id=mCT147847.0
FT                   created on 03-MAR-2003"
FT   CDS             join(<24030056..24030130,24034440..24034505)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030143"
FT                   /product="mCG1030143"
FT                   /note="gene_id=mCG1030143.0 transcript_id=mCT147847.0
FT                   protein_id=mCP51127.0"
FT                   /protein_id="EDL08364.1"
FT                   /translation="GKRTALAWESLSGCSRRHALTSEVQVISLARILISWTFSSHSEQI
FT                   S"
FT   gene            complement(24150204..24178266)
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /note="gene_id=mCG11349.2"
FT   mRNA            complement(join(24150204..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24156843..24157034,
FT                   24159482..24159610,24162030..24162401,24164102..24164316,
FT                   24164994..24165141,24166029..24166166,24166463..24166767,
FT                   24178165..24178260))
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, transcript variant
FT                   mCT12377"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT12377.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(24150344..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24155930..24155980,
FT                   24156843..24157034,24159482..24159610,24162030..24162401,
FT                   24164102..24164316,24164994..24165141,24166029..24166166,
FT                   24166463..24166767,24178165..24178266))
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, transcript variant
FT                   mCT174041"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT174041.0 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(24150360..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24156843..24157034,
FT                   24159482..24159610,24162030..24162401,24164102..24164316,
FT                   24164994..24165141,24166029..24166166,24166463..24166767,
FT                   24177730..>24177778))
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, transcript variant
FT                   mCT190046"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190046.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(24150373..24150899,24150930..24151110,
FT                   24151731..24151856,24152787..24153079,24155363..24155604,
FT                   24156843..24157034,24159482..24159610,24162030..24162401,
FT                   24164102..24164316,24164994..24165141,24166029..24166166,
FT                   24166463..24166767,24178165..>24178209))
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, transcript variant
FT                   mCT190045"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190045.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24150995..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24156843..24157034,
FT                   24159482..24159610,24162030..24162401,24164102..24164316,
FT                   24164994..24165141,24166029..24166166,24166463..>24166687))
FT                   /codon_start=1
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190045.0
FT                   protein_id=mCP111058.0 isoform=CRA_b"
FT                   /protein_id="EDL08366.1"
FT                   /translation="LSCQRMSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQY
FT                   MQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASE
FT                   CMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKP
FT                   AAGAQNAGSQQVAAVSSVSPATPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAA
FT                   PPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVA
FT                   RRESGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYK
FT                   PVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDH
FT                   EVVAMARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAESSRSSEESSSDSGSSD
FT                   SEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKDKDKEKEKH
FT                   KAKSEEEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQLKKGGKQASASYDSEEEEEGL
FT                   PMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLREL
FT                   ERYVKSCLQKKQRKPLSTSGKKQAAKSKEELAQEKKKELEKRLQDVSGQLNSKKPTKKE
FT                   KSGSAPSGGPSRLSSSSSSESASSSSSGSSSDSSDSE"
FT   CDS             complement(join(24150995..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24156843..24157034,
FT                   24159482..24159610,24162030..24162401,24164102..24164316,
FT                   24164994..24165141,24166029..24166166,24166463..>24166687))
FT                   /codon_start=1
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190046.0
FT                   protein_id=mCP111059.0 isoform=CRA_b"
FT                   /protein_id="EDL08367.1"
FT                   /translation="LSCQRMSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQY
FT                   MQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASE
FT                   CMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKP
FT                   AAGAQNAGSQQVAAVSSVSPATPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAA
FT                   PPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVA
FT                   RRESGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYK
FT                   PVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDH
FT                   EVVAMARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAESSRSSEESSSDSGSSD
FT                   SEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKDKDKEKEKH
FT                   KAKSEEEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQLKKGGKQASASYDSEEEEEGL
FT                   PMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLREL
FT                   ERYVKSCLQKKQRKPLSTSGKKQAAKSKEELAQEKKKELEKRLQDVSGQLNSKKPTKKE
FT                   KSGSAPSGGPSRLSSSSSSESASSSSSGSSSDSSDSE"
FT   CDS             complement(join(24150995..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24156843..24157034,
FT                   24159482..24159610,24162030..24162401,24164102..24164316,
FT                   24164994..24165141,24166029..24166166,24166463..24166672))
FT                   /codon_start=1
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, isoform CRA_d"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT12377.2
FT                   protein_id=mCP19632.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3TUI3"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="MGI:MGI:1914632"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TUI3"
FT                   /protein_id="EDL08369.1"
FT                   /translation="MSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVV
FT                   VKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDF
FT                   NTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQ
FT                   NAGSQQVAAVSSVSPATPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAAPPPPA
FT                   TPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVARRESG
FT                   GRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYKPVDAE
FT                   ALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAM
FT                   ARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAESSRSSEESSSDSGSSDSEEER
FT                   ATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKDKDKEKEKHKAKSE
FT                   EEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQLKKGGKQASASYDSEEEEEGLPMSYD
FT                   EKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVK
FT                   SCLQKKQRKPLSTSGKKQAAKSKEELAQEKKKELEKRLQDVSGQLNSKKPTKKEKSGSA
FT                   PSGGPSRLSSSSSSESASSSSSGSSSDSSDSE"
FT   CDS             complement(join(24150995..24151110,24151731..24151856,
FT                   24152787..24153079,24155363..24155604,24155930..24155980,
FT                   24156843..24157034,24159482..24159610,24162030..24162401,
FT                   24164102..24164316,24164994..24165141,24166029..24166166,
FT                   24166463..24166672))
FT                   /codon_start=1
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT174041.0
FT                   protein_id=mCP96960.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5CCJ9"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="MGI:MGI:1914632"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCJ9"
FT                   /protein_id="EDL08365.1"
FT                   /translation="MSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVV
FT                   VKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDF
FT                   NTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQ
FT                   NAGSQQVAAVSSVSPATPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAAPPPPA
FT                   TPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVARRESG
FT                   GRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYKPVDAE
FT                   ALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAM
FT                   ARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAESSRSSEESSSDSGSSDSEEER
FT                   ATRLAELQEQTGCGAFQDQLLNVSSVQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKK
FT                   KDKDKDKEKEKHKAKSEEEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQLKKGGKQAS
FT                   ASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEID
FT                   FETLKPTTLRELERYVKSCLQKKQRKPLSTSGKKQAAKSKEELAQEKKKELEKRLQDVS
FT                   GQLNSKKPTKKEKSGSAPSGGPSRLSSSSSSESASSSSSGSSSDSSDSE"
FT   mRNA            complement(join(24155526..24157034,24159482..24159610,
FT                   24162030..24162401,24164102..24164316,24164994..24165141,
FT                   24166029..24166166,24166463..24166767,24178165..>24178242))
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, transcript variant
FT                   mCT190047"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190047.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24156711..24157034,24159482..24159610,
FT                   24162030..24162401,24164102..24164316,24164994..24165141,
FT                   24166029..24166166,24166463..>24166687))
FT                   /codon_start=1
FT                   /gene="Brd3"
FT                   /locus_tag="mCG_11349"
FT                   /product="bromodomain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG11349.2 transcript_id=mCT190047.0
FT                   protein_id=mCP111060.0 isoform=CRA_c"
FT                   /protein_id="EDL08368.1"
FT                   /translation="LSCQRMSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQY
FT                   MQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASE
FT                   CMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKP
FT                   AAGAQNAGSQQVAAVSSVSPATPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAA
FT                   PPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVA
FT                   RRESGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYK
FT                   PVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDH
FT                   EVVAMARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAESSRSSEESSSDSGSSD
FT                   SEEERATRLAELQEQVRVSSPAASHWACATKPSCPSWPRPAILFPFLRLLRPLSVLVE"
FT   gene            24217887..24239265
FT                   /gene="Wdr5"
FT                   /locus_tag="mCG_17875"
FT                   /note="gene_id=mCG17875.1"
FT   mRNA            join(24217887..24218021,24221370..24221533,
FT                   24222090..24222198,24222484..24222557,24223068..24223157,
FT                   24223314..24223403,24223569..24223652,24227864..24227919,
FT                   24231032..24231078,24234397..24234472,24235751..24235784,
FT                   24236095..24236169,24236526..24236613,24237515..24239265)
FT                   /gene="Wdr5"
FT                   /locus_tag="mCG_17875"
FT                   /product="WD repeat domain 5"
FT                   /note="gene_id=mCG17875.1 transcript_id=mCT16951.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(24221453..24221533,24222090..24222198,
FT                   24222484..24222557,24223068..24223157,24223314..24223403,
FT                   24223569..24223652,24227864..24227919,24231032..24231078,
FT                   24234397..24234472,24235751..24235784,24236095..24236169,
FT                   24236526..24236613,24237515..24237615)
FT                   /codon_start=1
FT                   /gene="Wdr5"
FT                   /locus_tag="mCG_17875"
FT                   /product="WD repeat domain 5"
FT                   /note="gene_id=mCG17875.1 transcript_id=mCT16951.1
FT                   protein_id=mCP19530.1"
FT                   /protein_id="EDL08370.1"
FT                   /translation="MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHT
FT                   KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVS
FT                   ASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC
FT                   LKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF
FT                   SPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDN
FT                   LVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC"
FT   gene            24243206..24245872
FT                   /locus_tag="mCG_1030145"
FT                   /note="gene_id=mCG1030145.0"
FT   mRNA            join(24243206..24243278,24245487..24245872)
FT                   /locus_tag="mCG_1030145"
FT                   /product="mCG1030145"
FT                   /note="gene_id=mCG1030145.0 transcript_id=mCT147849.0
FT                   created on 24-FEB-2003"
FT   CDS             24245511..24245642
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030145"
FT                   /product="mCG1030145"
FT                   /note="gene_id=mCG1030145.0 transcript_id=mCT147849.0
FT                   protein_id=mCP51137.1"
FT                   /protein_id="EDL08371.1"
FT                   /translation="MDGTLELPTEINPSFLRCFWSRRFITVTDMKLGHHLSPACAGA"
FT   gene            <24379678..24463625
FT                   /gene="Rxra"
FT                   /locus_tag="mCG_17872"
FT                   /note="gene_id=mCG17872.2"
FT   mRNA            join(<24379678..24379734,24439802..24440067,
FT                   24443556..24443706,24444267..24444446,24451117..24451286,
FT                   24454817..24454946,24456728..24456860,24458704..24458795,
FT                   24460266..24460371,24462046..24463625)
FT                   /gene="Rxra"
FT                   /locus_tag="mCG_17872"
FT                   /product="retinoid X receptor alpha"
FT                   /note="gene_id=mCG17872.2 transcript_id=mCT16948.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<24439804..24440067,24443556..24443706,
FT                   24444267..24444446,24451117..24451286,24454817..24454946,
FT                   24456728..24456860,24458704..24458795,24460266..24460371,
FT                   24462046..24462193)
FT                   /codon_start=1
FT                   /gene="Rxra"
FT                   /locus_tag="mCG_17872"
FT                   /product="retinoid X receptor alpha"
FT                   /note="gene_id=mCG17872.2 transcript_id=mCT16948.2
FT                   protein_id=mCP19450.2"
FT                   /protein_id="EDL08372.1"
FT                   /translation="FSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSP
FT                   ISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKP
FT                   PLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLT
FT                   YTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSAN
FT                   EDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRI
FT                   PHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAI
FT                   FDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYC
FT                   KHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT"
FT   gene            complement(24464293..24465456)
FT                   /locus_tag="mCG_124516"
FT                   /note="gene_id=mCG124516.1"
FT   mRNA            complement(24464293..24465456)
FT                   /locus_tag="mCG_124516"
FT                   /product="mCG124516"
FT                   /note="gene_id=mCG124516.1 transcript_id=mCT125760.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(24464765..24464923)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124516"
FT                   /product="mCG124516"
FT                   /note="gene_id=mCG124516.1 transcript_id=mCT125760.1
FT                   protein_id=mCP50673.1"
FT                   /protein_id="EDL08373.1"
FT                   /translation="MARVQGTPALKHLKIDASPASRESPEPDFPTEGDLRSLLTRSKCT
FT                   GKWESLD"
FT   gene            24589457..24740321
FT                   /gene="Col5a1"
FT                   /locus_tag="mCG_17877"
FT                   /note="gene_id=mCG17877.1"
FT   mRNA            join(24589457..24589696,24624794..24624961,
FT                   24630819..24631032,24632156..24632318,24652391..24652522,
FT                   24653391..24653522,24654051..24654290,24655037..24655210,
FT                   24655733..24655789,24660986..24661027,24661249..24661311,
FT                   24663151..24663225,24664826..24664918,24666832..24666888,
FT                   24668015..24668068,24668361..24668414,24669694..24669747,
FT                   24670903..24670956,24672509..24672562,24674211..24674255,
FT                   24675912..24675965,24676632..24676676,24677208..24677261,
FT                   24677457..24677501,24678319..24678372,24683269..24683313,
FT                   24683834..24683887,24687846..24687890,24689518..24689571,
FT                   24691936..24692043,24692835..24692888,24694791..24694844,
FT                   24698503..24698547,24698658..24698711,24699666..24699710,
FT                   24700360..24700413,24701523..24701576,24704367..24704420,
FT                   24705280..24705387,24706658..24706747,24706839..24706892,
FT                   24707976..24708083,24710545..24710652,24711905..24711958,
FT                   24712821..24712874,24712967..24713074,24713882..24713935,
FT                   24714039..24714146,24715472..24715525,24716257..24716364,
FT                   24716904..24716957,24717167..24717220,24718651..24718704,
FT                   24719236..24719289,24719892..24719999,24720078..24720131,
FT                   24720223..24720276,24721238..24721345,24722734..24722787,
FT                   24723565..24723600,24725078..24725131,24727402..24727657,
FT                   24728390..24728502,24731764..24731832,24735388..24735621,
FT                   24739667..24740321)
FT                   /gene="Col5a1"
FT                   /locus_tag="mCG_17877"
FT                   /product="procollagen, type V, alpha 1"
FT                   /note="gene_id=mCG17877.1 transcript_id=mCT16953.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(24589588..24589696,24624794..24624961,
FT                   24630819..24631032,24632156..24632318,24652391..24652522,
FT                   24653391..24653522,24654051..24654290,24655037..24655210,
FT                   24655733..24655789,24660986..24661027,24661249..24661311,
FT                   24663151..24663225,24664826..24664918,24666832..24666888,
FT                   24668015..24668068,24668361..24668414,24669694..24669747,
FT                   24670903..24670956,24672509..24672562,24674211..24674255,
FT                   24675912..24675965,24676632..24676676,24677208..24677261,
FT                   24677457..24677501,24678319..24678372,24683269..24683313,
FT                   24683834..24683887,24687846..24687890,24689518..24689571,
FT                   24691936..24692043,24692835..24692888,24694791..24694844,
FT                   24698503..24698547,24698658..24698711,24699666..24699710,
FT                   24700360..24700413,24701523..24701576,24704367..24704420,
FT                   24705280..24705387,24706658..24706747,24706839..24706892,
FT                   24707976..24708083,24710545..24710652,24711905..24711958,
FT                   24712821..24712874,24712967..24713074,24713882..24713935,
FT                   24714039..24714146,24715472..24715525,24716257..24716364,
FT                   24716904..24716957,24717167..24717220,24718651..24718704,
FT                   24719236..24719289,24719892..24719999,24720078..24720131,
FT                   24720223..24720276,24721238..24721345,24722734..24722787,
FT                   24723565..24723600,24725078..24725131,24727402..24727657,
FT                   24728390..24728502,24731764..24731832,24735388..24735621,
FT                   24739667..24739813)
FT                   /codon_start=1
FT                   /gene="Col5a1"
FT                   /locus_tag="mCG_17877"
FT                   /product="procollagen, type V, alpha 1"
FT                   /note="gene_id=mCG17877.1 transcript_id=mCT16953.1
FT                   protein_id=mCP19408.2"
FT                   /protein_id="EDL08374.1"
FT                   /translation="MDVHTRWKAARPGALLLSSPLLLFLLLLWAPPSSRAAQPADLLEM
FT                   LDFHNLPSGVTKTTGFCATRRSSSEPDVAYRVSKDAQLSMPTKQLYPESGFPEDFSILT
FT                   TVKAKKGSQAFLVSIYNEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDG
FT                   KWHRIALSVYKKNVTLILDCKKKITKFLSRSDHPIIDTNGIVMFGSRILDDEIFEGDIQ
FT                   QLLFVSDNRAAYDYCEHYSPDCDTAVPDTPQSQDPNPDEYYPEGEGETYYYEYPYYEDP
FT                   EDPGKEPAPTQKPVEAARETTEVPEEQTQPLPEAPTVPETSDTADKEDSLGIGDYDYVP
FT                   PDDYYTPPPYEDFGYGEGVENPDQPTNPDSGAEVPTSTTVTSNTSNPAPGEGKDDLGGE
FT                   FTEETIKNLEENYYDPYFDPDSDSSVSPSEIGPGMPANQDTIFEGIGGPRGEKGQKGEP
FT                   AIIEPGMLIEGPPGPEGPAGLPGPPGTTGPTGQMGDPGERGPPGRPGLPGADGLPGPPG
FT                   TMLMLPFRFGGGGDAGSKGPMVSAQESQAQAILQQARLALRGPAGPMGLTGRPGPMGPP
FT                   GSGGLKGEPGDMGPQGPRGVQGPPGPTGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGL
FT                   AGLPGEKGHRGDPGPSGPPGIPGDDGERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPG
FT                   PPGVTGMDGQPGPKGNVGPQGEPGPPGQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLP
FT                   GMPGADGPPGHPGKEGPPGEKGGQGPPGPQGPIGYPGPRGVKGADGIRGLKGTKGEKGE
FT                   DGFPGFKGDMGIKGDRGEIGPPGPRGEDGPEGPKGRGGPNGDPGPLGPTGEKGKLGVPG
FT                   LPGYPGRQGPKGSIGFPGFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGKP
FT                   GPKGNSGGDGPAGPPGERGPNGPQGPTGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGK
FT                   TGPPGPPGVVGPQGPTGETGPMGERGHPGPPGPPGEQGLPGAAGKEGTKGDPGPAGLPG
FT                   KDGPPGLRGFPGDRGLPGPVGALGLKGSEGPPGPPGPAGSPGERGPAGAAGPIGIPGRP
FT                   GPQGPPGPAGEKGLPGEKGPQGPAGRDGLQGPVGLPGPAGPVGPPGEDGDKGEIGEPGQ
FT                   KGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEPGPRGQQGLFGQKGDEGSRGFPGPPG
FT                   PVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGAPGADGPQGPPGGIGNPGAVGEK
FT                   GEPGEAGDPGLPGEGGPLGPKGERGEKGEAGPSGAAGPPGPKGPPGDDGPKGSPGPVGF
FT                   PGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGEPGPSGPPGKRGPPGPAGPEG
FT                   RQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGIPGPVGEQGLPGSPGPDGPP
FT                   GPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSSGPKGDQGI
FT                   TGPSGPLGPPGPPGLPGPTGPKGAKGSSGPTGPKGEAGHPGLPGPPGPPGEVIQPLPIQ
FT                   ASRTRRNIDASQLLDDGAGESYVDYADGMEEIFGSLNSLKLEIEQMKRPLGTQQNPART
FT                   CKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTCVFPDKKSEGARITSWPK
FT                   ENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQNVTYNCYQSVAWQDAA
FT                   TGSYDKAIRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKTVLEIDTPKVEQVPIVDI
FT                   MFNDFGEASQKFGFEVGPACFLG"
FT   gene            complement(24779179..24787697)
FT                   /gene="Fcnb"
FT                   /locus_tag="mCG_17873"
FT                   /note="gene_id=mCG17873.2"
FT   mRNA            complement(join(24779179..24779624,24781049..24781183,
FT                   24781924..24782053,24782424..24782551,24782703..24782735,
FT                   24783388..24783423,24783698..24783751,24785708..24785821,
FT                   24787593..24787697))
FT                   /gene="Fcnb"
FT                   /locus_tag="mCG_17873"
FT                   /product="ficolin B"
FT                   /note="gene_id=mCG17873.2 transcript_id=mCT16949.2 created
FT                   on 09-OCT-2002"
FT   CDS             complement(join(24779377..24779624,24781049..24781183,
FT                   24781924..24782053,24782424..24782551,24782703..24782735,
FT                   24783388..24783423,24783698..24783751,24785708..24785821,
FT                   24787593..24787659))
FT                   /codon_start=1
FT                   /gene="Fcnb"
FT                   /locus_tag="mCG_17873"
FT                   /product="ficolin B"
FT                   /note="gene_id=mCG17873.2 transcript_id=mCT16949.2
FT                   protein_id=mCP19471.1"
FT                   /protein_id="EDL08375.1"
FT                   /translation="MALGSAALFVLTLTVHAAGTCPELKVLDLEGYKQLTILQGCPGLP
FT                   GAAGPKGEAGAKGDRGESGLPGIPGKEGPTGPKGNQGEKGIRGEKGDSGPSQSCATGPR
FT                   TCKELLTQGHFLTGWYTIYLPDCRPLTVLCDMDTDGGGWTVFQRRLDGSVDFFRDWTSY
FT                   KRGFGSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKL
FT                   ILGNFLGGGAGDSLTPHNNRLFSTKDQDNDGSTSSCAMGYHGAWWYSQCHTSNLNGLYL
FT                   RGPHKSYANGVNWKSWRGYNYSCKVSEMKVRLI"
FT   gene            <24798280..24830528
FT                   /locus_tag="mCG_145107"
FT                   /note="gene_id=mCG145107.0"
FT   mRNA            join(<24798280..24798340,24802603..24802808,
FT                   24812948..24813121,24824269..24824463,24824741..24824866,
FT                   24829429..24829554,24829960..24830104,24830218..24830528)
FT                   /locus_tag="mCG_145107"
FT                   /product="mCG145107"
FT                   /note="gene_id=mCG145107.0 transcript_id=mCT184531.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<24824455..24824463,24824741..24824866,
FT                   24829429..24829539)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145107"
FT                   /product="mCG145107"
FT                   /note="gene_id=mCG145107.0 transcript_id=mCT184531.0
FT                   protein_id=mCP105478.0"
FT                   /protein_id="EDL08376.1"
FT                   /translation="SKEAPAQHGTGPTPDGLPSTESQRHRADPREPQSPTTENTSQSLE
FT                   PPGSDFNVYFVGSVQLHHACTCMTGFCPWTIPLLLK"
FT   gene            24895740..24933255
FT                   /gene="Olfm1"
FT                   /locus_tag="mCG_17880"
FT                   /note="gene_id=mCG17880.2"
FT   mRNA            join(24895740..24896210,24910841..24910990,
FT                   24915328..24915483,24917405..24917624,24925394..24925500,
FT                   24931847..24933255)
FT                   /gene="Olfm1"
FT                   /locus_tag="mCG_17880"
FT                   /product="olfactomedin 1, transcript variant mCT174052"
FT                   /note="gene_id=mCG17880.2 transcript_id=mCT174052.0 created
FT                   on 01-OCT-2002"
FT   CDS             join(24896145..24896210,24910841..24910990,
FT                   24915328..24915483,24917405..24917624,24925394..24925500,
FT                   24931847..24932521)
FT                   /codon_start=1
FT                   /gene="Olfm1"
FT                   /locus_tag="mCG_17880"
FT                   /product="olfactomedin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17880.2 transcript_id=mCT174052.0
FT                   protein_id=mCP96971.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9Q7"
FT                   /db_xref="InterPro:IPR003112"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022082"
FT                   /db_xref="MGI:MGI:1860437"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Q7"
FT                   /protein_id="EDL08377.1"
FT                   /translation="MQPARKLLSLLVLLVMGTELTQVLPTNPEESWQVYSSAQDSEGRC
FT                   ICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGL
FT                   ETKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSV
FT                   LNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWM
FT                   TDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSGTGQVVYNGS
FT                   IYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDENGLWAVY
FT                   ATNQNAGNIVISKLDPVSLQILQTWNTSYPKRSAGEAFIICGTLYVTNGYSGGTKVHYA
FT                   YQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQTLYNVTLFHVIRSDEL"
FT   mRNA            join(24908652..24908862,24910841..24910990,
FT                   24915328..24915483,24917405..24917624,24925394..24925500,
FT                   24931847..24933255)
FT                   /gene="Olfm1"
FT                   /locus_tag="mCG_17880"
FT                   /product="olfactomedin 1, transcript variant mCT16956"
FT                   /note="gene_id=mCG17880.2 transcript_id=mCT16956.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(24908713..24908862,24910841..24910990,
FT                   24915328..24915483,24917405..24917624,24925394..24925500,
FT                   24931847..24932521)
FT                   /codon_start=1
FT                   /gene="Olfm1"
FT                   /locus_tag="mCG_17880"
FT                   /product="olfactomedin 1, isoform CRA_b"
FT                   /note="gene_id=mCG17880.2 transcript_id=mCT16956.1
FT                   protein_id=mCP19686.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8R357"
FT                   /db_xref="InterPro:IPR003112"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022082"
FT                   /db_xref="MGI:MGI:1860437"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R357"
FT                   /protein_id="EDL08378.1"
FT                   /translation="MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTL
FT                   DRSTGVLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNM
FT                   SQSIEVLDRRTQRDLQY