Dbfetch

ID   CH466538; SV 2; linear; genomic DNA; CON; MUS; 38164462 BP.
XX
AC   CH466538;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009746983 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-38164462
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-38164462
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-38164462
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 99a8906fe492aea529312b75fd63b278.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000212.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000003282; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006586; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023267; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028214; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028234; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028245; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028248; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028249; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028274; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028278; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028284; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028287; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028289; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028294; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028298; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028300; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028413; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028415; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036073; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040183; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040296; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041135; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041153; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045751; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047187; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049225; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051279; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066324; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068240; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071014; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071019; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090137; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094695; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095234; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028024; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028026; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028029; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028030; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028031; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028035; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028039; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028043; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028048; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028057; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028058; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028065; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028066; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028075; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028076; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028077; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028086; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028090; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028093; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028103; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028104; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028107; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028108; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028113; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028114; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028116; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028118; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028122; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028130; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028134; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028137; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028138; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028139; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028140; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028148; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028149; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028153; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028154; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028164; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028165; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028172; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033709; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027982; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027984; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027988; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027997; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028001; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028005; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028013; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028023; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028024; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028033; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028035; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028048; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028062; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028065; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028066; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028071; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028072; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028076; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028080; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028081; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028088; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028092; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028095; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028096; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028097; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028098; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028101; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028102; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028106; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028107; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028111; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028112; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028122; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028123; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028130; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027948; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027950; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027953; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027954; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027955; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027959; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027963; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027967; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027971; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027979; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027980; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027981; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027988; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027989; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027998; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027999; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028009; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028013; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028016; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028026; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028029; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028030; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028035; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028036; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028037; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028043; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028051; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028055; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028058; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028059; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028060; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028061; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028064; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028065; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028069; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028070; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028074; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028086; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028093; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027994; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027999; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028000; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028001; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028005; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028009; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028013; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028017; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028025; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028026; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028027; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028034; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028035; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028044; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028045; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028046; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028055; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028062; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028072; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028075; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028077; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028082; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028085; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028087; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028091; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028092; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028099; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028103; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028107; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028108; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028109; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028113; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028114; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028118; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028123; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028124; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028134; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028135; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028143; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027724; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027726; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027729; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027730; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027731; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027735; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027739; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027747; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027755; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027756; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027757; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027764; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027765; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027775; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027776; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027785; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027792; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027803; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027806; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027807; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027814; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027820; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027821; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027828; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027835; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027836; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027837; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027838; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027842; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027846; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027847; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027851; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027852; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027863; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027881; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033398; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028437; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028439; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028442; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028443; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028444; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028448; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028452; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028460; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028468; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028478; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028479; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028487; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028488; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028489; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028498; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028502; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028505; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028516; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028518; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028519; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028524; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028525; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028529; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028533; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028534; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028541; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028545; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028548; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028550; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028551; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028554; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028555; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028560; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028564; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028565; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028575; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028576; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028584; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027177; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027179; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027182; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027183; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027184; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027188; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027193; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027197; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027201; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027209; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027210; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027219; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027220; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027229; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027230; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027231; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027240; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027247; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027258; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027260; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027261; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027266; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027267; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027269; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027271; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027275; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027276; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027283; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027287; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027292; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027293; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027294; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027295; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027297; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027302; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027303; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027307; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027308; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027318; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027319; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027326; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027699; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027701; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027704; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027705; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027706; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027710; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027714; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027722; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027730; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027731; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027732; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027737; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027738; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027747; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027748; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027758; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027762; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027765; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027776; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027779; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027784; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027785; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027792; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027800; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027804; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027807; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027809; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027810; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027813; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027818; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027819; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027823; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027824; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027834; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027835; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027843; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027839; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027841; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027844; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027845; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027846; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027850; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027854; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027863; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027871; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027872; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027873; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027880; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027890; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027891; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027892; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027901; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027905; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027908; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027919; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027922; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027923; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027928; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027929; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027930; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027932; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027937; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027944; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027948; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027951; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027953; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027954; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027958; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027962; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027963; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027967; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027968; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033530; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027806; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027808; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027811; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027812; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027813; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027817; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027821; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027825; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027829; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027837; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027838; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027839; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027846; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027856; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027857; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027858; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027867; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027871; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027874; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027887; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027893; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027894; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027896; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027898; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027902; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027910; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027918; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027919; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027920; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027924; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027925; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027929; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027934; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027945; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027946; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027954; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033471; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027950; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027952; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027956; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027957; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027965; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027969; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027973; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027981; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027982; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027983; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027989; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027990; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027999; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028000; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028001; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028010; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028014; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028017; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028028; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028030; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028031; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028036; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028037; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028040; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028044; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028045; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028052; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028056; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028060; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028061; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028062; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028065; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028066; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028070; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028071; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028075; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028076; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028086; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028087; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028095; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027839; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027841; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027844; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027845; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027846; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027850; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027854; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027858; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027870; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027871; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027872; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027879; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027880; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027889; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027891; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027900; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027904; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027907; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027921; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027926; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027929; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027931; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027935; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027936; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027943; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027947; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027951; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027952; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027953; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027954; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027957; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027958; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027962; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027963; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027967; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027968; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027979; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027986; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028496; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028498; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028502; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028503; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028507; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028515; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028519; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028527; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028528; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028537; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028538; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028546; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028547; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028548; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028557; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028561; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028564; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028575; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028577; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028578; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028583; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028584; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028586; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028592; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028593; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028600; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028604; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028607; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028608; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028609; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028610; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028613; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028614; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028618; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028619; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028623; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028624; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028634; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028635; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028642; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026905; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026914; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026918; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026930; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026931; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026932; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026939; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026940; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026949; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026950; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026951; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026960; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026978; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026980; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026981; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026986; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026987; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026988; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026990; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026994; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027006; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027009; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027013; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027015; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027016; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027021; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027022; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027026; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027037; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027038; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027045; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032431; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027257; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027259; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027262; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027263; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027264; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027272; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027276; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027280; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027288; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027289; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027290; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027298; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027306; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027307; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027308; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027317; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027321; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027324; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027334; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027335; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027337; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027338; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027343; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027344; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027345; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027347; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027351; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027352; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027359; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027363; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027367; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027368; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027369; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027370; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027373; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027374; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027378; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027379; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027383; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027384; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027394; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027395; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027402; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024035; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029881; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029942; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030136; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037035; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084695; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084750; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095128; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098190; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102973; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108002; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108052; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108136; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164772; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179526; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185029; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064564; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064569; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064590; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064592; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064631; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064669; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064728; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064730; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064732; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064760; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064766; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064787; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064792; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064794; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064812; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064823; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064840; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064890; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064893; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064901; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064909; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064941; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064944; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064950; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064955; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064964; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064967; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065002; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065019; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065025; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065031; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065041; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065042; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065056; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065059; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065080; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065082; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065095; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065099; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065145; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065171; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089211; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0064592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064618; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064620; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064622; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064635; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064659; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064696; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064711; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064754; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064756; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064817; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064824; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064842; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064855; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064872; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064925; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064933; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064941; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064972; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064975; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064981; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064986; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064995; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0064998; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065033; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065050; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065056; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065062; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065072; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065073; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065088; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065090; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065112; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065114; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065127; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065172; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065178; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065204; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064535; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064539; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064560; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064562; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064564; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064577; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064601; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064638; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064653; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064698; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064700; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064729; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064735; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064757; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064762; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064764; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064782; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064812; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064862; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064865; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064872; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064880; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064911; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064914; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064920; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064925; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064934; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064937; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064972; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064989; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0064995; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065001; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065011; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065012; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065027; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065029; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065051; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065053; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065070; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065111; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065117; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065140; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064512; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064517; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064538; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064542; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064555; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064579; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064616; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064674; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064676; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064708; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064736; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064741; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064743; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064774; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064841; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064844; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064851; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064860; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064891; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064894; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064901; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064906; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064915; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064952; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064969; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064976; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064982; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064993; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065008; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065010; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065032; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065034; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065047; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065051; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065092; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065098; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065125; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064202; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064207; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064228; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064230; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064232; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064269; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064321; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064366; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064398; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064404; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064427; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064434; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064452; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064463; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064480; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064534; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064542; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064550; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064584; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064590; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064595; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064604; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064642; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064659; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064665; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064671; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064681; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064682; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064697; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064699; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064719; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064721; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064734; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064738; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064779; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064785; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064852; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0088801; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065008; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065012; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065033; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065035; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065037; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065050; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065111; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065126; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065172; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065174; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065202; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065208; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065228; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065233; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065235; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065253; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065264; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065281; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065334; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065341; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065349; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065380; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065390; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065395; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065404; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065407; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065442; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065465; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065471; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065481; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065482; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065496; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065498; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065518; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065520; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065533; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065537; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065579; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065584; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065611; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064525; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064546; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064550; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064564; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064589; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064625; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064642; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064691; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064693; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064731; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064757; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064762; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064765; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064785; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064797; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064814; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064873; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064881; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064890; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064926; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064929; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064936; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064942; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064953; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064991; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065010; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065015; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065021; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065031; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065032; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065037; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065048; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065050; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065070; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065073; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065085; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065089; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065131; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065136; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065164; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0064160; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064164; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064185; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064189; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064226; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064263; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064278; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064321; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064323; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064349; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064355; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064377; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064384; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064402; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064413; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064430; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064483; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064490; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064498; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064529; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064532; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064538; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064545; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064554; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064591; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064614; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064620; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064630; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064631; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064646; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064648; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064670; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064672; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064685; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064689; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064730; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064736; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0064763; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0064274; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064278; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064299; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064301; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064303; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064316; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064340; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064377; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064436; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064438; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064440; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064470; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064476; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064498; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064503; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064523; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064536; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064553; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064606; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064614; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064653; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064656; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064662; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064667; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064676; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064679; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064714; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064731; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064737; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064753; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064754; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064768; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064770; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064793; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064795; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064808; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064812; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064853; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064859; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0064886; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0088944; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0064231; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064235; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064256; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064258; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064260; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064297; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064334; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064349; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064391; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064393; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064395; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064421; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064427; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064449; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064454; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064474; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064485; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064502; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064555; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064560; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064568; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064602; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064609; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064624; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064627; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064662; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064679; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064686; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064692; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064702; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064703; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064718; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064720; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064743; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064745; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064758; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064762; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064802; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064807; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0064834; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0088781; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064417; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064421; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064442; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064444; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064446; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064459; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064483; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064520; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064535; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064578; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064580; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064582; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064606; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064612; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064634; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064639; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064641; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064659; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064670; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064687; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064736; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064739; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064754; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064788; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064794; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064799; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064808; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064811; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064846; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064863; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064869; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064875; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064885; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064886; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064901; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064903; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064926; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064945; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064986; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0064991; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065018; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064232; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064257; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064274; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064298; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064350; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064394; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064396; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064422; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064428; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064450; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064455; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064457; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064504; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064557; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064564; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064572; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064603; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064606; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064618; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064627; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064630; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064665; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064682; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064689; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064696; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064706; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064707; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064722; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064724; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064745; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064760; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064764; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064834; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065223; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065227; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065248; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065250; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065265; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065289; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065326; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065341; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065384; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065386; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065388; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065418; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065424; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065444; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065449; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065451; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065469; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065497; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065549; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065556; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065596; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065599; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065606; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065611; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065620; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065623; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065658; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065675; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065681; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065687; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065697; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065698; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065713; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065715; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065737; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065739; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065752; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065756; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065797; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065802; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065828; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090053; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064049; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064053; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064074; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064076; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064078; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064118; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064154; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064170; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064215; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064217; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064219; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064248; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064280; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064285; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064287; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064305; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064313; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064331; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064390; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064397; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064406; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064441; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064444; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064452; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064458; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064468; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064471; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064510; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064534; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064540; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064550; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064551; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064555; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064567; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064569; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064596; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064609; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064612; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064655; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064660; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064683; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088766; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063459; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063463; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063484; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063486; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063488; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063501; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063525; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063562; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063577; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063620; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063622; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063624; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063652; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063658; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063683; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063685; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063703; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063714; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063731; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063781; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063784; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063791; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063799; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063830; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063839; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063845; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063854; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063857; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063892; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063909; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063916; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063922; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063932; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063933; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063948; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063950; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063972; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063974; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063987; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063990; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064031; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064036; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064062; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980442.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..38164462
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1533..5145
FT                   /estimated_length=3613
FT                   /gap_type="unknown"
FT   assembly_gap    6486..8868
FT                   /estimated_length=2383
FT                   /gap_type="unknown"
FT   assembly_gap    18677..18820
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    48172..48191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            50307..54943
FT                   /pseudo
FT                   /locus_tag="mCG_52831"
FT                   /note="gene_id=mCG52831.2"
FT   mRNA            join(50307..50452,51499..51680,54536..54943)
FT                   /pseudo
FT                   /locus_tag="mCG_52831"
FT                   /note="gene_id=mCG52831.2 transcript_id=mCT53014.2 created
FT                   on 27-MAR-2003"
FT   assembly_gap    50570..50589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    51737..51756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    53132..53151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    54275..54294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    62337..62937
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    78255..78274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    80911..81044
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    82772..83673
FT                   /estimated_length=902
FT                   /gap_type="unknown"
FT   assembly_gap    101393..101529
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    102623..104457
FT                   /estimated_length=1835
FT                   /gap_type="unknown"
FT   assembly_gap    112949..112968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    115177..115316
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    122757..122993
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    124166..126162
FT                   /estimated_length=1997
FT                   /gap_type="unknown"
FT   assembly_gap    133681..133721
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    138163..138182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    142723..142742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    147214..147233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    148238..150098
FT                   /estimated_length=1861
FT                   /gap_type="unknown"
FT   assembly_gap    152348..152886
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    155778..159874
FT                   /estimated_length=4097
FT                   /gap_type="unknown"
FT   assembly_gap    163140..201490
FT                   /estimated_length=38351
FT                   /gap_type="unknown"
FT   assembly_gap    203516..203535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    205344..205499
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    206708..210827
FT                   /estimated_length=4120
FT                   /gap_type="unknown"
FT   assembly_gap    212831..212850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(213354..240035)
FT                   /gene="Tmem68"
FT                   /locus_tag="mCG_10917"
FT                   /note="gene_id=mCG10917.2"
FT   mRNA            complement(join(213354..214889,216062..216201,
FT                   218779..218839,224941..225134,228535..228699,
FT                   233777..234165,234734..234785,239913..240035))
FT                   /gene="Tmem68"
FT                   /locus_tag="mCG_10917"
FT                   /product="transmembrane protein 68, transcript variant
FT                   mCT10718"
FT                   /note="gene_id=mCG10917.2 transcript_id=mCT10718.2 created
FT                   on 07-DEC-2002"
FT   mRNA            complement(join(213588..214889,216062..216201,
FT                   218779..218839,224941..225134,226461..226587,
FT                   228535..228699,233777..234165,234734..234785,
FT                   239913..>240020))
FT                   /gene="Tmem68"
FT                   /locus_tag="mCG_10917"
FT                   /product="transmembrane protein 68, transcript variant
FT                   mCT189836"
FT                   /note="gene_id=mCG10917.2 transcript_id=mCT189836.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(214785..214889,216062..216201,
FT                   218779..218839,224941..225134,228535..228699,
FT                   233777..234101))
FT                   /codon_start=1
FT                   /gene="Tmem68"
FT                   /locus_tag="mCG_10917"
FT                   /product="transmembrane protein 68, isoform CRA_a"
FT                   /note="gene_id=mCG10917.2 transcript_id=mCT10718.2
FT                   protein_id=mCP1178.2 isoform=CRA_a"
FT                   /protein_id="EDL05719.1"
FT                   /translation="MIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQLEDYLNFANHLL
FT                   WVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHA
FT                   AVWHGYEVHGMEKIPEGAALIIFYHGAIPIDFYYFMAKIFIQKGRTCRVVADHFVFKIP
FT                   GFSLLLDVFCALHGPREKCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQV
FT                   AIDAKVPIIPMFTQNIREGFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPI
FT                   PYDPKVTAEELAEKTKNAVQALIDKHQRIPGNIRSALLDRFHKEQKAH"
FT   CDS             complement(join(226565..226587,228535..228699,
FT                   233777..>234137))
FT                   /codon_start=1
FT                   /gene="Tmem68"
FT                   /locus_tag="mCG_10917"
FT                   /product="transmembrane protein 68, isoform CRA_b"
FT                   /note="gene_id=mCG10917.2 transcript_id=mCT189836.0
FT                   protein_id=mCP110811.0 isoform=CRA_b"
FT                   /protein_id="EDL05720.1"
FT                   /translation="RKRQDLGFSSKNMIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQ
FT                   LEDYLNFANHLLWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGA
FT                   RKTVATLWDGHAAVWHGYEVHGMEKIPEGAALIIFYHGAIPIDFYYFMAKIFIQKGRTC
FT                   RVVADHFVFKIPVETSQES"
FT   assembly_gap    233373..233392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            240084..281557
FT                   /gene="Ncoa6ip"
FT                   /locus_tag="mCG_10916"
FT                   /note="gene_id=mCG10916.3"
FT   mRNA            join(240084..240338,248630..248694,250237..250394,
FT                   250658..251471,254353..254470,256441..256527,
FT                   258673..258850,260568..260868,263810..263959,
FT                   267443..267586,269995..270211,271119..271197,
FT                   279796..281557)
FT                   /gene="Ncoa6ip"
FT                   /locus_tag="mCG_10916"
FT                   /product="nuclear receptor coactivator 6 interacting
FT                   protein"
FT                   /note="gene_id=mCG10916.3 transcript_id=mCT10716.3 created
FT                   on 13-DEC-2002"
FT   CDS             join(240235..240338,248630..248694,250237..250394,
FT                   250658..251471,254353..254470,256441..256527,
FT                   258673..258850,260568..260868,263810..263959,
FT                   267443..267586,269995..270211,271119..271197,
FT                   279796..279942)
FT                   /codon_start=1
FT                   /gene="Ncoa6ip"
FT                   /locus_tag="mCG_10916"
FT                   /product="nuclear receptor coactivator 6 interacting
FT                   protein"
FT                   /note="gene_id=mCG10916.3 transcript_id=mCT10716.3
FT                   protein_id=mCP1175.3"
FT                   /protein_id="EDL05718.1"
FT                   /translation="MCCEKWNHVAEMLLFIEDREEEYKILCLCSRAFVEDRKLYNLGLK
FT                   GYYVKSSGNNAGDQGTEEEEDGHSNGTAESHSPNESDLDSEAKLMRSMGLPIQFGRMSS
FT                   HENFEMSMNARNKAKVKQKRRKHQKRYLDEMVRESWRNDYEEDDLVVSDDPSSVEHCEN
FT                   NRTCEIQSKAGSEVENLPVENTLAPKLEVPENWEKYWNEYGEGLLWQSWQEKYPDQTLS
FT                   SEPWNLPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFTASQNCDKDVYTSHTEVDQNA
FT                   ESSLKADVMTFSSSPNIVEDEIPGSNDNDHNEIITAINNITVSAEKVEQSQLDSSQHCD
FT                   EPLSEITGKECPASGGSDSCNGTPKENDISENRSSDQPAKELQESSGTNKGKHRPHHNG
FT                   ADGHESDDDPPEHKPSKVKRSHELDVDENPDSEVDDNGFLLGFKHGSGQKYGGIPNFSH
FT                   RQVRYLEKNVKYKSKYLDLRKQMPVKSKHILFTEDSGKPFVVCKSKVRSKVEKFLKWVN
FT                   ERVDEETSQDSLSQNKMQDTCTSSDSEEQDMSLEKADNLMETRDPEPEKCQIISSATEL
FT                   EAEKSEVGSLVATVPENCSTEEIPNSPHAETEVEIKKKKKKNKNKKINDLPPEIASVPE
FT                   LAKYWAQRYRLFSRFDDGIKLDKEGWFSVTPEKIAEHIAGRVSQAFRCDVVVDAFCGVG
FT                   GNTIQFALTGKRVIAIDIDPVKIDLARNNAEVYGIADKIEFICGDFLLLAPCLKADVVF
FT                   LSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSQKITNNIVYFLPRNADIDQVASLAGL
FT                   GGQVEIEQNFLNNKLKTITAYFGDLIRRPALLKTSTSEAEV"
FT   assembly_gap    308027..308046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <322029..328778
FT                   /locus_tag="mCG_1043308"
FT                   /note="gene_id=mCG1043308.1"
FT   mRNA            join(<322029..322172,322989..323357,324932..325001,
FT                   328496..328778)
FT                   /locus_tag="mCG_1043308"
FT                   /product="mCG1043308"
FT                   /note="gene_id=mCG1043308.1 transcript_id=mCT161012.1
FT                   created on 10-JAN-2003"
FT   assembly_gap    322451..322897
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   CDS             join(<323241..323357,324932..324982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043308"
FT                   /product="mCG1043308"
FT                   /note="gene_id=mCG1043308.1 transcript_id=mCT161012.1
FT                   protein_id=mCP67593.1"
FT                   /protein_id="EDL05717.1"
FT                   /translation="IGCSSHNSKSYPWPVTEERITLSRHPCGMADSLSHANKQQLGSWA
FT                   RWMTASLRPA"
FT   gene            343663..468136
FT                   /gene="Lyn"
FT                   /locus_tag="mCG_3575"
FT                   /note="gene_id=mCG3575.2"
FT   mRNA            join(343663..343902,412603..412739,416328..416373,
FT                   417083..417188,419204..419302,419409..419512,
FT                   420597..420746,422546..422712,432321..432407,
FT                   457440..457593,459498..459629,466265..468136)
FT                   /gene="Lyn"
FT                   /locus_tag="mCG_3575"
FT                   /product="Yamaguchi sarcoma viral (v-yes-1) oncogene
FT                   homolog, transcript variant mCT178982"
FT                   /note="gene_id=mCG3575.2 transcript_id=mCT178982.0 created
FT                   on 22-JAN-2003"
FT   mRNA            join(343663..343902,412603..412676,416328..416373,
FT                   417083..417188,419204..419302,419409..419512,
FT                   420597..420746,422546..422712,432321..432407,
FT                   457440..457593,459498..459629,466265..468136)
FT                   /gene="Lyn"
FT                   /locus_tag="mCG_3575"
FT                   /product="Yamaguchi sarcoma viral (v-yes-1) oncogene
FT                   homolog, transcript variant mCT3323"
FT                   /note="gene_id=mCG3575.2 transcript_id=mCT3323.2 created on
FT                   22-JAN-2003"
FT   assembly_gap    364428..364447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    365636..365898
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    373435..380767
FT                   /estimated_length=7333
FT                   /gap_type="unknown"
FT   gene            complement(394052..394736)
FT                   /pseudo
FT                   /locus_tag="mCG_10919"
FT                   /note="gene_id=mCG10919.2"
FT   mRNA            complement(394052..394736)
FT                   /pseudo
FT                   /locus_tag="mCG_10919"
FT                   /note="gene_id=mCG10919.2 transcript_id=mCT10720.2 created
FT                   on 31-JAN-2003"
FT   CDS             join(412608..412739,416328..416373,417083..417188,
FT                   419204..419302,419409..419512,420597..420746,
FT                   422546..422712,432321..432407,457440..457593,
FT                   459498..459629,466265..466467)
FT                   /codon_start=1
FT                   /gene="Lyn"
FT                   /locus_tag="mCG_3575"
FT                   /product="Yamaguchi sarcoma viral (v-yes-1) oncogene
FT                   homolog, isoform CRA_a"
FT                   /note="gene_id=mCG3575.2 transcript_id=mCT178982.0
FT                   protein_id=mCP101904.0 isoform=CRA_a"
FT                   /protein_id="EDL05715.1"
FT                   /translation="MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPV
FT                   PEFHLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKS
FT                   LSSKREGFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKG
FT                   SFSLSVRDYDPMHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRL
FT                   EKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGECSTLSAGSLLDFLKSD
FT                   EGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIE
FT                   DNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADV
FT                   MSALSQGYRMPRMENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQ
FT                   P"
FT   CDS             join(412608..412676,416328..416373,417083..417188,
FT                   419204..419302,419409..419512,420597..420746,
FT                   422546..422712,432321..432407,457440..457593,
FT                   459498..459629,466265..466467)
FT                   /codon_start=1
FT                   /gene="Lyn"
FT                   /locus_tag="mCG_3575"
FT                   /product="Yamaguchi sarcoma viral (v-yes-1) oncogene
FT                   homolog, isoform CRA_b"
FT                   /note="gene_id=mCG3575.2 transcript_id=mCT3323.2
FT                   protein_id=mCP4495.2 isoform=CRA_b"
FT                   /protein_id="EDL05716.1"
FT                   /translation="MGCIKSKRKDNLNDDEVDSKTQPVPEFHLLPGQRFQTKDPEEQGD
FT                   IVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAKVNTLE
FT                   TEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVIKHYK
FT                   IRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAWEIP
FT                   RESIKLVKKLGAGQFGEVWMGECSTLSAGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGM
FT                   AYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEA
FT                   INFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELY
FT                   DIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP"
FT   assembly_gap    426452..431983
FT                   /estimated_length=5532
FT                   /gap_type="unknown"
FT   assembly_gap    447921..448175
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    453397..453416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    455006..456298
FT                   /estimated_length=1293
FT                   /gap_type="unknown"
FT   assembly_gap    465317..465336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    468976..469110
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    481805..481991
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    485150..487912
FT                   /estimated_length=2763
FT                   /gap_type="unknown"
FT   assembly_gap    495992..496011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    501343..501451
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(506614..510649)
FT                   /locus_tag="mCG_3574"
FT                   /note="gene_id=mCG3574.2"
FT   mRNA            complement(join(506614..509728,509984..510057,
FT                   510240..510339,510533..510649))
FT                   /locus_tag="mCG_3574"
FT                   /product="mCG3574"
FT                   /note="gene_id=mCG3574.2 transcript_id=mCT3324.2 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(509546..509728,509984..510057,
FT                   510240..510339,510533..510535))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3574"
FT                   /product="mCG3574"
FT                   /note="gene_id=mCG3574.2 transcript_id=mCT3324.2
FT                   protein_id=mCP4494.2"
FT                   /db_xref="GOA:Q5BLK2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="MGI:MGI:1914677"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLK2"
FT                   /protein_id="EDL05714.1"
FT                   /translation="MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKE
FT                   KNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSI
FT                   SIEPGVEVEVTIADA"
FT   assembly_gap    511140..511342
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    520431..520664
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    524149..524211
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    525728..526702
FT                   /estimated_length=975
FT                   /gap_type="unknown"
FT   assembly_gap    531461..531864
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   gene            complement(<546550..>547828)
FT                   /locus_tag="mCG_6480"
FT                   /note="gene_id=mCG6480.2"
FT   mRNA            complement(join(<546550..546858,547014..>547828))
FT                   /locus_tag="mCG_6480"
FT                   /product="mCG6480"
FT                   /note="gene_id=mCG6480.2 transcript_id=mCT5799.2 created on
FT                   27-AUG-2002"
FT   CDS             complement(join(546550..546858,547014..>547781))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6480"
FT                   /product="mCG6480"
FT                   /note="gene_id=mCG6480.2 transcript_id=mCT5799.2
FT                   protein_id=mCP18414.2"
FT                   /protein_id="EDL05713.1"
FT                   /translation="EGSNLQPCSQTSLAVPTHFSLVSHVTVPSEGVMPSPLSLCRYLPR
FT                   ELSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDWEQVCLMHRLGSG
FT                   GFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNIVRVVAASTRTP
FT                   EDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLDVVNGLLFLH
FT                   SQSILHLDLKPANILISEQDVCKISDFGCSQKLQHQAPEILKGEIATPKADIYSFGITL
FT                   WQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAVFTASLTGKTLQNIIQSCWEARALQR
FT                   PGAELLQRDLKAFRGALG"
FT   assembly_gap    546888..546983
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    569168..569222
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            complement(579534..581607)
FT                   /locus_tag="mCG_6479"
FT                   /note="gene_id=mCG6479.0"
FT   mRNA            complement(join(579534..580846,581346..581607))
FT                   /locus_tag="mCG_6479"
FT                   /product="mCG6479"
FT                   /note="gene_id=mCG6479.0 transcript_id=mCT5785.0 created on
FT                   05-AUG-2002"
FT   CDS             complement(join(579589..580846,581346..581587))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6479"
FT                   /product="mCG6479"
FT                   /note="gene_id=mCG6479.0 transcript_id=mCT5785.0
FT                   protein_id=mCP18413.1"
FT                   /db_xref="GOA:Q9QYE0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR027765"
FT                   /db_xref="InterPro:IPR027775"
FT                   /db_xref="MGI:MGI:1891916"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYE0"
FT                   /protein_id="EDL05712.1"
FT                   /translation="MATVIPGDLSEVRDTQKAPSGKRKRGESKPRKNFPCQLCDKAFNS
FT                   VEKLKVHSFSHTGERPYKCTHQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRK
FT                   DHLKNHLHTHDPNKETFKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQNFESTG
FT                   VLLEHLKSHAGKSSGGVKEKKHQCEHCERRFYTRKDVRRHMVVHTGRKDFLCQYCAQRF
FT                   GRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKP
FT                   FTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDAVHPSHHLAFKCPFSSTS
FT                   YAISIPEKEQPLKGEIESYLMELQGGAPSSSQDSPASSSKLGLEPQSGSPDDGAGDLSL
FT                   SKSSISISDPLSTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPTQ
FT                   TQDLQDPANTVGLSSLHSLSAAFTSSLSSSTTLPRFHQAFQ"
FT   gene            complement(587757..614397)
FT                   /locus_tag="mCG_147159"
FT                   /note="gene_id=mCG147159.0"
FT   mRNA            complement(join(587757..591625,614216..614397))
FT                   /locus_tag="mCG_147159"
FT                   /product="mCG147159"
FT                   /note="gene_id=mCG147159.0 transcript_id=mCT187422.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(591175..591339)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147159"
FT                   /product="mCG147159"
FT                   /note="gene_id=mCG147159.0 transcript_id=mCT187422.0
FT                   protein_id=mCP108354.0"
FT                   /protein_id="EDL05711.1"
FT                   /translation="MAKSGLASENKAIVKLVGFFSSSLRPQMSSQTLDLLNIPEGKTTL
FT                   WNHCVHVLR"
FT   assembly_gap    614406..614566
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            614739..619377
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /note="gene_id=mCG6481.2"
FT   mRNA            join(614739..614814,615231..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178442"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178442.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(614739..614814,615276..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178445"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178445.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(614760..614983,615231..615378,616630..616734,
FT                   617097..617162,618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178446"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178446.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(614760..614983,615276..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178443"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178443.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(614765..614983,615231..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT5786"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT5786.2 created on
FT                   10-JAN-2003"
FT   mRNA            join(614777..614969,615231..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178444"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178444.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(614777..614969,615276..615378,617097..617162,
FT                   618572..618670,619239..619377)
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, transcript variant mCT178447"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178447.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178443.0
FT                   protein_id=mCP101366.0 isoform=CRA_a"
FT                   /protein_id="EDL05704.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178445.0
FT                   protein_id=mCP101365.0 isoform=CRA_a"
FT                   /protein_id="EDL05705.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178446.0
FT                   protein_id=mCP101367.0 isoform=CRA_a"
FT                   /protein_id="EDL05706.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178447.0
FT                   protein_id=mCP101364.0 isoform=CRA_a"
FT                   /protein_id="EDL05707.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT5786.2
FT                   protein_id=mCP18415.2 isoform=CRA_a"
FT                   /protein_id="EDL05708.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178444.0
FT                   protein_id=mCP101368.0 isoform=CRA_a"
FT                   /protein_id="EDL05709.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   CDS             join(617109..617162,618572..618670,619239..619343)
FT                   /codon_start=1
FT                   /gene="Chchd7"
FT                   /locus_tag="mCG_6481"
FT                   /product="coiled-coil-helix-coiled-coil-helix domain
FT                   containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG6481.2 transcript_id=mCT178442.0
FT                   protein_id=mCP101369.0 isoform=CRA_a"
FT                   /protein_id="EDL05710.1"
FT                   /translation="MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYK
FT                   NCRRFWNSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY"
FT   assembly_gap    622190..623878
FT                   /estimated_length=1689
FT                   /gap_type="unknown"
FT   assembly_gap    647996..648015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(649026..649763)
FT                   /locus_tag="mCG_6478"
FT                   /note="gene_id=mCG6478.2"
FT   mRNA            complement(649026..649763)
FT                   /locus_tag="mCG_6478"
FT                   /product="mCG6478"
FT                   /note="gene_id=mCG6478.2 transcript_id=mCT5797.2 created on
FT                   31-JAN-2003"
FT   CDS             complement(649110..649496)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6478"
FT                   /product="mCG6478"
FT                   /note="gene_id=mCG6478.2 transcript_id=mCT5797.2
FT                   protein_id=mCP18412.1"
FT                   /db_xref="GOA:Q5M9K3"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9K3"
FT                   /protein_id="EDL05703.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   gene            complement(654188..654684)
FT                   /pseudo
FT                   /locus_tag="mCG_1043006"
FT                   /note="gene_id=mCG1043006.1"
FT   mRNA            complement(654188..654684)
FT                   /pseudo
FT                   /locus_tag="mCG_1043006"
FT                   /note="gene_id=mCG1043006.1 transcript_id=mCT160710.1
FT                   created on 03-MAR-2003"
FT   assembly_gap    664176..664195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    671753..671772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(671889..694234)
FT                   /gene="Rdhe2"
FT                   /locus_tag="mCG_125456"
FT                   /note="gene_id=mCG125456.1"
FT   mRNA            complement(join(671889..672202,683111..683236,
FT                   684195..684339,687921..688020,689938..690069,
FT                   693705..694234))
FT                   /gene="Rdhe2"
FT                   /locus_tag="mCG_125456"
FT                   /product="retinal short chain dehydrogenase reductase 2"
FT                   /note="gene_id=mCG125456.1 transcript_id=mCT126717.1
FT                   created on 31-JAN-2003"
FT   CDS             complement(join(672109..672202,683111..683236,
FT                   684195..684339,687921..688020,689938..690069,
FT                   693705..694037))
FT                   /codon_start=1
FT                   /gene="Rdhe2"
FT                   /locus_tag="mCG_125456"
FT                   /product="retinal short chain dehydrogenase reductase 2"
FT                   /note="gene_id=mCG125456.1 transcript_id=mCT126717.1
FT                   protein_id=mCP67712.1"
FT                   /protein_id="EDL05702.1"
FT                   /translation="MSQNLESVKNLLVFLGKSLLSVLEALLFHVISKPRKNVAGEIVLI
FT                   TGAGSGLGRLLALQFARLGAVLVLWDVNKEANDETHQLAREAGAARVHAYTCDCSRREE
FT                   VYRVADQVKKEVGDVSILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPA
FT                   MIANNHGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMFIETLAKKQWGIKTTIVC
FT                   PFFIKTGMFEGCTTKCPTLLPILDPEYAVRKIIDAILQEQLYLYMPKFLYFIVFLKSIL
FT                   PIKTGILIADYLGVFHMTEGFTGQKKKT"
FT   assembly_gap    673553..673572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    674706..674725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    706791..706810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    708129..708148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    711014..712602
FT                   /estimated_length=1589
FT                   /gap_type="unknown"
FT   assembly_gap    720562..721318
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    722701..722720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(734392..755980)
FT                   /locus_tag="mCG_51169"
FT                   /note="gene_id=mCG51169.2"
FT   mRNA            complement(join(734392..735366,737223..737348,
FT                   741086..741230,741688..741787,748361..748492,
FT                   755062..755408,755909..755980))
FT                   /locus_tag="mCG_51169"
FT                   /product="mCG51169"
FT                   /note="gene_id=mCG51169.2 transcript_id=mCT51352.2 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(735240..735366,737223..737348,
FT                   741086..741230,741688..741787,748361..748492,
FT                   755062..755382))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51169"
FT                   /product="mCG51169"
FT                   /note="gene_id=mCG51169.2 transcript_id=mCT51352.2
FT                   protein_id=mCP39055.2"
FT                   /db_xref="GOA:Q05A13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:2685269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05A13"
FT                   /protein_id="EDL05701.1"
FT                   /translation="MNSVADTAIFFGKFLYYFLESLVFKVIPKRKKDVSGEIVLITGAG
FT                   SGLGRLLAIHFASHGATLVLWDINQEGNMETCRLVKQKGDVKVFAYKCDCSSRIEVYRV
FT                   ADQVKEEVGDVTILINNAGVVTGKSFLNTPDHLVEKSFLVNAISHFWTCKAFLPAMVKA
FT                   NHGHLVCISSIAGLVGINGLSDYSSSKFAAFGFAESLFLELTMIMKTKVKSTIVCPYFI
FT                   KTGMFEGCTTKYPLLLPLLEQEYVAQKIFNAILEEQVYLIIPKFAYVALFLKQIISPKM
FT                   MIALGEYLGVDTCMTSFTGRVKAEELQMETKRKEQ"
FT   assembly_gap    740395..740414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    761558..763195
FT                   /estimated_length=1638
FT                   /gap_type="unknown"
FT   assembly_gap    769454..769473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    800542..800890
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   gene            complement(812112..817406)
FT                   /gene="Penk1"
FT                   /locus_tag="mCG_17613"
FT                   /note="gene_id=mCG17613.2"
FT   mRNA            complement(join(812112..813082,816581..816721,
FT                   817210..817406))
FT                   /gene="Penk1"
FT                   /locus_tag="mCG_17613"
FT                   /product="preproenkephalin 1, transcript variant mCT14267"
FT                   /note="gene_id=mCG17613.2 transcript_id=mCT14267.2 created
FT                   on 21-JAN-2003"
FT   mRNA            complement(join(812112..813082,816581..817014))
FT                   /gene="Penk1"
FT                   /locus_tag="mCG_17613"
FT                   /product="preproenkephalin 1, transcript variant mCT178973"
FT                   /note="gene_id=mCG17613.2 transcript_id=mCT178973.0 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(812414..813082,816581..816718))
FT                   /codon_start=1
FT                   /gene="Penk1"
FT                   /locus_tag="mCG_17613"
FT                   /product="preproenkephalin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17613.2 transcript_id=mCT14267.2
FT                   protein_id=mCP18408.2 isoform=CRA_a"
FT                   /db_xref="GOA:P22005"
FT                   /db_xref="InterPro:IPR000703"
FT                   /db_xref="InterPro:IPR006024"
FT                   /db_xref="MGI:MGI:104629"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22005"
FT                   /protein_id="EDL05699.1"
FT                   /translation="MARFLRLCTWLLALGSCLLATVQAECSQDCAKCSYRLVRPGDINF
FT                   LACTLECEGQLPSFKIWETCKDLLQVSRPEFPWDNIDMYKDSSKQDESHLLAKKYGGFM
FT                   KRYGGFMKKMDELYPMEPEEEANGGEILAKRYGGFMKKDADEGDTLANSSDLLKELLGT
FT                   GDNRAKDSHQQESTNNDEDMSKRYGGFMRSLKRSPQLEDEAKELQKRYGGFMRRVGRPE
FT                   WWMDYQKRYGGFLKRFAESLPSDEEGENYSKEVPEIEKRYGGFMRF"
FT   CDS             complement(join(812414..813082,816581..816718))
FT                   /codon_start=1
FT                   /gene="Penk1"
FT                   /locus_tag="mCG_17613"
FT                   /product="preproenkephalin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17613.2 transcript_id=mCT178973.0
FT                   protein_id=mCP101895.0 isoform=CRA_a"
FT                   /db_xref="GOA:P22005"
FT                   /db_xref="InterPro:IPR000703"
FT                   /db_xref="InterPro:IPR006024"
FT                   /db_xref="MGI:MGI:104629"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22005"
FT                   /protein_id="EDL05700.1"
FT                   /translation="MARFLRLCTWLLALGSCLLATVQAECSQDCAKCSYRLVRPGDINF
FT                   LACTLECEGQLPSFKIWETCKDLLQVSRPEFPWDNIDMYKDSSKQDESHLLAKKYGGFM
FT                   KRYGGFMKKMDELYPMEPEEEANGGEILAKRYGGFMKKDADEGDTLANSSDLLKELLGT
FT                   GDNRAKDSHQQESTNNDEDMSKRYGGFMRSLKRSPQLEDEAKELQKRYGGFMRRVGRPE
FT                   WWMDYQKRYGGFLKRFAESLPSDEEGENYSKEVPEIEKRYGGFMRF"
FT   assembly_gap    819405..819424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    825810..825829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    841470..841706
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    844746..844765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    861057..861365
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    899345..899413
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    926236..926255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    927294..927313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    990286..990372
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1030597..1030616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1074576..1074960
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    1089751..1089806
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    1296937..1296956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1309679..1309698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1310853..1310872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1313111..1313130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1314416..1325170
FT                   /estimated_length=10755
FT                   /gap_type="unknown"
FT   assembly_gap    1332205..1332224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1333280..1333299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1340394..1340413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1345480..1345499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1351428..1351447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1408726..1408745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1416235..1416548
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    1427474..1427493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1429919..1460795)
FT                   /gene="Impad1"
FT                   /locus_tag="mCG_17612"
FT                   /note="gene_id=mCG17612.2"
FT   mRNA            complement(join(1429919..1435406,1436746..1436907,
FT                   1443751..1443846,1445630..1445792,1460162..1460795))
FT                   /gene="Impad1"
FT                   /locus_tag="mCG_17612"
FT                   /product="inositol monophosphatase domain containing 1"
FT                   /note="gene_id=mCG17612.2 transcript_id=mCT14266.2 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(1435138..1435406,1436746..1436907,
FT                   1443751..1443846,1445630..1445792,1460162..1460542))
FT                   /codon_start=1
FT                   /gene="Impad1"
FT                   /locus_tag="mCG_17612"
FT                   /product="inositol monophosphatase domain containing 1"
FT                   /note="gene_id=mCG17612.2 transcript_id=mCT14266.2
FT                   protein_id=mCP18407.2"
FT                   /db_xref="GOA:Q80V26"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="MGI:MGI:1915720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80V26"
FT                   /protein_id="EDL05698.1"
FT                   /translation="MAPMGIRLSPLGVAVFFLLGLGVLYHLYSGFLAGRFSLFGLGSEP
FT                   AAGEAEVASDGGTVDLREMLAVAVLAAERGGDEVRRVRESNVLHEKSKGKTREGADDKM
FT                   TSGDVLSNRKMFYLLKTAFPNVQINTEEHVDASDKEVIVWNRKIPEDILKEIAAPKEVP
FT                   AESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGS
FT                   NVKARSSYNEKTPKIIVSRSHAGMVKQVALQTFGNQTSIIPAGGAGYKVLALLDVPDMT
FT                   QEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLNGEEISYTGSDGIEGGLLASIRMN
FT                   HQALVRKLPDLEKSGH"
FT   gene            1460056..1463696
FT                   /locus_tag="mCG_147151"
FT                   /note="gene_id=mCG147151.0"
FT   mRNA            1460056..1463696
FT                   /locus_tag="mCG_147151"
FT                   /product="mCG147151"
FT                   /note="gene_id=mCG147151.0 transcript_id=mCT187414.0
FT                   created on 13-JAN-2004"
FT   CDS             1460078..1460563
FT                   /codon_start=1
FT                   /locus_tag="mCG_147151"
FT                   /product="mCG147151"
FT                   /note="gene_id=mCG147151.0 transcript_id=mCT187414.0
FT                   protein_id=mCP108348.0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C7C0"
FT                   /protein_id="EDL05697.1"
FT                   /translation="MTLHTLHGCLPASLSRSDRAPGPQPSTYLHVGEGRLEQVEHLAVG
FT                   QYVAAGHLIIGALARLPLGLLVKDIALADPPHLVAAALGRQHGHGQHLAQVHRAPVGRH
FT                   LGLPCRRLAAQAEEAEAAGQEARVEVVEHPEPQQEKYGHPQRGQADAHGGHGARDRR"
FT   assembly_gap    1491988..1492189
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    1514616..1514635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1517812..1517831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1541952..1541971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1543168..1543187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1547717..1547736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1549993..1550012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1555259..1555278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1556726..1576955
FT                   /estimated_length=20230
FT                   /gap_type="unknown"
FT   assembly_gap    1606587..1606606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1608778..1608797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1615239..1615635
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1629100..1629227
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    1643260..1643279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662180..1662199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1679463..1680478
FT                   /estimated_length=1016
FT                   /gap_type="unknown"
FT   assembly_gap    1681361..1685784
FT                   /estimated_length=4424
FT                   /gap_type="unknown"
FT   assembly_gap    1718620..1718639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1734723..1734928
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    1736506..1737553
FT                   /estimated_length=1048
FT                   /gap_type="unknown"
FT   assembly_gap    1766484..1766503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1777286..1778037
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    1779499..1779518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1810082..1810167
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    1831011..1831123
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    1879356..1879534
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    1883735..1884769
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    1968105..1968296
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    2010398..2013850
FT                   /estimated_length=3453
FT                   /gap_type="unknown"
FT   assembly_gap    2035256..2035305
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2037343..2037362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2058297..2058766
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    2071034..2071337
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    2082557..2082599
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2132108..2132127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2176093..2176278
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    2244328..2244347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264910..2264941
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            <2271591..2281542
FT                   /locus_tag="mCG_1043298"
FT                   /note="gene_id=mCG1043298.0"
FT   mRNA            join(<2271591..2271639,2272302..2272471,2277904..2277991,
FT                   2280568..2281236,2281331..2281542)
FT                   /locus_tag="mCG_1043298"
FT                   /product="mCG1043298"
FT                   /note="gene_id=mCG1043298.0 transcript_id=mCT161002.0
FT                   created on 10-JAN-2003"
FT   CDS             join(<2281015..2281236,2281331..2281384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043298"
FT                   /product="mCG1043298"
FT                   /note="gene_id=mCG1043298.0 transcript_id=mCT161002.0
FT                   protein_id=mCP67868.0"
FT                   /protein_id="EDL05696.1"
FT                   /translation="TVLKPWLRVLGNSSPLVRFSLEYHQHLSRCCWSLRLDTKDLFLPI
FT                   ASKLLSHDFFLVSPVGSTSLYSRLLFSSQISYRSPNEISQAIRDCG"
FT   gene            <2283403..2747111
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /note="gene_id=mCG48906.2"
FT   mRNA            join(<2283403..2283688,2368320..2368406,2445793..2445875,
FT                   2532181..2532260,2746689..2747111)
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, transcript variant
FT                   mCT49089"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT49089.2 created
FT                   on 10-JAN-2003"
FT   mRNA            join(<2283403..2283688,2368320..2368406,2437837..2439512)
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, transcript variant
FT                   mCT178430"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT178430.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(<2283403..2283688,2368320..2372272)
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, transcript variant
FT                   mCT178429"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT178429.0 created
FT                   on 10-JAN-2003"
FT   assembly_gap    2299157..2299176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2347970..2349891
FT                   /estimated_length=1922
FT                   /gap_type="unknown"
FT   assembly_gap    2361958..2362079
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   CDS             join(<2368388..2368406,2445793..2445875,2532181..2532260,
FT                   2746689..2746815)
FT                   /codon_start=1
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, isoform CRA_b"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT49089.2
FT                   protein_id=mCP39065.2 isoform=CRA_b"
FT                   /protein_id="EDL05694.1"
FT                   /translation="NTHCLLGLKLLGLTGVISGPPACCTAKKKLQRNTGTSLWRRIRQE
FT                   KIGEQDHNHAWCKIPRCLLLDSMLWRRRAPLDWLVIAPGTVTPEATVEPTCLIVDSM"
FT   CDS             <2371305..2371691
FT                   /codon_start=1
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, isoform CRA_a"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT178429.0
FT                   protein_id=mCP101351.0 isoform=CRA_a"
FT                   /protein_id="EDL05693.1"
FT                   /translation="LKHHVSFSQTSSLLWIQCFLHKDPCVPYGDSASFHSSTSGFSLPR
FT                   TALCQENDSELRFPSTVRWGAPWALSADLEQGRLRNQGKSASVMRLLCPPELYNKKGQI
FT                   GHSFAKAVKVLDVYSKKVSVRRNR"
FT   assembly_gap    2376962..2376981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2398810..2400819
FT                   /estimated_length=2010
FT                   /gap_type="unknown"
FT   assembly_gap    2423000..2423556
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   CDS             <2438035..2439252
FT                   /codon_start=1
FT                   /gene="1700012H17Rik"
FT                   /locus_tag="mCG_48906"
FT                   /product="RIKEN cDNA 1700012H17, isoform CRA_c"
FT                   /note="gene_id=mCG48906.2 transcript_id=mCT178430.0
FT                   protein_id=mCP101352.0 isoform=CRA_c"
FT                   /protein_id="EDL05695.1"
FT                   /translation="HCFQDPSSALCASCTCVCSGRPEAPRRASTTAAGERPPTMPTETL
FT                   QTGSMVKPVSPAGTFTSAVPLRILNKGPDYFRRQAEPNPKRLSAVERLEADKAKYVKSQ
FT                   EVINAKQEPVKPAVLAKPPVCPGTKRALGSPTLKVFGNHAKTESGVQRETLKLEILKNI
FT                   INSSEGSSSGSGHKHSSRNWPPHRDTTDLHRHSFAESLKVYPTPGHGSPQESSSHVSRR
FT                   LLEQSAETFLHVSHSSSDIRKVTSVKPLKAIPCSSSAPPLPPKPKVAAMKSPEADQVEP
FT                   ACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARANSDIIS
FT                   LNFRSASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNARIIKWLYSIKQARES
FT                   QKVSHV"
FT   assembly_gap    2460506..2462679
FT                   /estimated_length=2174
FT                   /gap_type="unknown"
FT   assembly_gap    2486309..2486470
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            complement(2494341..2495309)
FT                   /pseudo
FT                   /locus_tag="mCG_9444"
FT                   /note="gene_id=mCG9444.2"
FT   mRNA            complement(2494341..2495309)
FT                   /pseudo
FT                   /locus_tag="mCG_9444"
FT                   /note="gene_id=mCG9444.2 transcript_id=mCT9522.2 created on
FT                   31-JAN-2003"
FT   assembly_gap    2537910..2537929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2540268..2540312
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    2550852..2550871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2567508..2567527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2568932..2571520
FT                   /estimated_length=2589
FT                   /gap_type="unknown"
FT   assembly_gap    2618342..2618498
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    2712084..2712103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2720639..2720795
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    2730135..2730154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2731164..2731183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2769058..2769127
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2777550..2780824
FT                   /estimated_length=3275
FT                   /gap_type="unknown"
FT   assembly_gap    2783492..2783511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2790482..2792034
FT                   /estimated_length=1553
FT                   /gap_type="unknown"
FT   assembly_gap    2794720..2794739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2796437..2798041
FT                   /estimated_length=1605
FT                   /gap_type="unknown"
FT   assembly_gap    2801676..2801825
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    2802907..2804065
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    2808095..2808114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2809844..2810043
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    2815410..2815449
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            2829409..2854823
FT                   /gene="3110003A22Rik"
FT                   /locus_tag="mCG_4372"
FT                   /note="gene_id=mCG4372.1"
FT   mRNA            join(2829409..2829517,2834715..2834818,2840587..2840737,
FT                   2842070..2842153,2842857..2842966,2847077..2847214,
FT                   2852903..2853064,2854176..2854823)
FT                   /gene="3110003A22Rik"
FT                   /locus_tag="mCG_4372"
FT                   /product="RIKEN cDNA 3110003A22"
FT                   /note="gene_id=mCG4372.1 transcript_id=mCT3264.1 created on
FT                   05-AUG-2002"
FT   CDS             join(2829434..2829517,2834715..2834818,2840587..2840737,
FT                   2842070..2842153,2842857..2842966,2847077..2847214,
FT                   2852903..2853064,2854176..2854338)
FT                   /codon_start=1
FT                   /gene="3110003A22Rik"
FT                   /locus_tag="mCG_4372"
FT                   /product="RIKEN cDNA 3110003A22"
FT                   /note="gene_id=mCG4372.1 transcript_id=mCT3264.1
FT                   protein_id=mCP6807.2"
FT                   /protein_id="EDL05692.1"
FT                   /translation="MAEGGRAEPEEQERGSSRPRPPSARDLQLALAELYEDEMKCKSSK
FT                   PDRSTPATCRSPRTPPHRLYSGDHKYDGLHIVQPPTGKIVNELFKEAREHGAVPLNEAT
FT                   RSSREDKTKSFTGGGYRLGNSFYKRSEYIYGENQLQDVQVLLKLWRNGFSLDDGELRPY
FT                   SDPTNAQFLESVKRGETPLELQRLVHGAQVNLDMEDHQDQEYIKPRLRFKAFSGEGQKL
FT                   GSLTPEIVSTPSSPEEEDKSILNAAVLIDDSMPTTKIQIRLADGSRLVQRFNSTHRILD
FT                   VRDFIVRSRPEFATTDFILVTSFPSKELTDETVTLQEADILNTVILQQLK"
FT   assembly_gap    2872244..2872433
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    2880428..2881173
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    2896606..2896625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2898866..>2899656)
FT                   /locus_tag="mCG_1043294"
FT                   /note="gene_id=mCG1043294.1"
FT   mRNA            complement(join(<2898866..2899035,2899233..2899342,
FT                   2899535..>2899656))
FT                   /locus_tag="mCG_1043294"
FT                   /product="mCG1043294"
FT                   /note="gene_id=mCG1043294.1 transcript_id=mCT160998.1
FT                   created on 28-MAR-2003"
FT   CDS             complement(join(<2898866..2899035,2899233..2899342,
FT                   2899535..>2899656))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043294"
FT                   /product="mCG1043294"
FT                   /note="gene_id=mCG1043294.1 transcript_id=mCT160998.1
FT                   protein_id=mCP67821.1"
FT                   /protein_id="EDL05691.1"
FT                   /translation="TFKYVGRKCTTFKDTLLVVNELLNSRYELDESSTMLNSFSMVSEF
FT                   SVHSSWLHCSLASIKAECYDSRSVYVRPYSLHDIIYHSSEESTTSEPSARITARNSLCK
FT                   KSPGILHKSTQTSNHCKVVMIKELTEMNFG"
FT   gene            complement(2904376..2914396)
FT                   /gene="Cyp7a1"
FT                   /locus_tag="mCG_4371"
FT                   /note="gene_id=mCG4371.2"
FT   mRNA            complement(join(2904376..2907272,2907820..2907995,
FT                   2909871..2910001,2911059..2911645,2912339..2912579,
FT                   2914257..2914396))
FT                   /gene="Cyp7a1"
FT                   /locus_tag="mCG_4371"
FT                   /product="cytochrome P450, family 7, subfamily a,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG4371.2 transcript_id=mCT3271.2 created on
FT                   23-NOV-2004"
FT   CDS             complement(join(2906976..2907272,2907820..2907995,
FT                   2909871..2910001,2911059..2911645,2912339..2912579,
FT                   2914257..2914336))
FT                   /codon_start=1
FT                   /gene="Cyp7a1"
FT                   /locus_tag="mCG_4371"
FT                   /product="cytochrome P450, family 7, subfamily a,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG4371.2 transcript_id=mCT3271.2
FT                   protein_id=mCP6802.2"
FT                   /protein_id="EDL05690.1"
FT                   /translation="MMSISLIWGIAVVVSCCIWFIIGIRRRKVGEPPLDNGLIPYLGCA
FT                   LKFGSNPLEFLRAKQRKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHYTT
FT                   SAKAFGHRSIDPSDGNTTENINKTFNKTLQGDALCSLSEAMMQNLQSVMRPPGLPKSKS
FT                   AVWVTEGMYAFCYRVMFEAGYLTLFGKDISKTDTQRAFIQNNLDSFKQFDQVFPALVAG
FT                   VPIHLFKTAHKARERLAESLKHKNLYMRDQVSELIRLRMFLNDTLSTFDDMEKAKTHLV
FT                   ILWASQANTIPATFWSLFQMIRSPEAMKAASEEVNGALQSAGQELSSGGNAIYLDQEQL
FT                   NNLPVLDSIIKEALRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPE
FT                   IYPDPLTFKYDRYLDESGKAKTTFYRNGNKLKYFYMPFGSGATICPGRLFAVQEIKQFL
FT                   ILMLSYFELELVESHTKCPPLDQSRAGLGILPPLNDIEFKYKLKH"
FT   assembly_gap    2917915..2918115
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    2951872..2952923
FT                   /estimated_length=1052
FT                   /gap_type="unknown"
FT   assembly_gap    2958750..2958769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2976495..2976514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2989748..2995180)
FT                   /locus_tag="mCG_147155"
FT                   /note="gene_id=mCG147155.0"
FT   mRNA            complement(join(2989748..2990301,2992920..2993061,
FT                   2994817..2994916,2995075..2995180))
FT                   /locus_tag="mCG_147155"
FT                   /product="mCG147155"
FT                   /note="gene_id=mCG147155.0 transcript_id=mCT187418.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2989868..2990044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147155"
FT                   /product="mCG147155"
FT                   /note="gene_id=mCG147155.0 transcript_id=mCT187418.0
FT                   protein_id=mCP108350.0"
FT                   /protein_id="EDL05689.1"
FT                   /translation="MWKGRVLPTLKKITFLECSGYGLEFRRICTRHIFLNLCYKIVNST
FT                   FSMTRKEVIFSSP"
FT   gene            <3003340..3033940
FT                   /locus_tag="mCG_4375"
FT                   /note="gene_id=mCG4375.2"
FT   mRNA            join(<3003340..3003417,3014733..3014798,3016622..3016703,
FT                   3018646..3018755,3022682..3022843,3024189..3024364,
FT                   3030602..3030773,3031293..3031384,3032166..3033940)
FT                   /locus_tag="mCG_4375"
FT                   /product="mCG4375, transcript variant mCT189833"
FT                   /note="gene_id=mCG4375.2 transcript_id=mCT189833.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3003343..3003417,3014733..3014798,3016622..3016703,
FT                   3018646..3018755,3022682..3022843,3024189..3024364,
FT                   3030602..3030773,3031293..3031384,3032166..3032220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4375"
FT                   /product="mCG4375, isoform CRA_a"
FT                   /note="gene_id=mCG4375.2 transcript_id=mCT189833.0
FT                   protein_id=mCP110826.0 isoform=CRA_a"
FT                   /protein_id="EDL05687.1"
FT                   /translation="RAGRAPRFGCVELERAAGAARSSGQKISAEMSLYPSLEDLKVDKV
FT                   IQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMV
FT                   SGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSI
FT                   DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIR
FT                   DRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLK
FT                   DAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV"
FT   mRNA            join(3003379..3003417,3014733..3014798,3016622..3016703,
FT                   3018646..3018755,3022685..3022843,3024189..3024364,
FT                   3030602..3030773,3031293..3031384,3032166..3033311)
FT                   /locus_tag="mCG_4375"
FT                   /product="mCG4375, transcript variant mCT3263"
FT                   /note="gene_id=mCG4375.2 transcript_id=mCT3263.1 created on
FT                   05-AUG-2002"
FT   CDS             join(3014748..3014798,3016622..3016703,3018646..3018755,
FT                   3022685..3022843,3024189..3024364,3030602..3030773,
FT                   3031293..3031384,3032166..3032220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4375"
FT                   /product="mCG4375, isoform CRA_b"
FT                   /note="gene_id=mCG4375.2 transcript_id=mCT3263.1
FT                   protein_id=mCP6800.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TMX0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR030528"
FT                   /db_xref="MGI:MGI:1337026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TMX0"
FT                   /protein_id="EDL05688.1"
FT                   /translation="MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGN
FT                   LYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGLVARPSSVNYMVAPVTGNDAGIR
FT                   RAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQING
FT                   ENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIV
FT                   KDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKR
FT                   MAPSIMKSLMDHTIPEV"
FT   gene            complement(3033882..3090995)
FT                   /gene="Nsmaf"
FT                   /locus_tag="mCG_4374"
FT                   /note="gene_id=mCG4374.1"
FT   mRNA            complement(join(3033882..3034473,3035971..3036080,
FT                   3036197..3036299,3036461..3036611,3044415..3044498,
FT                   3046186..3046309,3046718..3046785,3047472..3047539,
FT                   3051196..3051254,3052592..3052700,3054138..3054301,
FT                   3054803..3054845,3055384..3055515,3055899..3056019,
FT                   3056110..3056161,3057502..3057565,3057688..3057778,
FT                   3058695..3058774,3060960..3061136,3062517..3062625,
FT                   3064040..3064111,3066030..3066159,3069384..3069436,
FT                   3069534..3069581,3069967..3070038,3071761..3071811,
FT                   3074446..3074482,3074558..3074625,3074747..3074825,
FT                   3077604..3077693,3090719..3090995))
FT                   /gene="Nsmaf"
FT                   /locus_tag="mCG_4374"
FT                   /product="neutral sphingomyelinase (N-SMase) activation
FT                   associated factor, transcript variant mCT3266"
FT                   /note="gene_id=mCG4374.1 transcript_id=mCT3266.1 created on
FT                   05-AUG-2002"
FT   CDS             complement(join(3034379..3034473,3035971..3036080,
FT                   3036197..3036299,3036461..3036611,3044415..3044498,
FT                   3046186..3046309,3046718..3046785,3047472..3047539,
FT                   3051196..3051254,3052592..3052700,3054138..3054301,
FT                   3054803..3054845,3055384..3055515,3055899..3056019,
FT                   3056110..3056161,3057502..3057565,3057688..3057778,
FT                   3058695..3058774,3060960..3061136,3062517..3062625,
FT                   3064040..3064111,3066030..3066159,3069384..3069436,
FT                   3069534..3069581,3069967..3070038,3071761..3071811,
FT                   3074446..3074482,3074558..3074625,3074747..3074825,
FT                   3077604..3077693,3090719..3090777))
FT                   /codon_start=1
FT                   /gene="Nsmaf"
FT                   /locus_tag="mCG_4374"
FT                   /product="neutral sphingomyelinase (N-SMase) activation
FT                   associated factor, isoform CRA_b"
FT                   /note="gene_id=mCG4374.1 transcript_id=mCT3266.1
FT                   protein_id=mCP6790.2 isoform=CRA_b"
FT                   /db_xref="GOA:O35242"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR023362"
FT                   /db_xref="MGI:MGI:1341864"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35242"
FT                   /protein_id="EDL05686.1"
FT                   /translation="MAFTRKRQREQQLQLYSKERFSLLLLNLEEYYFEQHTAFHVQHQG
FT                   SQEERKIRGSLKICSKSVIFEPDAISQPILKIPLRDCLKIGKHGENGANKHFAKAKSWG
FT                   ISLIFSQIYFIKEHNIVAPYKIERGKMEYVFELEVSGKVEDVVETLLQLHRASCLDKLG
FT                   DQMAMITAILQSRLARTSFDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVCITDTSLYF
FT                   QPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTDDDLCSDIYLKFYEPQDRDDL
FT                   YFYIATYLEHHAAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWII
FT                   SDYSSPELDLSNPATFRDLSKPVGALNAERLERLLTRYQEMPEPRFMYGSHYSSPGYVL
FT                   FYLVRIAPEYMLCLQNGRFDNADRMFNSIAETWKNCLDGATDFKELIPEFYDEDVSFLV
FT                   NSLKLDLGKRQGGQMVDDVDLPAWASSPQDFLQKNKDALESGYVSEHLHEWIDLIFGYK
FT                   QKGSEAIGAHNVFHPLTYEGGVDLNSIEDPDEKVAMLTQILEFGQTPKQLFVTPHPRRI
FT                   TPKFKSLSQASSYNASLTDSPVSPGEESFEDLTEESRTLAWSNIAKLQLHEQYKIHKEA
FT                   VTGIAVSCNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDTTVISSS
FT                   WDNNVYFYSIAFGRRQDTLMGHDDAVSKICWHNDRLYSGSWDSTVKVWSGVPAEMPGTK
FT                   RHQFDLLAELEHDVSVNTINLNAVSTLLVSGTKEGMVNIWDLTTATLLHQTSCHSGTVC
FT                   DAAFSPDSRHILSTGVDGCLNVIDVQTGMLISSMASEEPQRCFVWDGNSVLSGSRSGEL
FT                   LVWDLLGAKVSERIQGHTGAVTCMWMNEQCSSIITGGEDRQIMFWKLQY"
FT   assembly_gap    3034601..3034695
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3044028..3044498,3046186..3046309,
FT                   3046718..3046785,3047472..3047539,3051196..3051254,
FT                   3052592..3052700,3054138..3054301,3054803..3054845,
FT                   3055384..3055515,3055899..3056019,3056110..3056161,
FT                   3057502..3057565,3057688..3057778,3058695..3058774,
FT                   3060960..3061136,3062517..3062625,3064040..3064111,
FT                   3066030..3066159,3069384..3069436,3069534..3069581,
FT                   3069967..3070038,3071761..3071811,3074554..3074625,
FT                   3074747..3074825,3077604..3077693,3090719..>3090990))
FT                   /gene="Nsmaf"
FT                   /locus_tag="mCG_4374"
FT                   /product="neutral sphingomyelinase (N-SMase) activation
FT                   associated factor, transcript variant mCT189831"
FT                   /note="gene_id=mCG4374.1 transcript_id=mCT189831.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3044391..3044498,3046186..3046309,
FT                   3046718..3046785,3047472..3047539,3051196..3051254,
FT                   3052592..3052700,3054138..3054301,3054803..3054845,
FT                   3055384..3055515,3055899..3056019,3056110..3056161,
FT                   3057502..3057565,3057688..3057778,3058695..3058774,
FT                   3060960..3061136,3062517..3062625,3064040..3064111,
FT                   3066030..3066159,3069384..3069436,3069534..3069581,
FT                   3069967..3070038,3071761..>3071811))
FT                   /codon_start=1
FT                   /gene="Nsmaf"
FT                   /locus_tag="mCG_4374"
FT                   /product="neutral sphingomyelinase (N-SMase) activation
FT                   associated factor, isoform CRA_a"
FT                   /note="gene_id=mCG4374.1 transcript_id=mCT189831.0
FT                   protein_id=mCP110825.0 isoform=CRA_a"
FT                   /protein_id="EDL05685.1"
FT                   /translation="IYFIKEHNIVAPYKIERGKMEYVFELEVSGKVEDVVETLLQLHRA
FT                   SCLDKLGDQMAMITAILQSRLARTSFDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVCI
FT                   TDTSLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTDDDLCSDIYLKFYE
FT                   PQDRDDLYFYIATYLEHHAAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQY
FT                   PVFPWIISDYSSPELDLSNPATFRDLSKPVGALNAERLERLLTRYQEMPEPRFMYGSHY
FT                   SSPGYVLFYLVRIAPEYMLCLQNGRFDNADRMFNSIAETWKNCLDGATDFKELIPEFYD
FT                   EDVSFLVNSLKLDLGKRQGGQMVDDVDLPAWASSPQDFLQKNKDALESGYVSEHLHEWI
FT                   DLIFGYKQKGSEAIGAHNVFHPLTYEGGVDLNSIEDPDEKVAMLTQILEFGQTPKQLFV
FT                   TPHPRRITPKFKSLSQASSYNASLTDSPVSPGEESFEDLTEESRTLAWSNIAKLQLHEQ
FT                   YKIHKEAVTGIAVSCNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGD
FT                   TTVISSSWDNNVYFYSIAFGRRQDTLMGHDDAVSKICWHNDRLYSGSWDSTVKVWSGVP
FT                   AEMPGTKRHQFDLLAELEHDVSVSPAAEL"
FT   assembly_gap    3081668..3081687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3120317..3125889
FT                   /estimated_length=5573
FT                   /gap_type="unknown"
FT   assembly_gap    3127126..3136822
FT                   /estimated_length=9697
FT                   /gap_type="unknown"
FT   assembly_gap    3156141..3156296
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    3169880..3169899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3232604..3232844
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    3236056..3236075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3242038..3242057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3257993..3258012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3306161..3306330
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    3309090..3309109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3309110..3613477)
FT                   /gene="Tox"
FT                   /locus_tag="mCG_4373"
FT                   /note="gene_id=mCG4373.2"
FT   mRNA            complement(join(3309110..3310455,3310813..3310964,
FT                   3319399..3319785,3333410..3333490,3344115..3344345,
FT                   3363272..3363553,3444888..3445130,3464341..3464406,
FT                   3612278..3612413,3613304..3613477))
FT                   /gene="Tox"
FT                   /locus_tag="mCG_4373"
FT                   /product="thymocyte selection-associated HMG box gene"
FT                   /note="gene_id=mCG4373.2 transcript_id=mCT3265.2 created on
FT                   07-DEC-2002"
FT   CDS             complement(join(3310419..3310455,3310813..3310964,
FT                   3319399..3319785,3333410..3333490,3344115..3344345,
FT                   3363272..3363553,3444888..3445130,3464341..3464406,
FT                   3612278..3612379))
FT                   /codon_start=1
FT                   /gene="Tox"
FT                   /locus_tag="mCG_4373"
FT                   /product="thymocyte selection-associated HMG box gene"
FT                   /note="gene_id=mCG4373.2 transcript_id=mCT3265.2
FT                   protein_id=mCP6809.2"
FT                   /protein_id="EDL05684.1"
FT                   /translation="MDVRFYPPPAQPAAAPAAPCLGPSPCLDPYYCNKFDGENMYMSMT
FT                   EPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNG
FT                   LLPFHPQTMDLPEITVSNMLGQDGALLSNSISVMQEIGNAEGAQYSSHPQMAAMRPRGQ
FT                   PTDIRQQASMMQPGQLTTINQSQLSAQLGLNMGGTNVAHNSPSPPGSKSATPSPSSSVH
FT                   EDECEDASKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKG
FT                   QNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYTDP
FT                   VDVKTSQPPQLVNSKPSVFHGPSQAHSALYLSSHYHQQPGMTPQLTAMHPSLPRNIAPK
FT                   PNNQMPVTVSIANMAVSPPPPLQISPPLHQHLSMQQHQSLAMQQPLGSQLPMQVQTALH
FT                   SPTMQQGFTLQPDYQTIINPTSTAAQVVTQAMEYVRSGCRNPPPQPVDWSTDYCSSGGM
FT                   QRDKALYLT"
FT   assembly_gap    3336322..3336462
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    3447127..3447163
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    3501388..3501980
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    3530082..3530101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3612430..3613258
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    3646180..3647046
FT                   /estimated_length=867
FT                   /gap_type="unknown"
FT   assembly_gap    3650034..3653193
FT                   /estimated_length=3160
FT                   /gap_type="unknown"
FT   assembly_gap    3658132..3658186
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3745163..3747702
FT                   /estimated_length=2540
FT                   /gap_type="unknown"
FT   assembly_gap    3792199..3792218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3797002..3797021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3798623..3798642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3808006..3808025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3813400..3813419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3814650..3814669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3816225..3816244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3853282..3853381
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    3858612..3858692
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    3859937..3860083
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    3879017..3879036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3881408..3881767
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    3925869..3926050
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    3933456..3933475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3951398..3951544
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    3973296..3976168
FT                   /estimated_length=2873
FT                   /gap_type="unknown"
FT   assembly_gap    3992196..3992215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4000712..4000731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4020003..4020022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4025596..4030408
FT                   /estimated_length=4813
FT                   /gap_type="unknown"
FT   assembly_gap    4033556..4033575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4048130..4048149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4069350..4069369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4083447..4083466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4092127..4092246
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    4095263..4095677
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    4156622..4156641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4159382..4159401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4160748..4160767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4161859..4161878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4164743..4164762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4183214..4196323
FT                   /locus_tag="mCG_145026"
FT                   /note="gene_id=mCG145026.0"
FT   mRNA            join(<4183214..4183349,4187170..4187221,4195434..4196323)
FT                   /locus_tag="mCG_145026"
FT                   /product="mCG145026"
FT                   /note="gene_id=mCG145026.0 transcript_id=mCT184450.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4183269..4183349,4187170..4187221,4195434..4195579)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145026"
FT                   /product="mCG145026"
FT                   /note="gene_id=mCG145026.0 transcript_id=mCT184450.0
FT                   protein_id=mCP105696.0"
FT                   /protein_id="EDL05683.1"
FT                   /translation="TEYQPVENNKIKPTRQAYSLSNPACPDVEKSLEEGGKANSILIND
FT                   FHIEDYWMTCGTVFSVASSCTEVQVKATREAQEEMESKALKNEFLFF"
FT   assembly_gap    4219858..4219970
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    4227877..4227896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4241286..4248927
FT                   /estimated_length=7642
FT                   /gap_type="unknown"
FT   assembly_gap    4254505..4254524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4257299..4257318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4270000..4270019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4289442..4289461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4307265..4307450
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    4321403..4321422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4353042..4353061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4353857..4355349
FT                   /estimated_length=1493
FT                   /gap_type="unknown"
FT   assembly_gap    4367825..4367844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4430556..4430575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4439822..4439888
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    4446384..4446403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4480492..4480511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4484327..4484462
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    4488796..4493441
FT                   /estimated_length=4646
FT                   /gap_type="unknown"
FT   assembly_gap    4593553..4593572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4601167..4601334
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    4672501..4672581
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    4676140..4676159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4683302..4683321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4745745..4835235)
FT                   /gene="Car8"
FT                   /locus_tag="mCG_20159"
FT                   /note="gene_id=mCG20159.2"
FT   mRNA            complement(join(4745745..4745994,4746134..4748581,
FT                   4773435..4773604,4786292..4786404,4787623..4787671,
FT                   4788615..4788677,4792333..4792428,4818367..4818491,
FT                   4834134..4834325,4835067..4835235))
FT                   /gene="Car8"
FT                   /locus_tag="mCG_20159"
FT                   /product="carbonic anhydrase 8"
FT                   /note="gene_id=mCG20159.2 transcript_id=mCT19324.2 created
FT                   on 10-JAN-2003"
FT   assembly_gap    4751594..4751671
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4755338..4755357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4756458..4756477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(4773470..4773604,4786292..4786404,
FT                   4787623..4787671,4788615..4788677,4792333..4792428,
FT                   4818367..4818491,4834134..4834325,4835067..4835169))
FT                   /codon_start=1
FT                   /gene="Car8"
FT                   /locus_tag="mCG_20159"
FT                   /product="carbonic anhydrase 8"
FT                   /note="gene_id=mCG20159.2 transcript_id=mCT19324.2
FT                   protein_id=mCP6788.2"
FT                   /protein_id="EDL05682.1"
FT                   /translation="MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDA
FT                   NGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGP
FT                   LPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHG
FT                   IAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGS
FT                   LTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL
FT                   SDRVIRAAFQ"
FT   assembly_gap    4778045..4778664
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    4831851..4831870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4835236..4835411
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    4855913..4857153
FT                   /estimated_length=1241
FT                   /gap_type="unknown"
FT   assembly_gap    4878844..4878943
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    4882213..4882436
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    4891160..4891548
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    4909694..4912677
FT                   /estimated_length=2984
FT                   /gap_type="unknown"
FT   assembly_gap    4918114..4918236
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    4927160..4927889
FT                   /estimated_length=730
FT                   /gap_type="unknown"
FT   assembly_gap    4948766..4949703
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    4974797..4974816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4978690..4978709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4995070..4995145
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(5025529..5025949)
FT                   /pseudo
FT                   /locus_tag="mCG_1042965"
FT                   /note="gene_id=mCG1042965.1"
FT   mRNA            complement(5025529..5025949)
FT                   /pseudo
FT                   /locus_tag="mCG_1042965"
FT                   /note="gene_id=mCG1042965.1 transcript_id=mCT160669.1
FT                   created on 11-FEB-2003"
FT   assembly_gap    5042634..5048346
FT                   /estimated_length=5713
FT                   /gap_type="unknown"
FT   assembly_gap    5049563..5049582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5056132..5056342
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    5061245..5061651
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    5085829..5085848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5093932..5166900
FT                   /gene="Rab2"
FT                   /locus_tag="mCG_123621"
FT                   /note="gene_id=mCG123621.1"
FT   mRNA            join(5093932..5094209,5119507..5119578,5130738..5130805,
FT                   5136169..5136251,5136685..5136777,5140595..5140706,
FT                   5163497..5163565,5165530..5166900)
FT                   /gene="Rab2"
FT                   /locus_tag="mCG_123621"
FT                   /product="RAB2, member RAS oncogene family"
FT                   /note="gene_id=mCG123621.1 transcript_id=mCT124855.1
FT                   created on 31-JAN-2003"
FT   CDS             join(5094164..5094209,5119507..5119578,5130738..5130805,
FT                   5136169..5136251,5136685..5136777,5140595..5140706,
FT                   5163497..5163565,5165530..5165625)
FT                   /codon_start=1
FT                   /gene="Rab2"
FT                   /locus_tag="mCG_123621"
FT                   /product="RAB2, member RAS oncogene family"
FT                   /note="gene_id=mCG123621.1 transcript_id=mCT124855.1
FT                   protein_id=mCP67646.1"
FT                   /db_xref="GOA:Q0PD65"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1928750"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD65"
FT                   /protein_id="EDL05680.1"
FT                   /translation="MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGA
FT                   RMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDA
FT                   RQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINT
FT                   AKEIYEKIQEGVFDINNEANGIKIGPQHAATNASHGSNQGGQQAGGGCC"
FT   assembly_gap    5120636..5120655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5145402..5145837
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    5146997..5147016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5151676..5152320)
FT                   /locus_tag="mCG_20157"
FT                   /note="gene_id=mCG20157.2"
FT   mRNA            complement(5151676..5152320)
FT                   /locus_tag="mCG_20157"
FT                   /product="mCG20157"
FT                   /note="gene_id=mCG20157.2 transcript_id=mCT19231.2 created
FT                   on 31-JAN-2003"
FT   CDS             complement(5151818..5152252)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20157"
FT                   /product="mCG20157"
FT                   /note="gene_id=mCG20157.2 transcript_id=mCT19231.2
FT                   protein_id=mCP6812.1"
FT                   /protein_id="EDL05681.1"
FT                   /translation="MSHNSQAFLSTNAGLPPSYETIKEEYRVTELGEPSNSAVVRTTVI
FT                   NMPREVSVPDHVVWSLFNTLFFNACCLGFIAYAYSVKSRDRKMVGDVVGAQAYASTAKC
FT                   LNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF"
FT   assembly_gap    5191030..5191049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5192631..5192759
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5201337..5216382
FT                   /estimated_length=15046
FT                   /gap_type="unknown"
FT   assembly_gap    5217667..5217686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5220023..5220199
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(5228913..5229841)
FT                   /pseudo
FT                   /locus_tag="mCG_20161"
FT                   /note="gene_id=mCG20161.1"
FT   mRNA            complement(5228913..5229841)
FT                   /pseudo
FT                   /locus_tag="mCG_20161"
FT                   /note="gene_id=mCG20161.1 transcript_id=mCT19326.1 created
FT                   on 21-JAN-2003"
FT   assembly_gap    5245819..5247358
FT                   /estimated_length=1540
FT                   /gap_type="unknown"
FT   gene            5266264..5422909
FT                   /locus_tag="mCG_20155"
FT                   /note="gene_id=mCG20155.2"
FT   mRNA            join(5266264..5266483,5307330..5309154,5341482..5341903,
FT                   5357462..5357603,5361288..5361425,5362433..5362498,
FT                   5367575..5367630,5378514..5378628,5381599..5381682,
FT                   5382346..5382483,5382580..5382701,5383021..5383264,
FT                   5384370..5384546,5388613..5388756,5389878..5390133,
FT                   5394689..5394899,5395563..5395758,5396527..5396694,
FT                   5397234..5397413,5400447..5400557,5400642..5400847,
FT                   5403214..5403413,5403592..5403751,5406931..5407020,
FT                   5407389..5407492,5408813..5408942,5409308..5409380,
FT                   5409537..5409594,5410199..5410427,5410659..5410867,
FT                   5410980..5411648,5412808..5412965,5414613..5414840,
FT                   5415177..5415620,5418625..5418846,5420044..5420184,
FT                   5420336..5420440,5421873..5422909)
FT                   /locus_tag="mCG_20155"
FT                   /product="mCG20155"
FT                   /note="gene_id=mCG20155.2 transcript_id=mCT19229.2 created
FT                   on 21-JAN-2003"
FT   assembly_gap    5272273..5272292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5290653..5290904
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   CDS             join(5307511..5309154,5341482..5341903,5357462..5357603,
FT                   5361288..5361425,5362433..5362498,5367575..5367630,
FT                   5378514..5378628,5381599..5381682,5382346..5382483,
FT                   5382580..5382701,5383021..5383264,5384370..5384546,
FT                   5388613..5388756,5389878..5390133,5394689..5394899,
FT                   5395563..5395758,5396527..5396694,5397234..5397413,
FT                   5400447..5400557,5400642..5400847,5403214..5403413,
FT                   5403592..5403751,5406931..5407020,5407389..5407492,
FT                   5408813..5408942,5409308..5409380,5409537..5409594,
FT                   5410199..5410427,5410659..5410867,5410980..5411648,
FT                   5412808..5412965,5414613..5414840,5415177..5415620,
FT                   5418625..5418846,5420044..5420184,5420336..5420440,
FT                   5421873..5422790)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20155"
FT                   /product="mCG20155"
FT                   /note="gene_id=mCG20155.2 transcript_id=mCT19229.2
FT                   protein_id=mCP6805.2"
FT                   /protein_id="EDL05679.1"
FT                   /translation="MADPGMMSLFGEDGSLFSEGLEGLGECGYPENPVNPMGQQMPIDQ
FT                   GFPSLQPSLHHPSPNQNQTKLTHFDHYSQYEQKMHLMDQPNRMMGSAPGNGLASPHSQY
FT                   HTPPVPQVPHGGGGGGQMGVYPGIQNERHGQSFVDGGSMWGPRAVQVPDQIRAPYQQQQ
FT                   PQPAPSGPPAQGHPQHMQQMGSYLARGDFSMQQHGQPQQRMGQFSQGQEGLSQGSPFIA
FT                   TSGPGHLSHMPQQSPSMAPSLRHPVQQQFHHHPAALHGESVAHSPRFSPNPPQQGAVRP
FT                   QTLNFSSRNQTVPSPTVNNSGQYSRYPYSNLNQGLVNSTGMNQNLGLTNSTPMNQSVPR
FT                   YPNAVGFPSNSGQGLVHQQPIHSSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNP
FT                   AGTPPPQVRPGSAGMPMEVGSYPNMPHPQPSHQPPGAMGIGQRNMGPRNMQQPRSFMGM
FT                   SSAPRELTGHMRPNGCPGVGLADPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGL
FT                   HQSSPPHPHHQPWAQLHPSPQNTPQKVPVHQHSPSEPFLEKPVPDMTQVSAQNAQLVKS
FT                   DDYLPSIEQQPQQKKKKKKNNHIAAGDSSKGFGKDDFPGGVENQELRRNSLDVSQEEKK
FT                   KKKRPKVKKDPKESKEPKEKKEPKTPKAPKIPKEPKEKKAKTVTPKPKSSKKSSNKKPD
FT                   SEASALKKKVNKGKTEGSENSDLDKTPPPSPAPEEDEDPGVQKRRSSRQVKRKRYTEDL
FT                   EFKISDEEADDADAAGRDSPSNTSQSEQQESVDAEGPVVEKIMSSRLVKKQKESGEEVE
FT                   VEEFYVKYKNFSYLHCQWASVEDLEKDKRIQQKIKRFKSKQGQSKFLSEIEDDLFNPDY
FT                   VEVDRIMDFARSTDDRGEPVIHYLVKWCSLPYEDSTWELKQDIDQTKIEEFEKLMSREP
FT                   ETERVERPPADDWKKSESSREYKNNNKLREYQLEGVNWLLFNWYNMRNCILADEMGLGK
FT                   TIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQL
FT                   YEMYFKDPQGRVIKGSYKFHAIITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKL
FT                   LEGLKMMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSRFPSETTFMQEFGDLKTEEQVQ
FT                   KLQAILKPMMLRRLKEDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFTFLSKGGGQ
FT                   ANVPNLLNTMMELRKCCNHPYLINGAEEKILEEFKETHNAESPDFQLQAMIQAAGKLVL
FT                   IDKLLPKLKAGGHRVLIFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFS
FT                   KPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKSVKIY
FT                   RLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENATNGVQQLSKKEIEDLLRKGAYGA
FT                   LMDEEDEGSKFCEEDIDQILLRRTHTITIESEGKGSTFAKASFVASGNRTDISLDDPNF
FT                   WQKWAKKAELDIDALNGRNNLVIDTPRVRKQTRLYSAVKEDELMEFSDLESDSEEKPCA
FT                   KPRRPQDKSQGYARSECFRVEKNLLVYGWGRWTDILSHGRYKRQLTEQDVETICRAILV
FT                   YCLNHYRGDENIKSFIWDLITPTADGQTRALLNHSGLSAPVPRGRKGKKVKAQSTQPVV
FT                   HDAHWLASCNPDALFQEDSYKKHLKHHCNKVLLRVRMLYYLRQEVIGDQAEKILEGADS
FT                   SEADVWIPEPFHAEVPTDWWDREADKSLLIGVFKHGYEKYNSMRADPALCFLERVGMPD
FT                   AKAIAAEQRGTDMLADGGDGGEFDREDEDPEYKPTRAPFKDEIDEFANSPAEDKEESME
FT                   VHSSGKHSESNAELGQLYWPNTSTLTTRLRRLITAYQRSYKRQQMRQEALMKTDRRRRR
FT                   PREEVRALEAEREAIISEKRQKWTRREEADFYRVVSTFGVIFDPVKQQFDWNQFRAFAR
FT                   LDKKSDESLGKYFSCFVAMCRRVCRMPAKPEDEPPDLASLIEPITEERASRTLYRIELL
FT                   RKIREQVLHHPQLSDRLKLCQPSLDLPEWWECGRHDRDLLVGAAKHGVSRTDYHILNDP
FT                   ELSFLDAHKSFAQNRGASTVPPLNTLAMGFGQTPPVISSAHVHEEKAMEQAEGKAEECE
FT                   HSPAKERSDGKEEEEEAGGAKDGKQECEVEASSVKGELKGVEGSADPGSKSVSEKGSEE
FT                   DEEEKLEDDDKSEESSQPEGAVSRGKTFDEESNASLSTARDETRDGFYMEDGDASVAQL
FT                   LHERTFAFSFWPKDRVMINRLDNICEAVLKGKWPVNRRQMFDFQGLVPGYPPSAVDSPL
FT                   QKRSFAELSMVSQASISASEDITTSPQLSKDDALNLSVPRQRRRRRRKVEIEAERAAKR
FT                   RNLMEMVAQLRESQVVSENGQEKVVDLSKASREATSSTSNFSSLTSKFILPNVSTPVSD
FT                   AFKSQMELLQAGLSRTPTRHMLNGSLVDGEPPMKRRRGRRKNVEGLDLLFMSHKRTPLS
FT                   AEDAEVTKAFEEDIETPPIRNIPSPGQLDPDTRIPVINLEDGTRLVGEDAPKNKDLVDW
FT                   LKLHPTYTVDMPSYVPKNTDVLFSSFQKPKQKRHRCRNPNKLDINTLTGEERVPVVNKR
FT                   NGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWTDIVKQSGFVPESMFDRLLTGPVVRGE
FT                   GASRRGRRPKSEIARAAAAAAAVASTSGINPLLVNSLFAGMDLTSLQNLQNLQSLQLAG
FT                   LMGFPPGLATAATAGGDAKSPAAVLPLMLPGMAGLPNVFGLGGLLNNPLSAATGNTTTA
FT                   SSQGEPEDGTSKAEEKGNDNEDENRDSEKSTDTVSAADSANGSVGAATAPAALPSNPLA
FT                   FNPFLLSTMAPGLFYPSMFLPPGLGGLTLPGFPALAGLQNAVGTSEEKAADKAEGGPCK
FT                   DGETLEGSDAEENLDKTVESSILEDEVAQGEELDSLEGGDEIENTGNDE"
FT   assembly_gap    5316431..5316506
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    5353073..5353451
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    5458006..5458025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5483475..5483494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5495499..5495518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5503021..5503395
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    5515988..5519722
FT                   /estimated_length=3735
FT                   /gap_type="unknown"
FT   assembly_gap    5546175..5546270
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    5552599..5552618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5566154..5566235
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5567470..5567689
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    5568923..5569499
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   assembly_gap    5575716..5575735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5576859..5576878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5579669..5580130
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    5581754..5581773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5583587..5583606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5587047..5587681
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    5617952..5618869
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    5620959..5620978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5641425..5641748
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    5652424..5652494
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5677030..5677049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5697351..5697510
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    5707489..5707690
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    5709577..5710696
FT                   /estimated_length=1120
FT                   /gap_type="unknown"
FT   assembly_gap    5714690..5714803
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    5724239..5724691
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    5735572..5735591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5736791..5736810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5785785..5785979
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    5801161..5801210
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            5827912..6011700
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /note="gene_id=mCG9478.3"
FT   mRNA            join(5827912..5828068,5839978..5840602,5910178..5910352,
FT                   5984172..5984282,5989755..5989990,6009410..6011700)
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, transcript variant
FT                   mCT178454"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT178454.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(5827912..5828068,5839978..5840598,5910178..5913114)
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, transcript variant
FT                   mCT178455"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT178455.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(5827943..5828068,5838971..5839128,5839978..5840602,
FT                   5910178..5910352,5984172..5984282,5989755..5989990,
FT                   6009410..6011322)
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, transcript variant
FT                   mCT185684"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT185684.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(5830048..5830128,5839978..5840602,5910178..5910352,
FT                   5984172..5984282,5989755..5989990,6009410..6011700)
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, transcript variant
FT                   mCT9137"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT9137.3 created on
FT                   13-JUN-2003"
FT   CDS             join(5840148..5840602,5910178..5910352,5984172..5984282,
FT                   5989755..5989990,6009410..6009497)
FT                   /codon_start=1
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, isoform CRA_a"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT178454.1
FT                   protein_id=mCP101377.0 isoform=CRA_a"
FT                   /protein_id="EDL05674.1"
FT                   /translation="MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNEN
FT                   PDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLN
FT                   LDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAIL
FT                   LSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHF
FT                   VNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMG
FT                   TWARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKRSQSVVEAGTLKHEE
FT                   KGENENTQPLLALD"
FT   CDS             join(5840148..5840602,5910178..5910352,5984172..5984282,
FT                   5989755..5989990,6009410..6009497)
FT                   /codon_start=1
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, isoform CRA_a"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT185684.0
FT                   protein_id=mCP106942.0 isoform=CRA_a"
FT                   /protein_id="EDL05675.1"
FT                   /translation="MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNEN
FT                   PDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLN
FT                   LDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAIL
FT                   LSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHF
FT                   VNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMG
FT                   TWARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKRSQSVVEAGTLKHEE
FT                   KGENENTQPLLALD"
FT   CDS             join(5840148..5840602,5910178..5910352,5984172..5984282,
FT                   5989755..5989990,6009410..6009497)
FT                   /codon_start=1
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, isoform CRA_a"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT9137.3
FT                   protein_id=mCP6803.0 isoform=CRA_a"
FT                   /protein_id="EDL05677.1"
FT                   /translation="MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNEN
FT                   PDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLN
FT                   LDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAIL
FT                   LSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHF
FT                   VNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMG
FT                   TWARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKRSQSVVEAGTLKHEE
FT                   KGENENTQPLLALD"
FT   CDS             join(5840148..5840598,5910178..5910254)
FT                   /codon_start=1
FT                   /gene="4933402J24Rik"
FT                   /locus_tag="mCG_9478"
FT                   /product="RIKEN cDNA 4933402J24, isoform CRA_b"
FT                   /note="gene_id=mCG9478.3 transcript_id=mCT178455.0
FT                   protein_id=mCP101376.0 isoform=CRA_b"
FT                   /protein_id="EDL05676.1"
FT                   /translation="MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNEN
FT                   PDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLN
FT                   LDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQRTPSRTSSVPFSC
FT                   PWKSLLKIPSSR"
FT   assembly_gap    5846505..5846524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5893225..5893344
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5934272..5934307
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            5958055..5960440
FT                   /locus_tag="mCG_147156"
FT                   /note="gene_id=mCG147156.0"
FT   mRNA            join(5958055..5958105,5958157..5960440)
FT                   /locus_tag="mCG_147156"
FT                   /product="mCG147156"
FT                   /note="gene_id=mCG147156.0 transcript_id=mCT187419.0
FT                   created on 13-JAN-2004"
FT   CDS             5958691..5958939
FT                   /codon_start=1
FT                   /locus_tag="mCG_147156"
FT                   /product="mCG147156"
FT                   /note="gene_id=mCG147156.0 transcript_id=mCT187419.0
FT                   protein_id=mCP108351.0"
FT                   /protein_id="EDL05678.1"
FT                   /translation="MCDAFAECKIRGIYYQRNWVSRGDESMDLIDVQLKITLRMLKKRM
FT                   QTVHFDIYFLIALTVFSLLDWVVWTNASTTSFLRPKA"
FT   assembly_gap    5961126..5961393
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    5962124..5962238
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    5968851..5969223
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    5992695..5992714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5996275..5996383
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    5997708..5998198
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   gene            complement(6009101..>6221420)
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /note="gene_id=mCG124817.2"
FT   mRNA            complement(join(6009101..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6150838..6150885,6153413..6153469,
FT                   6154565..6154597,6156612..6156725,6159892..6159966,
FT                   6162937..6163032,6187926..6187994,6191223..6191372,
FT                   6220854..6221157))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT171119"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171119.0
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(6009101..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6150838..6150885,6153413..6153469,
FT                   6154565..6154597,6156612..6156725,6159892..6159966,
FT                   6162937..6163032,6176394..6176435,6187926..6187994,
FT                   6191223..6191372,6195560..6195699))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT126067"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT126067.1
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(6011745..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6220854..>6221159))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT189822"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT189822.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6012701..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6221229..>6221420))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT189823"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT189823.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6013315..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6221229..>6221289))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_g"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT189823.0
FT                   protein_id=mCP110814.0 isoform=CRA_g"
FT                   /protein_id="EDL05673.1"
FT                   /translation="PAPPPASGPRDWLVLASFRSEAKHGGHKNGRRGGISGGSFFTWFM
FT                   VIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLGLKERSPSERT
FT                   FPPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQSLLQESVHTDHDLEADGLAGEPQP
FT                   EVEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDTASQNHPNDMEEMTNEQENSEEVR
FT                   HQDYDEPVYEPSEHEGVAISDNTIDDSSIISEEINVASVEEQQDTPPVKKKKPKLLNKF
FT                   DKTIKAELDAAEKLRKRGKIEEAVNAFEELVRKYPQSPRARYGKAQCEDDLAEKQRSNE
FT                   VLRRAIETYQEAADLPDAPTDLVKLSLKRRSERQQFLGHMRGSLLTLQRLVQLFPSDTT
FT                   LKNDLGVGYLLLGDNDSAKKVYEEVLNVTPNDGFAKVHYGFILKAQNKISESIPYLKEG
FT                   IESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQ
FT                   PWWTPRETGYTELVKSLERNWKLIRDEGLMVMDKAKGLFLPEDENLREKGDWSQFTLWQ
FT                   QGRKNENACKGAPKTCALLEKFSETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHL
FT                   GLVIPKEGCKIRCANETRTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQ
FT                   QRRSLPAI"
FT   CDS             complement(join(6013315..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6220854..>6221031))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_f"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT189822.0
FT                   protein_id=mCP110813.0 isoform=CRA_f"
FT                   /protein_id="EDL05672.1"
FT                   /translation="CTQQGPGSLQSPEQLAMAPRKNAKGGGGNSSSSGSGSGSGSGSPS
FT                   TGSSGSSSSPGARREAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVWFDLVD
FT                   YEEVLGKLGVYDADGDGDFDVDDAKVLLGLKERSPSERTFPPEEEAETHAELEEQAPEG
FT                   ADIQNVEDEVKEQIQSLLQESVHTDHDLEADGLAGEPQPEVEDFLTVTDSDDRFEDLEP
FT                   GTVHEEIEDTYHVEDTASQNHPNDMEEMTNEQENSEEVRHQDYDEPVYEPSEHEGVAIS
FT                   DNTIDDSSIISEEINVASVEEQQDTPPVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKI
FT                   EEAVNAFEELVRKYPQSPRARYGKAQCEDDLAEKQRSNEVLRRAIETYQEAADLPDAPT
FT                   DLVKLSLKRRSERQQFLGHMRGSLLTLQRLVQLFPSDTTLKNDLGVGYLLLGDNDSAKK
FT                   VYEEVLNVTPNDGFAKVHYGFILKAQNKISESIPYLKEGIESGDPGTDDGRFYFHLGDA
FT                   MQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPRETGYTELVKSLERN
FT                   WKLIRDEGLMVMDKAKGLFLPEDENLREKGDWSQFTLWQQGRKNENACKGAPKTCALLE
FT                   KFSETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGCKIRCANETRTW
FT                   EEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI"
FT   CDS             complement(join(6013315..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6150838..6150885,6153413..6153469,
FT                   6154565..6154597,6156612..6156725,6159892..6159966,
FT                   6162937..6163032,6187926..6187994,6191223..6191372,
FT                   6220854..6220983))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_c"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171119.0
FT                   protein_id=mCP94039.0 isoform=CRA_c"
FT                   /protein_id="EDL05669.1"
FT                   /translation="MAPRKNAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGARREA
FT                   KHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGD
FT                   GDFDVDDAKVLLGLKERSPSERTFPPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQS
FT                   LLQESVHTDHDLEADGLAGEPQPEVEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDT
FT                   ASQNHPNDMEEMTNEQENSDPSEAVTDAGVLLPHAEEVRHQDYDEPVYEPSEHEGVAIS
FT                   DNTIDDSSIISEEINVASVEEQQDTPPVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKI
FT                   EEAVNAFEELVRKYPQSPRARYGKAQCEDDLAEKQRSNEVLRRAIETYQEAADLPDAPT
FT                   DLVKLSLKRRSERQQFLGHMRGSLLTLQRLVQLFPSDTTLKNDLGVGYLLLGDNDSAKK
FT                   VYEEVLNVTPNDGFAKVHYGFILKAQNKISESIPYLKEGIESGDPGTDDGRFYFHLGDA
FT                   MQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPRETGYTELVKSLERN
FT                   WKLIRDEGLMVMDKAKGLFLPEDENLREKGDWSQFTLWQQGRKNENACKGAPKTCALLE
FT                   KFSETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGCKIRCANETRTW
FT                   EEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI"
FT   CDS             complement(join(6013315..6013465,6034869..6035002,
FT                   6035361..6035452,6044251..6044386,6068164..6068301,
FT                   6074136..6074225,6077191..6077289,6089389..6089525,
FT                   6091307..6091457,6097075..6097161,6101622..6101707,
FT                   6143185..6143229,6146769..6146804,6147483..6147521,
FT                   6150375..6150407,6150838..6150885,6153413..6153469,
FT                   6154565..6154597,6156612..6156725,6159892..6159966,
FT                   6162937..6163032,6176394..6176435,6187926..6187994,
FT                   6191223..6191372,6195560..6195575))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_b"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT126067.1
FT                   protein_id=mCP67844.1 isoform=CRA_b"
FT                   /protein_id="EDL05668.1"
FT                   /translation="MAEDKEAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVW
FT                   FDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLEGPGGLAKRKTKAKGLKERSPSERTF
FT                   PPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQSLLQESVHTDHDLEADGLAGEPQPE
FT                   VEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDTASQNHPNDMEEMTNEQENSDPSEA
FT                   VTDAGVLLPHAEEVRHQDYDEPVYEPSEHEGVAISDNTIDDSSIISEEINVASVEEQQD
FT                   TPPVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAVNAFEELVRKYPQSPRARYGK
FT                   AQCEDDLAEKQRSNEVLRRAIETYQEAADLPDAPTDLVKLSLKRRSERQQFLGHMRGSL
FT                   LTLQRLVQLFPSDTTLKNDLGVGYLLLGDNDSAKKVYEEVLNVTPNDGFAKVHYGFILK
FT                   AQNKISESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFAS
FT                   VWQRSLYNVNGLKAQPWWTPRETGYTELVKSLERNWKLIRDEGLMVMDKAKGLFLPEDE
FT                   NLREKGDWSQFTLWQQGRKNENACKGAPKTCALLEKFSETTGCRRGQIKYSIMHPGTHV
FT                   WPHTGPTNCRLRMHLGLVIPKEGCKIRCANETRTWEEGKVLIFDDSFEHEVWQDASSFR
FT                   LIFIVDVWHPELTPQQRRSLPAI"
FT   assembly_gap    6041283..6041838
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    6055187..6055630
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    6106531..6106753
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   mRNA            complement(join(6134628..6136334,6143185..6143229,
FT                   6146769..6146804,6147483..6147521,6150375..6150407,
FT                   6150838..6150885,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6220854..6221157))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT171120"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171120.0
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(6134628..6136334,6143185..6143229,
FT                   6146769..6146804,6147483..6147521,6150375..6150407,
FT                   6150838..6150885,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6176394..6176435,6187926..6187994,6191223..6191372,
FT                   6195560..6195699))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT171121"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171121.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(6136327..6136334,6143185..6143229,
FT                   6146769..6146804,6147483..6147521,6150375..6150407,
FT                   6150838..6150885,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6187926..6187994,6191223..6191372,6220854..6220983))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_d"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171120.0
FT                   protein_id=mCP94038.0 isoform=CRA_d"
FT                   /db_xref="GOA:A2AL81"
FT                   /db_xref="InterPro:IPR007943"
FT                   /db_xref="MGI:MGI:1914186"
FT                   /db_xref="UniProtKB/TrEMBL:A2AL81"
FT                   /protein_id="EDL05670.1"
FT                   /translation="MAPRKNAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGARREA
FT                   KHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGD
FT                   GDFDVDDAKVLLGLKERSPSERTFPPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQS
FT                   LLQESVHTDHDLEADGLAGEPQPEVEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDT
FT                   ASQNHPNDMEEMTNEQENSDPSEAVTDAGVLLPHAEEVRHQDYDEPVYEPSEHEGVAIS
FT                   DNTIDDSSIISEEINVASVEEQQDTPPDT"
FT   CDS             complement(join(6136327..6136334,6143185..6143229,
FT                   6146769..6146804,6147483..6147521,6150375..6150407,
FT                   6150838..6150885,6153413..6153469,6154565..6154597,
FT                   6156612..6156725,6159892..6159966,6162937..6163032,
FT                   6176394..6176435,6187926..6187994,6191223..6191372,
FT                   6195560..6195575))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_e"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT171121.0
FT                   protein_id=mCP94037.0 isoform=CRA_e"
FT                   /protein_id="EDL05671.1"
FT                   /translation="MAEDKEAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVW
FT                   FDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLEGPGGLAKRKTKAKGLKERSPSERTF
FT                   PPEEEAETHAELEEQAPEGADIQNVEDEVKEQIQSLLQESVHTDHDLEADGLAGEPQPE
FT                   VEDFLTVTDSDDRFEDLEPGTVHEEIEDTYHVEDTASQNHPNDMEEMTNEQENSDPSEA
FT                   VTDAGVLLPHAEEVRHQDYDEPVYEPSEHEGVAISDNTIDDSSIISEEINVASVEEQQD
FT                   TPPDT"
FT   mRNA            complement(join(6172942..6174259,6176394..6176435,
FT                   6187926..6187994,6191223..6191372,6195560..6195699))
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, transcript variant
FT                   mCT124664"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT124664.1
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(6173913..6174259,6176394..6176435,
FT                   6187926..6187994,6191223..6191372,6195560..6195575))
FT                   /codon_start=1
FT                   /gene="Asph"
FT                   /locus_tag="mCG_124817"
FT                   /product="aspartate-beta-hydroxylase, isoform CRA_a"
FT                   /note="gene_id=mCG124817.2 transcript_id=mCT124664.1
FT                   protein_id=mCP67939.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR06"
FT                   /db_xref="InterPro:IPR007943"
FT                   /db_xref="MGI:MGI:1914186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CR06"
FT                   /protein_id="EDL05667.1"
FT                   /translation="MAEDKEAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVW
FT                   FDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLEGPGGLAKRKTKAKAKEPIKEELKKE
FT                   RGKAVPSKNEERRQGKKEQEDRGKGRKKPDSDTSQKASAAGKRDRDKEKASSDKSSKSK
FT                   ESWKKAVETKAVSSKVAARDKDRRGRSSSGHAHVAKENGQKRKN"
FT   assembly_gap    6218924..6218943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6239473..6239492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6243498..6249637
FT                   /estimated_length=6140
FT                   /gap_type="unknown"
FT   assembly_gap    6250646..6250665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6270887..6271930
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   gene            <6307271..6357570
FT                   /locus_tag="mCG_145028"
FT                   /note="gene_id=mCG145028.0"
FT   mRNA            join(<6307271..6307382,6319342..6319455,6321651..6321907,
FT                   6355543..6357570)
FT                   /locus_tag="mCG_145028"
FT                   /product="mCG145028"
FT                   /note="gene_id=mCG145028.0 transcript_id=mCT184452.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    6338087..6338106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <6356549..6356860
FT                   /codon_start=1
FT                   /locus_tag="mCG_145028"
FT                   /product="mCG145028"
FT                   /note="gene_id=mCG145028.0 transcript_id=mCT184452.0
FT                   protein_id=mCP105700.0"
FT                   /protein_id="EDL05666.1"
FT                   /translation="KYNRANYFIQIYANLKEKYTIYLSSNHWHRNRLEKGNSFSKGFLG
FT                   CGVCWEYLEAISTEGENWRIMGERSLWSVSQETEVSGVCHRRQTSLEFCGGWTEEGDK"
FT   gene            6379407..>6395306
FT                   /gene="Gdf6"
FT                   /locus_tag="mCG_58174"
FT                   /note="gene_id=mCG58174.2"
FT   mRNA            join(6379407..6379920,6394357..>6395306)
FT                   /gene="Gdf6"
FT                   /locus_tag="mCG_58174"
FT                   /product="growth differentiation factor 6"
FT                   /note="gene_id=mCG58174.2 transcript_id=mCT58357.2 created
FT                   on 31-JAN-2003"
FT   CDS             join(6379506..6379920,6394357..6395306)
FT                   /codon_start=1
FT                   /gene="Gdf6"
FT                   /locus_tag="mCG_58174"
FT                   /product="growth differentiation factor 6"
FT                   /note="gene_id=mCG58174.2 transcript_id=mCT58357.2
FT                   protein_id=mCP29348.2"
FT                   /db_xref="GOA:A2AII0"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95689"
FT                   /db_xref="UniProtKB/TrEMBL:A2AII0"
FT                   /protein_id="EDL05665.1"
FT                   /translation="MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSSSTELDSTKDVG
FT                   NRKEGKMQRTPQESAEGRTPPEHGLRQKDLRRRPPGQHQGQEPPGRGLRVVPHEYMLSI
FT                   YKTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEE
FT                   LVGAELRLYRQAPPTPWGLPARPLHLQLFPCLSPLLLDARTLDPQGPTQAGWEVFDVWQ
FT                   GLRPQPWKQLCLELRAAWGELDAGDTGARARGPQQPPPLDLRSLGFGRRVRPPQERALL
FT                   VVFTRSQRKNLFTEMHEQLGSAEAAGAEGSWPAPSGSPDAGSWLPSPGRRRRRTAFASR
FT                   HGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNH
FT                   AIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR"
FT   gene            complement(6450990..6452641)
FT                   /pseudo
FT                   /locus_tag="mCG_50641"
FT                   /note="gene_id=mCG50641.1"
FT   mRNA            complement(6450990..6452641)
FT                   /pseudo
FT                   /locus_tag="mCG_50641"
FT                   /note="gene_id=mCG50641.1 transcript_id=mCT50824.1 created
FT                   on 10-JAN-2003"
FT   assembly_gap    6457303..6460445
FT                   /estimated_length=3143
FT                   /gap_type="unknown"
FT   assembly_gap    6469872..6469934
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    6489600..6489972
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    6492942..6493055
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    6498949..6498968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6522884..6522903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6525666..6525685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6542786..6544529
FT                   /estimated_length=1744
FT                   /gap_type="unknown"
FT   assembly_gap    6545576..6545595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6551026..6551067
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    6553591..6555505
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    6598363..6600017
FT                   /estimated_length=1655
FT                   /gap_type="unknown"
FT   assembly_gap    6603337..6604294
FT                   /estimated_length=958
FT                   /gap_type="unknown"
FT   assembly_gap    6633178..6636786
FT                   /estimated_length=3609
FT                   /gap_type="unknown"
FT   assembly_gap    6639550..6641536
FT                   /estimated_length=1987
FT                   /gap_type="unknown"
FT   assembly_gap    6660689..6661900
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   assembly_gap    6684859..6684878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6692412..6692707
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    6701664..6701799
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    6707829..6707886
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6715944..6715963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6742020..6742039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6743257..6743276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6760630..6760649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6762649..6762668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6764115..6764134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6769163..6769182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6813749..6813768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6822165..6826474
FT                   /estimated_length=4310
FT                   /gap_type="unknown"
FT   assembly_gap    6842927..6842946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6893680..6893699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6899679..6899698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6937843..6937952
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6947720..6947739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6972057..6973560)
FT                   /pseudo
FT                   /locus_tag="mCG_11023"
FT                   /note="gene_id=mCG11023.2"
FT   mRNA            complement(6972057..6973560)
FT                   /pseudo
FT                   /locus_tag="mCG_11023"
FT                   /note="gene_id=mCG11023.2 transcript_id=mCT11021.2 created
FT                   on 31-JAN-2003"
FT   assembly_gap    6983040..6983120
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    6992422..6992441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6993686..6993705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7008792..7009706
FT                   /estimated_length=915
FT                   /gap_type="unknown"
FT   assembly_gap    7020805..7020824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7021916..7023629
FT                   /estimated_length=1714
FT                   /gap_type="unknown"
FT   gene            complement(7035304..>7331820)
FT                   /locus_tag="mCG_144559"
FT                   /note="gene_id=mCG144559.0"
FT   mRNA            complement(join(7035304..7035371,7275862..7276038,
FT                   7278962..7279063,7309276..7309334,7331658..>7331820))
FT                   /locus_tag="mCG_144559"
FT                   /product="mCG144559"
FT                   /note="gene_id=mCG144559.0 transcript_id=mCT183983.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(7035333..7035371,7275862..>7276020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144559"
FT                   /product="mCG144559"
FT                   /note="gene_id=mCG144559.0 transcript_id=mCT183983.0
FT                   protein_id=mCP105695.0"
FT                   /protein_id="EDL05664.1"
FT                   /translation="LSRLTELGTPSLRRMAPFPRLDCWIAGLLDCWIAGLLDCWIAELL
FT                   NCTKWKKPSQEHHHGMFSLS"
FT   assembly_gap    7037002..7037041
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    7044156..7044330
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    7045208..7045492
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    7069512..7069531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7072012..7072148
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    7101457..7101658
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    7102788..7102807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7106037..7106056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7119844..7119863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7122347..7122366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7124267..7124286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7148445..7148464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7182693..7182951
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    7187383..7187549
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    7205504..7205523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7209072..7209091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7224820..7224894
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    7259063..7259247
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    7264128..7264274
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    7266532..7273932
FT                   /estimated_length=7401
FT                   /gap_type="unknown"
FT   assembly_gap    7312492..7312809
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   gene            7347655..7348765
FT                   /pseudo
FT                   /locus_tag="mCG_1043001"
FT                   /note="gene_id=mCG1043001.1"
FT   mRNA            7347655..7348765
FT                   /pseudo
FT                   /locus_tag="mCG_1043001"
FT                   /note="gene_id=mCG1043001.1 transcript_id=mCT160705.1
FT                   created on 03-MAR-2003"
FT   assembly_gap    7355054..7355205
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            7387134..7389110
FT                   /pseudo
FT                   /locus_tag="mCG_11022"
FT                   /note="gene_id=mCG11022.2"
FT   mRNA            7387134..7389110
FT                   /pseudo
FT                   /locus_tag="mCG_11022"
FT                   /note="gene_id=mCG11022.2 transcript_id=mCT11020.2 created
FT                   on 31-JAN-2003"
FT   assembly_gap    7393895..7393954
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            <7401614..7426935
FT                   /gene="2610301B20Rik"
FT                   /locus_tag="mCG_125757"
FT                   /note="gene_id=mCG125757.1"
FT   mRNA            join(<7401614..7402148,7406896..7406983,7409163..7409230,
FT                   7409769..7409834,7420777..7420872,7425420..7426935)
FT                   /gene="2610301B20Rik"
FT                   /locus_tag="mCG_125757"
FT                   /product="RIKEN cDNA 2610301B20"
FT                   /note="gene_id=mCG125757.1 transcript_id=mCT127020.1
FT                   created on 07-DEC-2002"
FT   CDS             join(<7402073..7402148,7406896..7406983,7409163..7409230,
FT                   7409769..7409834,7420777..7420802)
FT                   /codon_start=1
FT                   /gene="2610301B20Rik"
FT                   /locus_tag="mCG_125757"
FT                   /product="RIKEN cDNA 2610301B20"
FT                   /note="gene_id=mCG125757.1 transcript_id=mCT127020.1
FT                   protein_id=mCP67904.1"
FT                   /protein_id="EDL05663.1"
FT                   /translation="SGPKATAAAARTAATGTEPRRKKLSDQQKHLKKKMILTVLLMKYS
FT                   RSLTLTENLFKNLNLNLQVTHVSELPCKASVKVAVQCISVEAPFHVGLEQILHREHVTD
FT                   CVV"
FT   assembly_gap    7419267..7419717
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    7427122..7427676
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    7434212..7434367
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    7437611..7437630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7459255..7459274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7473424..7473969
FT                   /pseudo
FT                   /locus_tag="mCG_49661"
FT                   /note="gene_id=mCG49661.2"
FT   mRNA            7473424..7473969
FT                   /pseudo
FT                   /locus_tag="mCG_49661"
FT                   /note="gene_id=mCG49661.2 transcript_id=mCT49844.2 created
FT                   on 12-FEB-2003"
FT   assembly_gap    7476826..7477013
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    7485049..7485068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7486869..7486888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7497180..7497461
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    7499680..7499847
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    7500733..7502409
FT                   /estimated_length=1677
FT                   /gap_type="unknown"
FT   assembly_gap    7503462..7503481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7508855..7510892
FT                   /estimated_length=2038
FT                   /gap_type="unknown"
FT   gene            complement(7517008..7535727)
FT                   /gene="Plekhf2"
FT                   /locus_tag="mCG_48694"
FT                   /note="gene_id=mCG48694.2"
FT   mRNA            complement(join(7517008..7519699,7535505..7535727))
FT                   /gene="Plekhf2"
FT                   /locus_tag="mCG_48694"
FT                   /product="pleckstrin homology domain containing, family F
FT                   (with FYVE domain) member 2"
FT                   /note="gene_id=mCG48694.2 transcript_id=mCT48877.2 created
FT                   on 10-JAN-2003"
FT   CDS             complement(7518936..7519685)
FT                   /codon_start=1
FT                   /gene="Plekhf2"
FT                   /locus_tag="mCG_48694"
FT                   /product="pleckstrin homology domain containing, family F
FT                   (with FYVE domain) member 2"
FT                   /note="gene_id=mCG48694.2 transcript_id=mCT48877.2
FT                   protein_id=mCP38889.2"
FT                   /protein_id="EDL05662.1"
FT                   /translation="MVDRLANSEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKL
FT                   CRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKT
FT                   PTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQK
FT                   AKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMAACQPT
FT                   RSDSYSQSLKSPLNDASDDDDDDDSSD"
FT   assembly_gap    7524724..7525220
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    7535484..7535503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7550316..7550481
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    7559107..7559126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7559800..7560044
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    7574257..7574340
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(7579197..7603065)
FT                   /locus_tag="mCG_5105"
FT                   /note="gene_id=mCG5105.2"
FT   mRNA            complement(join(7579197..7579344,7581551..7581607,
FT                   7585286..7585387,7587135..7587268,7588325..7588427,
FT                   7593511..7593567,7597060..7597176,7600018..7600121,
FT                   7602859..7603065))
FT                   /locus_tag="mCG_5105"
FT                   /product="mCG5105, transcript variant mCT4031"
FT                   /note="gene_id=mCG5105.2 transcript_id=mCT4031.1 created on
FT                   10-JAN-2003"
FT   mRNA            complement(join(7579197..7579344,7581551..7581607,
FT                   7585286..7585387,7587135..7587268,7588325..7588427,
FT                   7597060..7597182,7600018..7600121,7602859..7603065))
FT                   /locus_tag="mCG_5105"
FT                   /product="mCG5105, transcript variant mCT178434"
FT                   /note="gene_id=mCG5105.2 transcript_id=mCT178434.0 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(7579216..7579344,7581551..7581607,
FT                   7585286..7585387,7587135..7587268,7588325..7588427,
FT                   7593511..7593567,7597060..7597176,7600018..7600110))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5105"
FT                   /product="mCG5105, isoform CRA_a"
FT                   /note="gene_id=mCG5105.2 transcript_id=mCT4031.1
FT                   protein_id=mCP18272.1 isoform=CRA_a"
FT                   /protein_id="EDL05660.1"
FT                   /translation="MKATCVPYCSLQSVKGLLLHCGPSMWNWLRLDSVSEKTIGLMRMQ
FT                   FWKKAVEDMYCDNPPHQPVAIELWKAVKKHNLTKRWLMRIIDEREKNLDDKAYRSMQEL
FT                   ENYAENTQGSLLYLTLEVLGVKDLHADHAASHIGKAQGIVTCLRATPYHSSRRQVFLPM
FT                   DVCVQHGVSQEDFLRRNQDKNVRDVVYDIASQAHLHLKHARSFHRSVPAEAFPAFLQTV
FT                   SLEDYLKKIQRVDFDIFHPSLQQKNMLLPLSLYIQSWRKRY"
FT   CDS             complement(join(7579216..7579344,7581551..7581607,
FT                   7585286..7585387,7587135..7587268,7588325..7588427,
FT                   7597060..7597182,7600018..7600110))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5105"
FT                   /product="mCG5105, isoform CRA_b"
FT                   /note="gene_id=mCG5105.2 transcript_id=mCT178434.0
FT                   protein_id=mCP101356.0 isoform=CRA_b"
FT                   /protein_id="EDL05661.1"
FT                   /translation="MKATCVPYCSLQSVKGLLLHCGPSMWNWLRLVKDSVSEKTIGLMR
FT                   MQFWKKAVEDMYCDNPPHQPVAIELWKEKNLDDKAYRSMQELENYAENTQGSLLYLTLE
FT                   VLGVKDLHADHAASHIGKAQGIVTCLRATPYHSSRRQVFLPMDVCVQHGVSQEDFLRRN
FT                   QDKNVRDVVYDIASQAHLHLKHARSFHRSVPAEAFPAFLQTVSLEDYLKKIQRVDFDIF
FT                   HPSLQQKNMLLPLSLYIQSWRKRY"
FT   assembly_gap    7592886..7592905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7606078..7606097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7607645..7607664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7612184..7612601
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    7617055..7617074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7619314..7619452
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    7628243..7628333
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    7649225..7649267
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    7651558..7651861
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   gene            <7663387..7664258
FT                   /locus_tag="mCG_1042963"
FT                   /note="gene_id=mCG1042963.1"
FT   mRNA            <7663387..7664258
FT                   /locus_tag="mCG_1042963"
FT                   /product="mCG1042963"
FT                   /note="gene_id=mCG1042963.1 transcript_id=mCT160667.1
FT                   created on 12-FEB-2003"
FT   CDS             7663387..7663668
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042963"
FT                   /product="mCG1042963"
FT                   /note="gene_id=mCG1042963.1 transcript_id=mCT160667.1
FT                   protein_id=mCP68097.1"
FT                   /protein_id="EDL05659.1"
FT                   /translation="MAGEKPKEGVKTENNDHINLKVSGQDGSEVQFKRHTSLSKLMKTY
FT                   CERQGLSMRQIRFRFDGQPINKTDTPAELNIEDEDTNDGFQQQTGGVY"
FT   assembly_gap    7673647..7674013
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   gene            7674766..7675349
FT                   /pseudo
FT                   /locus_tag="mCG_48695"
FT                   /note="gene_id=mCG48695.2"
FT   mRNA            7674766..7675349
FT                   /pseudo
FT                   /locus_tag="mCG_48695"
FT                   /note="gene_id=mCG48695.2 transcript_id=mCT48878.2 created
FT                   on 27-MAR-2003"
FT   gene            7686501..7704441
FT                   /gene="Trp53inp1"
FT                   /locus_tag="mCG_125749"
FT                   /note="gene_id=mCG125749.0"
FT   mRNA            join(7686501..7686608,7694390..7694648,7695169..7695526,
FT                   7699798..7704441)
FT                   /gene="Trp53inp1"
FT                   /locus_tag="mCG_125749"
FT                   /product="transformation related protein 53 inducible
FT                   nuclear protein 1"
FT                   /note="gene_id=mCG125749.0 transcript_id=mCT127012.0
FT                   created on 06-AUG-2002"
FT   CDS             join(7694537..7694648,7695169..7695526,7699798..7700047)
FT                   /codon_start=1
FT                   /gene="Trp53inp1"
FT                   /locus_tag="mCG_125749"
FT                   /product="transformation related protein 53 inducible
FT                   nuclear protein 1"
FT                   /note="gene_id=mCG125749.0 transcript_id=mCT127012.0
FT                   protein_id=mCP67592.1"
FT                   /db_xref="GOA:Q3UQK9"
FT                   /db_xref="InterPro:IPR029431"
FT                   /db_xref="InterPro:IPR029556"
FT                   /db_xref="MGI:MGI:1926609"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQK9"
FT                   /protein_id="EDL05658.1"
FT                   /translation="MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSA
FT                   EEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTSDSCFLQFESCPMEESWFITPPPCF
FT                   TAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRMEAQSE
FT                   MGKHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQM
FT                   KHSGWVVHQPCPRQYNY"
FT   gene            complement(7705771..>7720943)
FT                   /locus_tag="mCG_145032"
FT                   /note="gene_id=mCG145032.0"
FT   mRNA            complement(join(7705771..7708481,7709685..7709816,
FT                   7710379..7710642,7712268..7713049,7720829..>7720943))
FT                   /locus_tag="mCG_145032"
FT                   /product="mCG145032"
FT                   /note="gene_id=mCG145032.0 transcript_id=mCT184456.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(7707777..>7708277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145032"
FT                   /product="mCG145032"
FT                   /note="gene_id=mCG145032.0 transcript_id=mCT184456.0
FT                   protein_id=mCP105699.0"
FT                   /protein_id="EDL05657.1"
FT                   /translation="KESPLGFMPHTSRGLPLRLIVMSELWKRLITLLSCTCITRATQNR
FT                   DFNPHTPIQQTWEVLNVEGDIVWSTTAVQPLWTWWPDLTPDICKLVAESLTWDLPDHTN
FT                   LHKPPPDKQCVPSGIGSTFGCSGQFYLEPIFGLQNFMFALAKANHESFGISVEGHRTFT
FT                   VLR"
FT   assembly_gap    7713235..7713275
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    7720064..7720563
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    7721120..7721313
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            7721580..7734627
FT                   /gene="Ccne2"
FT                   /locus_tag="mCG_5098"
FT                   /note="gene_id=mCG5098.2"
FT   mRNA            join(7721580..7721669,7722535..7722571,7722669..7722765,
FT                   7722847..7722900,7723780..7723931,7724874..7725009,
FT                   7727007..7727153,7728583..7728678,7729151..7729285,
FT                   7731155..7731266,7732040..7732197,7732833..7734627)
FT                   /gene="Ccne2"
FT                   /locus_tag="mCG_5098"
FT                   /product="cyclin E2, transcript variant mCT4038"
FT                   /note="gene_id=mCG5098.2 transcript_id=mCT4038.2 created on
FT                   10-JAN-2003"
FT   mRNA            join(7721580..7721669,7722535..7722571,7722672..7722765,
FT                   7722847..7722900,7723780..7723931,7724874..7725009,
FT                   7727007..7727153,7728583..7728678,7729151..7729285,
FT                   7731155..7731266,7732040..7732197,7732833..7734627)
FT                   /gene="Ccne2"
FT                   /locus_tag="mCG_5098"
FT                   /product="cyclin E2, transcript variant mCT178433"
FT                   /note="gene_id=mCG5098.2 transcript_id=mCT178433.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(7722558..7722571,7722669..7722765,7722847..7722900,
FT                   7723780..7723931,7724874..7725009,7727007..7727153,
FT                   7728583..7728678,7729151..7729285,7731155..7731266,
FT                   7732040..7732197,7732833..7732946)
FT                   /codon_start=1
FT                   /gene="Ccne2"
FT                   /locus_tag="mCG_5098"
FT                   /product="cyclin E2, isoform CRA_b"
FT                   /note="gene_id=mCG5098.2 transcript_id=mCT4038.2
FT                   protein_id=mCP18285.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544H6"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028858"
FT                   /db_xref="MGI:MGI:1329034"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H6"
FT                   /protein_id="EDL05656.1"
FT                   /translation="MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEE
FT                   ITKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPD
FT                   LSWACSQEVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETF
FT                   YLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVD
FT                   ILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDL
FT                   CILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSP
FT                   VKLKTFKKIPMEDRHNIQTHTNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEK
FT                   PPGKH"
FT   CDS             join(7722558..7722571,7722672..7722765,7722847..7722900,
FT                   7723780..7723931,7724874..7725009,7727007..7727153,
FT                   7728583..7728678,7729151..7729285,7731155..7731266,
FT                   7732040..7732197,7732833..7732946)
FT                   /codon_start=1
FT                   /gene="Ccne2"
FT                   /locus_tag="mCG_5098"
FT                   /product="cyclin E2, isoform CRA_a"
FT                   /note="gene_id=mCG5098.2 transcript_id=mCT178433.0
FT                   protein_id=mCP101355.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2API1"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028858"
FT                   /db_xref="MGI:MGI:1329034"
FT                   /db_xref="UniProtKB/TrEMBL:A2API1"
FT                   /protein_id="EDL05655.1"
FT                   /translation="MSRRSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEI
FT                   TKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDL
FT                   SWACSQEVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFY
FT                   LAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDI
FT                   LKMELNILKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLC
FT                   ILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPV
FT                   KLKTFKKIPMEDRHNIQTHTNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKP
FT                   PGKH"
FT   gene            complement(7729012..>7782834)
FT                   /gene="Ints8"
FT                   /locus_tag="mCG_5104"
FT                   /note="gene_id=mCG5104.3"
FT   mRNA            complement(join(7729012..7729305,7734312..7734431,
FT                   7738674..7738717,7739060..7739124,7739240..7739313,
FT                   7741728..7741778,7743552..7743655,7746303..7746421,
FT                   7748458..7748519,7748615..7748671,7749739..7749772,
FT                   7750960..7751144,7753613..7753734,7755449..7755650,
FT                   7756967..7757077,7758698..7758831,7760174..7760349,
FT                   7761516..7761586,7764442..7764583,7765381..7765481,
FT                   7769177..7769332,7771451..7771558,7775599..7775781,
FT                   7775968..7776019,7777704..7777775,7778043..7778183,
FT                   7782654..>7782834))
FT                   /gene="Ints8"
FT                   /locus_tag="mCG_5104"
FT                   /product="integrator complex subunit 8, transcript variant
FT                   mCT4035"
FT                   /note="gene_id=mCG5104.3 transcript_id=mCT4035.3 created on
FT                   01-JUL-2003"
FT   mRNA            complement(join(7733958..7734431,7738674..7738717,
FT                   7739060..7739124,7739240..7739313,7741728..7741778,
FT                   7743552..7743655,7746303..7746421,7748458..7748519,
FT                   7748615..7748671,7749739..7749772,7750960..7751144,
FT                   7753613..7753734,7755449..7755650,7756967..7757077,
FT                   7758698..7758831,7760174..7760349,7761516..7761586,
FT                   7764442..7764583,7765381..7765481,7769177..7769332,
FT                   7771451..7771558,7775599..7775781,7775968..7776019,
FT                   7777704..7777775,7778043..7778183,7782654..>7782834))
FT                   /gene="Ints8"
FT                   /locus_tag="mCG_5104"
FT                   /product="integrator complex subunit 8, transcript variant
FT                   mCT186545"
FT                   /note="gene_id=mCG5104.3 transcript_id=mCT186545.0 created
FT                   on 01-JUL-2003"
FT   CDS             complement(join(7734315..7734431,7738674..7738717,
FT                   7739060..7739124,7739240..7739313,7741728..7741778,
FT                   7743552..7743655,7746303..7746421,7748458..7748519,
FT                   7748615..7748671,7749739..7749772,7750960..7751144,
FT                   7753613..7753734,7755449..7755650,7756967..7757077,
FT                   7758698..7758831,7760174..7760349,7761516..7761586,
FT                   7764442..7764583,7765381..7765481,7769177..7769332,
FT                   7771451..7771558,7775599..7775781,7775968..7776019,
FT                   7777704..7777775,7778043..7778183,7782654..>7782829))
FT                   /codon_start=1
FT                   /gene="Ints8"
FT                   /locus_tag="mCG_5104"
FT                   /product="integrator complex subunit 8, isoform CRA_a"
FT                   /note="gene_id=mCG5104.3 transcript_id=mCT4035.3
FT                   protein_id=mCP18270.3 isoform=CRA_a"
FT                   /protein_id="EDL05653.1"
FT                   /translation="DPAPVQLIVQFLEQASKPSVNEQNQVQPPPDNKRNRVLKLLALKV
FT                   AAHLKWDLDILEKSLSVPVLNMLLNELLCISKVPPGTKHVDMDLSALPPTTAMAILLYN
FT                   RWAIRTIVQSSFPVKQAKPGPPQLNVMNQMQQEKELTENILKVLKEQAADCILVLEAAL
FT                   RLNKDLYVHTMRTLDLLAVEPGTVNGETENSTAGLKIRTEEMQCQVCYDLGAAYFQQGS
FT                   TDSAIYENAREKFFRTKELLAEIGSLSLHCTIDEKRLAGYCQACDVLVPSSDNNSQQLT
FT                   PYSQVHICLRSGSYQEVVQIFIEDNLTFTLPVQFRQSVLRELFQKAQQGNEALDEICFK
FT                   ICVCNTVRDVLEGRTISVQFNQLFLRPNKEKIDFLLEVCSRSINVEKASDSLKGNMAAF
FT                   LKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQMRKRSPRVNLCIKPVTSFYDI
FT                   PASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQFWTVSNKWEVPSVYSSVILG
FT                   IKDNLTRDLVYILMAKGLHCSTVKDFPHSKQLFTACLELVTEFSPKLRQVMLNEMLLLD
FT                   IRTHEAGVGQSGERPPSDLISRVRGYLEMRLPDIPLRQVVAEECVAFMLNWRENEYLTL
FT                   QVPAFLFQNNPYVKLGQLLAATCKELPGPKESRRTAKDLWEVVVQICSVSNQHKRGNDG
FT                   RVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKLHNVREDIVNDITAEHI
FT                   SIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHAWLIIQADIYFATNQHSAALHY
FT                   YLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAILCQFLREIDYKTAFK
FT                   SLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEE
FT                   VLQLAAQRRKKKFLQAMAKLYF"
FT   CDS             complement(join(7734315..7734431,7738674..7738717,
FT                   7739060..7739124,7739240..7739313,7741728..7741778,
FT                   7743552..7743655,7746303..7746421,7748458..7748519,
FT                   7748615..7748671,7749739..7749772,7750960..7751144,
FT                   7753613..7753734,7755449..7755650,7756967..7757077,
FT                   7758698..7758831,7760174..7760349,7761516..7761586,
FT                   7764442..7764583,7765381..7765481,7769177..7769332,
FT                   7771451..7771558,7775599..7775781,7775968..7776019,
FT                   7777704..7777775,7778043..7778183,7782654..>7782829))
FT                   /codon_start=1
FT                   /gene="Ints8"
FT                   /locus_tag="mCG_5104"
FT                   /product="integrator complex subunit 8, isoform CRA_a"
FT                   /note="gene_id=mCG5104.3 transcript_id=mCT186545.0
FT                   protein_id=mCP107249.0 isoform=CRA_a"
FT                   /protein_id="EDL05654.1"
FT                   /translation="DPAPVQLIVQFLEQASKPSVNEQNQVQPPPDNKRNRVLKLLALKV
FT                   AAHLKWDLDILEKSLSVPVLNMLLNELLCISKVPPGTKHVDMDLSALPPTTAMAILLYN
FT                   RWAIRTIVQSSFPVKQAKPGPPQLNVMNQMQQEKELTENILKVLKEQAADCILVLEAAL
FT                   RLNKDLYVHTMRTLDLLAVEPGTVNGETENSTAGLKIRTEEMQCQVCYDLGAAYFQQGS
FT                   TDSAIYENAREKFFRTKELLAEIGSLSLHCTIDEKRLAGYCQACDVLVPSSDNNSQQLT
FT                   PYSQVHICLRSGSYQEVVQIFIEDNLTFTLPVQFRQSVLRELFQKAQQGNEALDEICFK
FT                   ICVCNTVRDVLEGRTISVQFNQLFLRPNKEKIDFLLEVCSRSINVEKASDSLKGNMAAF
FT                   LKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQMRKRSPRVNLCIKPVTSFYDI
FT                   PASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQFWTVSNKWEVPSVYSSVILG
FT                   IKDNLTRDLVYILMAKGLHCSTVKDFPHSKQLFTACLELVTEFSPKLRQVMLNEMLLLD
FT                   IRTHEAGVGQSGERPPSDLISRVRGYLEMRLPDIPLRQVVAEECVAFMLNWRENEYLTL
FT                   QVPAFLFQNNPYVKLGQLLAATCKELPGPKESRRTAKDLWEVVVQICSVSNQHKRGNDG
FT                   RVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKLHNVREDIVNDITAEHI
FT                   SIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHAWLIIQADIYFATNQHSAALHY
FT                   YLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAILCQFLREIDYKTAFK
FT                   SLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEE
FT                   VLQLAAQRRKKKFLQAMAKLYF"
FT   assembly_gap    7783846..7784238
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            complement(7795378..>7852653)
FT                   /locus_tag="mCG_142132"
FT                   /note="gene_id=mCG142132.0"
FT   mRNA            complement(join(7795378..7796013,7797684..7797842,
FT                   7803032..7803164,7806892..7806974,7807957..7808013,
FT                   7811032..7811152,7815085..7815204,7817647..7817805,
FT                   7819812..7819885,7820333..7820431,7820533..7820664,
FT                   7822696..7822830,7826076..7826199,7833485..7833630,
FT                   7834120..7834241,7834473..7834563,7839537..7839661,
FT                   7847765..7847872,7852521..>7852653))
FT                   /locus_tag="mCG_142132"
FT                   /product="mCG142132, transcript variant mCT179270"
FT                   /note="gene_id=mCG142132.0 transcript_id=mCT179270.0
FT                   created on 31-JAN-2003"
FT   mRNA            complement(join(7795378..7796013,7797684..7797842,
FT                   7803032..7803164,7806892..7806974,7807957..7808013,
FT                   7811032..7811152,7815085..7815204,7817647..7817805,
FT                   7819812..7819885,7820333..7820431,7820533..7820664,
FT                   7822696..7822830,7826076..7826199,7833485..7833630,
FT                   7834120..7834241,7834473..7834563,7839537..7839661,
FT                   7847765..7847872,7850307..7850339,7852521..>7852653))
FT                   /locus_tag="mCG_142132"
FT                   /product="mCG142132, transcript variant mCT179269"
FT                   /note="gene_id=mCG142132.0 transcript_id=mCT179269.0
FT                   created on 31-JAN-2003"
FT   CDS             complement(join(7795849..7796013,7797684..7797842,
FT                   7803032..7803164,7806892..7806974,7807957..7808013,
FT                   7811032..7811152,7815085..7815204,7817647..7817805,
FT                   7819812..7819885,7820333..7820431,7820533..7820664,
FT                   7822696..7822830,7826076..7826199,7833485..7833630,
FT                   7834120..7834241,7834473..7834563,7839537..7839661,
FT                   7847765..7847872,7852521..>7852653))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142132"
FT                   /product="mCG142132, isoform CRA_b"
FT                   /note="gene_id=mCG142132.0 transcript_id=mCT179270.0
FT                   protein_id=mCP102191.0 isoform=CRA_b"
FT                   /protein_id="EDL05652.1"
FT                   /translation="VGARQPGAGRGGRGVWILGGLGDSGLLGSRRATRVSAETMAKEEG
FT                   TSVEPRQRKKQRTSGSQEAKAEKIRRTPAPERAPKYVSFQRFAKIVIGCLAAVISGMMH
FT                   VFYLSAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKT
FT                   ISLKTINAMQQMSLYPELIASVLYQATGSNEVIEPVYFYIGIVFGLQGMYVTALFVTSW
FT                   LMSGTWLAGMLTVAWFLINRVDTTRIEYSIPLRENWALPYFACQVAALTGYLKRNLNTY
FT                   AERFCYLLLSTSTYTFMMVWEYSHYVLFLQAVSLLLLDIFSVEQSDKVYEVYKVYIFSL
FT                   FLGYLLQFENPALLVSPLLSLVGAFMLVKCLQLNGKKGTFVAKVIKVFEFYLLCTLPVT
FT                   LNLIVKMFVPHKENEHVLKFLEVKFGLNMTKNFTLNWLLCQESLQAPSQDFFFRLTQSS
FT                   LLPFYVLVLIICLLSMTQVFFRRMSGKSKKETVTLEDGRIGERPEIIYHVIHTLLLGSL
FT                   AMLMEGLKFIWTPYVCMLAAFGVCSPELWMTLLKWLRLRTVHPMLLALILSMAVPTIIG
FT                   LSLWKEFFPRLITELTELQEFYDPDTVELMTWIKRQAPVAAVFAGSPQLMGVIKLCTGW
FT                   TVTSLPLYSDDDLLQRNENIYQIYSKRSAEDIYKILTSYKANYLIVEDAICNELGTTRG
FT                   CRVKDLLDIANGHVVFEEGDKLTYSKYGRFCHEVKINYSPYVNYFTRVYWNRSYFVYKV
FT                   NTVISFQS"
FT   CDS             complement(join(7795849..7796013,7797684..7797842,
FT                   7803032..7803164,7806892..7806974,7807957..7808013,
FT                   7811032..7811152,7815085..7815204,7817647..7817805,
FT                   7819812..7819885,7820333..7820431,7820533..7820664,
FT                   7822696..7822830,7826076..7826199,7833485..7833630,
FT                   7834120..7834241,7834473..7834563,7839537..7839661,
FT                   7847765..7847872,7850307..>7850307))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142132"
FT                   /product="mCG142132, isoform CRA_a"
FT                   /note="gene_id=mCG142132.0 transcript_id=mCT179269.0
FT                   protein_id=mCP102192.0 isoform=CRA_a"
FT                   /protein_id="EDL05651.1"
FT                   /translation="GTSVEPRQRKKQRTSGSQEAKAEKIRRTPAPERAPKYVSFQRFAK
FT                   IVIGCLAAVISGMMHVFYLSAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAP
FT                   SFERGVYELTHNNKTISLKTINAMQQMSLYPELIASVLYQATGSNEVIEPVYFYIGIVF
FT                   GLQGMYVTALFVTSWLMSGTWLAGMLTVAWFLINRVDTTRIEYSIPLRENWALPYFACQ
FT                   VAALTGYLKRNLNTYAERFCYLLLSTSTYTFMMVWEYSHYVLFLQAVSLLLLDIFSVEQ
FT                   SDKVYEVYKVYIFSLFLGYLLQFENPALLVSPLLSLVGAFMLVKCLQLNGKKGTFVAKV
FT                   IKVFEFYLLCTLPVTLNLIVKMFVPHKENEHVLKFLEVKFGLNMTKNFTLNWLLCQESL
FT                   QAPSQDFFFRLTQSSLLPFYVLVLIICLLSMTQVFFRRMSGKSKKETVTLEDGRIGERP
FT                   EIIYHVIHTLLLGSLAMLMEGLKFIWTPYVCMLAAFGVCSPELWMTLLKWLRLRTVHPM
FT                   LLALILSMAVPTIIGLSLWKEFFPRLITELTELQEFYDPDTVELMTWIKRQAPVAAVFA
FT                   GSPQLMGVIKLCTGWTVTSLPLYSDDDLLQRNENIYQIYSKRSAEDIYKILTSYKANYL
FT                   IVEDAICNELGTTRGCRVKDLLDIANGHVVFEEGDKLTYSKYGRFCHEVKINYSPYVNY
FT                   FTRVYWNRSYFVYKVNTVISFQS"
FT   assembly_gap    7817231..7817458
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    7842462..7842481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7843511..7843530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7848861..7848880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7862447..7917179)
FT                   /gene="Rbm35a"
FT                   /locus_tag="mCG_5095"
FT                   /note="gene_id=mCG5095.3"
FT   mRNA            complement(join(7862447..7863985,7883710..7883878,
FT                   7887887..7888073,7890153..7890371,7891369..7891670,
FT                   7895414..7895456,7895554..7895686,7895784..7895894,
FT                   7897318..7897372,7897495..7897593,7909696..7909810,
FT                   7914745..7914858,7916043..7916171,7916699..7917179))
FT                   /gene="Rbm35a"
FT                   /locus_tag="mCG_5095"
FT                   /product="RNA binding motif protein 35A, transcript variant
FT                   mCT4040"
FT                   /note="gene_id=mCG5095.3 transcript_id=mCT4040.3 created on
FT                   27-JUN-2003"
FT   mRNA            complement(join(7862447..7863985,7883710..7883878,
FT                   7887875..7888073,7890153..7890371,7891369..7891670,
FT                   7895414..7895456,7895554..7895686,7895784..7895894,
FT                   7897318..7897372,7897495..7897593,7909696..>7909810))
FT                   /gene="Rbm35a"
FT                   /locus_tag="mCG_5095"
FT                   /product="RNA binding motif protein 35A, transcript variant
FT                   mCT189830"
FT                   /note="gene_id=mCG5095.3 transcript_id=mCT189830.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7863979..7863985,7883710..7883878,
FT                   7887887..7888073,7890153..7890371,7891369..7891670,
FT                   7895414..7895456,7895554..7895686,7895784..7895894,
FT                   7897318..7897372,7897495..7897593,7909696..7909810,
FT                   7914745..7914858,7916043..7916171,7916699..7916830))
FT                   /codon_start=1
FT                   /gene="Rbm35a"
FT                   /locus_tag="mCG_5095"
FT                   /product="RNA binding motif protein 35A, isoform CRA_b"
FT                   /note="gene_id=mCG5095.3 transcript_id=mCT4040.3
FT                   protein_id=mCP18281.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q3US41"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR034427"
FT                   /db_xref="MGI:MGI:1917326"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3US41"
FT                   /protein_id="EDL05650.1"
FT                   /translation="MTASPDYLVVLFGITAGATGAKLGSDEKELILLLWKVVDLANKKV
FT                   GQLHEVLVRPDQLELTEDCKEETKIDAENLSSAPQLDQALRQFNQSVSNELNIGVGTSF
FT                   CLCTDGQLHIRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTE
FT                   SLNFEKSDSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELID
FT                   DSTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDL
FT                   ALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAE
FT                   EVVAFFGQHCPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKELLGKRYI
FT                   ELFRSTAAEVQQVLNRFSSAPLIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATI
FT                   EDILDFLGEFSTDIRTHGVHMVLNHQGRPSGDAFIQMKSTDRAFMAAQKYHKKTMKDRY
FT                   VEVFQCSAEEMNFVLMGGTLNRNGLSPPPCLSPPSYTFPAPTAVIPTEAAIYQPSLLLN
FT                   PRALQPSTAYYPAGTQLFMNYTAYYPSV"
FT   CDS             complement(join(7863979..7863985,7883710..7883878,
FT                   7887875..7888073,7890153..7890371,7891369..7891670,
FT                   7895414..7895456,7895554..7895686,7895784..7895894,
FT                   7897318..7897372,7897495..7897593,7909696..>7909810))
FT                   /codon_start=1
FT                   /gene="Rbm35a"
FT                   /locus_tag="mCG_5095"
FT                   /product="RNA binding motif protein 35A, isoform CRA_a"
FT                   /note="gene_id=mCG5095.3 transcript_id=mCT189830.0
FT                   protein_id=mCP110827.0 isoform=CRA_a"
FT                   /protein_id="EDL05649.1"
FT                   /translation="NVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTESLNFEKS
FT                   DSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDSTVVRA
FT                   RGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKH
FT                   HMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFG
FT                   QHCPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKELLGKRYIELFRSTA
FT                   AEVQQVLNRFSSAPLIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFL
FT                   GEFSTDIRTHGVHMVLNHQGRPSGDAFIQMKSTDRAFMAAQKYHKKTMKDRYVEVFQCS
FT                   AEEMNFVLMGGTLNRNGLSPPPCKLPCLSPPSYTFPAPTAVIPTEAAIYQPSLLLNPRA
FT                   LQPSTAYYPAGTQLFMNYTAYYPSV"
FT   assembly_gap    7865684..7865703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7882884..7882921
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    7917471..7917490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7930130..7930149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7930150..7931761
FT                   /locus_tag="mCG_51561"
FT                   /note="gene_id=mCG51561.2"
FT   mRNA            <7930150..7931761
FT                   /locus_tag="mCG_51561"
FT                   /product="mCG51561"
FT                   /note="gene_id=mCG51561.2 transcript_id=mCT51744.2 created
FT                   on 12-FEB-2003"
FT   CDS             <7930152..7930844
FT                   /codon_start=1
FT                   /locus_tag="mCG_51561"
FT                   /product="mCG51561"
FT                   /note="gene_id=mCG51561.2 transcript_id=mCT51744.2
FT                   protein_id=mCP38898.2"
FT                   /protein_id="EDL05648.1"
FT                   /translation="QAAVVSWLADGGRGTGRGTGSAGPGRTGRYDMKTRPDEKMHLAVV
FT                   ACGERLEETVTMLKSALIFSIKPLHVHIFAEDQLHNSFKDRLASWSFLRRFDYSLYPIT
FT                   FPCDSAADWKKLFKPCASQRLFLPLILKEVDSLLYVDTDILFLPPVDDIWSLLKKFNST
FT                   QIAAMAPEHKEPRIGWYNRFAWHPYYGRTGVNSGVMLMNMTRMRSKYFKNDMTTARLQL
FT                   GGHTYATA"
FT   assembly_gap    7933160..7933179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7951088..7951107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7970948..7977939
FT                   /pseudo
FT                   /locus_tag="mCG_1043000"
FT                   /note="gene_id=mCG1043000.0"
FT   mRNA            join(7970948..7971112,7977782..7977939)
FT                   /pseudo
FT                   /locus_tag="mCG_1043000"
FT                   /note="gene_id=mCG1043000.0 transcript_id=mCT160704.1
FT                   created on 03-MAR-2003"
FT   assembly_gap    7988602..7989060
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   gene            8016950..8081892
FT                   /locus_tag="mCG_142037"
FT                   /note="gene_id=mCG142037.0"
FT   mRNA            join(8016950..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8047718..8047867,
FT                   8049820..8050308,8052003..8052157,8053751..8053833,
FT                   8057245..8057338,8057493..8058037,8058546..8058781,
FT                   8059436..8059688,8061727..8061944,8065088..8065220,
FT                   8070794..8070946,8071365..8071525,8072994..8073090,
FT                   8075722..8075888,8076860..8077191,8079631..8079774,
FT                   8080445..8081892)
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, transcript variant mCT178534"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT178534.0
FT                   created on 10-JAN-2003"
FT   mRNA            join(8016950..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8049820..8050308,
FT                   8052003..8052157,8053751..8053833,8057245..8057338,
FT                   8057493..8058519)
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, transcript variant mCT178533"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT178533.0
FT                   created on 10-JAN-2003"
FT   CDS             join(8017005..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8047718..8047867,
FT                   8049820..8050308,8052003..8052157,8053751..8053833,
FT                   8057245..8057338,8057493..8058037,8058546..8058781,
FT                   8059436..8059688,8061727..8061944,8065088..8065220,
FT                   8070794..8070946,8071365..8071525,8072994..8073090,
FT                   8075722..8075888,8076860..8077191,8079631..8079774,
FT                   8080445..8080599)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, isoform CRA_c"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT178534.0
FT                   protein_id=mCP101457.0 isoform=CRA_c"
FT                   /protein_id="EDL05647.1"
FT                   /translation="MAVDSSMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPP
FT                   GVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNS
FT                   KVNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHAD
FT                   GEKEDQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPVSGDKEEDVPHREDYFEPIS
FT                   PDRNSVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDEDDCHTVDSIPDDEEED
FT                   EEEEGEEDEEGEGDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDP
FT                   YDRELAPLLYFSCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAK
FT                   WVTALEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIALNVRQLKA
FT                   GTKLVTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGM
FT                   EAFLRSTQNEKSGYQRLLELILLDQTVRVVTAGSAILQKCHFYEILSEIKRLGDHIAEK
FT                   TSAVPNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVF
FT                   HVMETAPHTMTQPPVKSFPTIARITGPPERDDPYPVLFRGPGFGFQHSIVAHSHQLLQF
FT                   QRVQCPLLAYVGTVHTWYIDTCKQNTHDIRYLHSHHFLELVTLLLSIPITSAHQGVLQA
FT                   TKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQSDGADDAFALWLQD
FT                   STQTLQCITELFSHFQRCTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLDKNL
FT                   QSLITLMEYYSKEALGDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHAASLLKLCKA
FT                   DENNAKLQELGKWLEPLKNLRFEINCIPNLIEYVKQNIDNLMTAEGVGLTTALRVLCNV
FT                   ACPPPPVEGQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHR
FT                   VTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQ
FT                   KIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLS
FT                   ELLPLPLPMQTTQVIEPHDISVALNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHM
FT                   LRRICVQLCDLASPTALLIMRTVLDLIVEDLQSTSEDKEKQYTSQTTRLLALLDALASH
FT                   KACKLAILHLINGTIKGDERYAEIFQDLLALVRSPGDSVTRQQCVEYVTSILQSLCDQD
FT                   IALILPSPSEGPASELEQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTMMF
FT                   LAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNADAMGC
FT                   CGDDSGLMEVEGAHPPRTMSLNAAELKQLLQSKEESPESLFLELEKLVLEHSKDDDSLE
FT                   SLLDNVIGLKQMLESSGEPLPLSDQDVEPVLSAPESLQNLFNNRTAYVLTDVMDDQLKS
FT                   MWFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSKTTKGF
FT                   KLGKHKHETFITSSGKSEYIEPAKRAHVVPPPRGRGRGGFGQGIRPHDIFRQRKQNTSR
FT                   PPSMHVDDFVAAESKEVVPQDGIPPPKRPLKVSQKISSRGGFSGNRGGRGAFHSQNRFF
FT                   TPPASKGNYSRREGTRGSSWSAQNTPRGNYNESRGGQSNFNRGPLPPLRPLSSTGYRPS
FT                   PRDRASRGRGGLGPSWASTNSGSGGSRGKFVSGGSGRGRHVRSFTR"
FT   CDS             join(8017005..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8049820..8050308,
FT                   8052003..8052157,8053751..8053833,8057245..8057338,
FT                   8057493..8058070)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, isoform CRA_a"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT178533.0
FT                   protein_id=mCP101456.0 isoform=CRA_a"
FT                   /protein_id="EDL05645.1"
FT                   /translation="MAVDSSMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPP
FT                   GVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNS
FT                   KVNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHAD
FT                   GEKEDQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPVSGDKEEDVPHREDYFEPIS
FT                   PDRNSVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDEDDCHTVDSIPDDEEED
FT                   EEEEGEEDEEGEGDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDP
FT                   YDRELAPLLYFSCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAK
FT                   WVTALEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIALNVRQLKA
FT                   GTKLVTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGM
FT                   EAFLRSTQNEKSGYQRLLELILLDQTVRVVTAGSAILQKCHFYEILSEIKRLGDHIAEK
FT                   TSAVPNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVF
FT                   HVMETAPHTMTQPPVKSFPTIARITGPPERDDPYPVLFRYLHSHHFLELVTLLLSIPIT
FT                   SAHQGVLQATKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQSDGAD
FT                   DAFALWLQDSTQTLQCITELFSHFQRCTASEETDHSDLLGTLHNLYLITFNPVGRSAVG
FT                   HVFSLDKNLQSLITLMEYYSKEALGDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHA
FT                   ASLLKLCKADENNAKLQELGKWLEPLKNLRFEINCIPNLIEYVKQNIDNLMTAEGVGLT
FT                   TALRVLCNVACPPPPVEGQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLH
FT                   VNMGTTLHRVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPL
FT                   SGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEG
FT                   FFSGLILLSELLPLPLPMQTTQVPLHITCILS"
FT   mRNA            join(<8017017..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8049820..8050308,
FT                   8052003..8052157,8053751..8053833,8057245..8057338,
FT                   8057493..8058037,8058546..8058781,8059436..8059688,
FT                   8061727..8061944,8065088..8065220,8070794..8070946,
FT                   8071365..8071525,8072994..8073090,8075722..8075888,
FT                   8076860..8077191,8079631..8079774,8080445..8081590)
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, transcript variant mCT189835"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT189835.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8017017..8017067,8025691..8025806,8029668..8029754,
FT                   8032204..8032252,8036337..8036505,8037849..8037971,
FT                   8038802..8039074,8043923..8045063,8049820..8050308,
FT                   8052003..8052157,8053751..8053833,8057245..8057338,
FT                   8057493..8058037,8058546..8058781,8059436..8059688,
FT                   8061727..8061944,8065088..8065220,8070794..8070946,
FT                   8071365..8071525,8072994..8073090,8075722..8075888,
FT                   8076860..8077191,8079631..8079774,8080445..8080599)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142037"
FT                   /product="mCG142037, isoform CRA_b"
FT                   /note="gene_id=mCG142037.0 transcript_id=mCT189835.0
FT                   protein_id=mCP110818.0 isoform=CRA_b"
FT                   /protein_id="EDL05646.1"
FT                   /translation="SSMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRA
FT                   HSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNT
FT                   DGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHADGEKE
FT                   DQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPVSGDKEEDVPHREDYFEPISPDRN
FT                   SVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDEDDCHTVDSIPDDEEEDEEEE
FT                   GEEDEEGEGDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDPYDRE
FT                   LAPLLYFSCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAKWVTA
FT                   LEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIALNVRQLKAGTKL
FT                   VTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFL
FT                   RSTQNEKSGYQRLLELILLDQTVRVVTAGSAILQKCHFYEILSEIKRLGDHIAEKTSAV
FT                   PNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVFHVME
FT                   TAPHTMTQPPVKSFPTIARITGPPERDDPYPVLFRYLHSHHFLELVTLLLSIPITSAHQ
FT                   GVLQATKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQSDGADDAFA
FT                   LWLQDSTQTLQCITELFSHFQRCTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFS
FT                   LDKNLQSLITLMEYYSKEALGDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHAASLL
FT                   KLCKADENNAKLQELGKWLEPLKNLRFEINCIPNLIEYVKQNIDNLMTAEGVGLTTALR
FT                   VLCNVACPPPPVEGQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMG
FT                   TTLHRVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRL
FT                   DSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSG
FT                   LILLSELLPLPLPMQTTQVIEPHDISVALNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQ
FT                   PIQHMLRRICVQLCDLASPTALLIMRTVLDLIVEDLQSTSEDKEKQYTSQTTRLLALLD
FT                   ALASHKACKLAILHLINGTIKGDERYAEIFQDLLALVRSPGDSVTRQQCVEYVTSILQS
FT                   LCDQDIALILPSPSEGPASELEQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCV
FT                   RTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNA
FT                   DAMGCCGDDSGLMEVEGAHPPRTMSLNAAELKQLLQSKEESPESLFLELEKLVLEHSKD
FT                   DDSLESLLDNVIGLKQMLESSGEPLPLSDQDVEPVLSAPESLQNLFNNRTAYVLTDVMD
FT                   DQLKSMWFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSK
FT                   TTKGFKLGKHKHETFITSSGKSEYIEPAKRAHVVPPPRGRGRGGFGQGIRPHDIFRQRK
FT                   QNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKVSQKISSRGGFSGNRGGRGAFHS
FT                   QNRFFTPPASKGNYSRREGTRGSSWSAQNTPRGNYNESRGGQSNFNRGPLPPLRPLSST
FT                   GYRPSPRDRASRGRGGLGPSWASTNSGSGGSRGKFVSGGSGRGRHVRSFTR"
FT   assembly_gap    8025479..8025531
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    8051743..8051762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8089847..8146691
FT                   /locus_tag="mCG_142038"
FT                   /note="gene_id=mCG142038.0"
FT   mRNA            join(8089847..8089931,8094259..8094409,8100811..8100922,
FT                   8124497..8124691,8126536..8126808,8128701..8128863,
FT                   8130543..8130768,8132418..8132625,8135766..8135905,
FT                   8136928..8137218,8140176..8140351,8141186..8141447,
FT                   8143254..8143320,8143500..8143700,8146325..8146691)
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, transcript variant mCT178535"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT178535.0
FT                   created on 30-JAN-2003"
FT   mRNA            join(8089847..8089931,8094259..8094409,8100811..8100922,
FT                   8114514..8116581)
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, transcript variant mCT178532"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT178532.0
FT                   created on 30-JAN-2003"
FT   CDS             join(8094275..8094409,8100811..8100922,8124497..8124691,
FT                   8126536..8126808,8128701..8128863,8130543..8130768,
FT                   8132418..8132625,8135766..8135905,8136928..8137218,
FT                   8140176..8140351,8141186..8141447,8143254..8143320,
FT                   8143500..8143700,8146325..8146536)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, isoform CRA_b"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT178535.0
FT                   protein_id=mCP101455.0 isoform=CRA_b"
FT                   /protein_id="EDL05642.1"
FT                   /translation="MRRSAAPSQVQGKSFKKTRFIPPGRSNADVSKEITKMSPDPKLFQ
FT                   GAEQSQNDPGVCSSNPCPSEGIPREVGDGTRVDPLPPVHSASKEITESKAQEEEASSLL
FT                   KYFSVVWCKASKKKHKKWEGDAILIVRGRSFTLKDLEGKDIGRGIGYKFKDLENVEEGQ
FT                   TLIIGGKEIEILGTISSDDFNSGKCFQHGSGSPAVPSSQAARKCFSNPFKSVCQSTQAQ
FT                   GKRWNDCRPRHNPCTPNALVMPRPDENHQRMFNRHCSPIVDVVIDPHLVHHLRPHQKDG
FT                   IIFLYECVMGMRAVGKCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLIVT
FT                   PGSLVDNWRKEFQKWLGSERIKIFTVDQDHKVEEFINSTFHSVLIISYEMLLRSLDQIK
FT                   TIPFGLLICDEGHRLKNSSIKTTTALSSLSCEKTVILTGTPVQNDLQEFFALVDFVNPG
FT                   ILGSLSSYRKIYEEPIIISREPSSSKEERELGERRATELTRLTGRFILRRTQEVINKYL
FT                   PPKIENVVFCRPGALQIELYRKLLRSQSVRFCLQGLLENSAHLICIGALKKLCNHPCLL
FT                   FSSVKGKEFSSSCEENEERNLCQGLLSVFPAGYNPLQFSEEESGKLQVLVKLLAVIHEL
FT                   RPTEKVILVSNYRQTLNVLEEVCKRHGYACARLDGQTPVSQRQHIVDSFNSKYSTDFIF
FT                   LLSSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIE
FT                   EKIYQRQISKQGLSGAVVDLTRSSEHIQFSVEELKNLFTLHESSHCVTHDLLDCECTGE
FT                   KGHTEDASEGPVASRQCQFGPQKSDALRPLSMSQLKQWKHFSGDHLNLPDPFLERIREN
FT                   VSFFFQNITNQAPAV"
FT   assembly_gap    8100017..8100272
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   mRNA            join(<8110571..8110944,8114514..8116581)
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, transcript variant mCT51866"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT51866.2 created
FT                   on 30-JAN-2003"
FT   CDS             join(8110571..8110944,8114514..8115039)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, isoform CRA_c"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT51866.2
FT                   protein_id=mCP38893.0 isoform=CRA_c"
FT                   /protein_id="EDL05643.1"
FT                   /translation="MVGKARSSNFTLSEKLDLLNLVKPYVKILEEHTNKNSVIVEKNRC
FT                   WDVIAVNYNAIGVDRPPRTAQGLRSLYKRLKEYAKQELLQQKEAQSEFKSSVSEPTKQV
FT                   MEMIPQIASFGLIRDRSHIQSANLDETAQAGTSSLQVMVDHHPVAITVEVKQEEDIKPS
FT                   PPLVSNPQLSDTLEQREEHELMHVVEGSESPSLSSVDMRMTSSPSSVPRRDEIFHQESG
FT                   EHFRSLLRCDPQVLQMLKEEHQIILENQKNFGLYVQEKRDGLRRRQRLEEELLRAKIEV
FT                   EKLKATRLRRDLPEYSSL"
FT   CDS             8114563..8115039
FT                   /codon_start=1
FT                   /locus_tag="mCG_142038"
FT                   /product="mCG142038, isoform CRA_a"
FT                   /note="gene_id=mCG142038.0 transcript_id=mCT178532.0
FT                   protein_id=mCP101454.0 isoform=CRA_a"
FT                   /protein_id="EDL05641.1"
FT                   /translation="MVDHHPVAITVEVKQEEDIKPSPPLVSNPQLSDTLEQREEHELMH
FT                   VVEGSESPSLSSVDMRMTSSPSSVPRRDEIFHQESGEHFRSLLRCDPQVLQMLKEEHQI
FT                   ILENQKNFGLYVQEKRDGLRRRQRLEEELLRAKIEVEKLKATRLRRDLPEYSSL"
FT   assembly_gap    8123353..8123489
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    8135350..8135369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8142022..>8145890)
FT                   /locus_tag="mCG_146061"
FT                   /note="gene_id=mCG146061.0"
FT   mRNA            complement(join(8142022..8142264,8143133..8143260,
FT                   8145830..>8145890))
FT                   /locus_tag="mCG_146061"
FT                   /product="mCG146061"
FT                   /note="gene_id=mCG146061.0 transcript_id=mCT186164.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(8142066..8142264,8143133..>8143260))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146061"
FT                   /product="mCG146061"
FT                   /note="gene_id=mCG146061.0 transcript_id=mCT186164.0
FT                   protein_id=mCP107558.0"
FT                   /protein_id="EDL05644.1"
FT                   /translation="TWPRQKKSYEYNRKQWPLPHQQSAGIYCTIGNSGFHCQHDAERLT
FT                   ITPSFMWCDSDLWREDDRRTHQAVVEALMLQNQLAAEALDTKPWVKSFSWHCPSLVLRI
FT                   NYCL"
FT   assembly_gap    8148883..8148902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8159551..8159621
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            complement(8180361..8181249)
FT                   /pseudo
FT                   /locus_tag="mCG_48696"
FT                   /note="gene_id=mCG48696.2"
FT   mRNA            complement(8180361..8181249)
FT                   /pseudo
FT                   /locus_tag="mCG_48696"
FT                   /note="gene_id=mCG48696.2 transcript_id=mCT48879.2 created
FT                   on 03-MAR-2003"
FT   assembly_gap    8197069..8197359
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    8201031..8201050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8205196..8205215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217438..8217557
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            8234915..8245215
FT                   /gene="Gem"
FT                   /locus_tag="mCG_5096"
FT                   /note="gene_id=mCG5096.1"
FT   mRNA            join(8234915..8235026,8236365..8236701,8241599..8241675,
FT                   8242430..8242634,8243936..8245215)
FT                   /gene="Gem"
FT                   /locus_tag="mCG_5096"
FT                   /product="GTP binding protein (gene overexpressed in
FT                   skeletal muscle), transcript variant mCT4037"
FT                   /note="gene_id=mCG5096.1 transcript_id=mCT4037.0 created on
FT                   02-AUG-2002"
FT   mRNA            join(<8236267..8236701,8241599..8241675,8242430..8242634,
FT                   8243936..8245209)
FT                   /gene="Gem"
FT                   /locus_tag="mCG_5096"
FT                   /product="GTP binding protein (gene overexpressed in
FT                   skeletal muscle), transcript variant mCT189832"
FT                   /note="gene_id=mCG5096.1 transcript_id=mCT189832.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8236365..8236701,8241599..8241675,8242430..8242634,
FT                   8243936..8244213)
FT                   /codon_start=1
FT                   /gene="Gem"
FT                   /locus_tag="mCG_5096"
FT                   /product="GTP binding protein (gene overexpressed in
FT                   skeletal muscle), isoform CRA_a"
FT                   /note="gene_id=mCG5096.1 transcript_id=mCT189832.0
FT                   protein_id=mCP110828.0 isoform=CRA_a"
FT                   /protein_id="EDL05639.1"
FT                   /translation="DPAMTLNNVTMRQGTVGMQPQQRWSIPADARHLMVQKDPHPCNLR
FT                   NRHSTAPEEHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSM
FT                   DSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
FT                   RASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIET
FT                   SAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRRESIPRKARRFWGKIVAKNNK
FT                   NMAFKLKSKSCHDLSVL"
FT   CDS             join(8236374..8236701,8241599..8241675,8242430..8242634,
FT                   8243936..8244213)
FT                   /codon_start=1
FT                   /gene="Gem"
FT                   /locus_tag="mCG_5096"
FT                   /product="GTP binding protein (gene overexpressed in
FT                   skeletal muscle), isoform CRA_b"
FT                   /note="gene_id=mCG5096.1 transcript_id=mCT4037.0
FT                   protein_id=mCP18283.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TH76"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017358"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TH76"
FT                   /protein_id="EDL05640.1"
FT                   /translation="MTLNNVTMRQGTVGMQPQQRWSIPADARHLMVQKDPHPCNLRNRH
FT                   STAPEEHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSD
FT                   CEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRAS
FT                   FEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAA
FT                   VQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRRESIPRKARRFWGKIVAKNNKNMA
FT                   FKLKSKSCHDLSVL"
FT   assembly_gap    8248357..8248994
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    8270640..8270816
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    8272600..8272649
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            8288809..8347667
FT                   /gene="Cdh17"
FT                   /locus_tag="mCG_5094"
FT                   /note="gene_id=mCG5094.2"
FT   mRNA            join(8288809..8288934,8298361..8298430,8301895..8301993,
FT                   8310727..8310861,8311791..8311929,8313722..8313880,
FT                   8313976..8314175,8315268..8315399,8315764..8315914,
FT                   8325263..8325478,8327473..8327549,8329339..8329530,
FT                   8333655..8333899,8337208..8337338,8340005..8340244,
FT                   8344380..8344496,8344626..8344739,8346755..8347667)
FT                   /gene="Cdh17"
FT                   /locus_tag="mCG_5094"
FT                   /product="cadherin 17, transcript variant mCT4043"
FT                   /note="gene_id=mCG5094.2 transcript_id=mCT4043.2 created on
FT                   30-JUN-2003"
FT   mRNA            join(8288809..8288934,8298361..8298430,8301895..8301993,
FT                   8310727..8310861,8311791..8311929,8313722..8313880,
FT                   8313976..8314175,8315268..8315399,8315764..8315914,
FT                   8325263..8325478,8327473..8327549,8329339..8329530,
FT                   8333655..8333899,8337208..8337338,8340005..8341256)
FT                   /gene="Cdh17"
FT                   /locus_tag="mCG_5094"
FT                   /product="cadherin 17, transcript variant mCT186544"
FT                   /note="gene_id=mCG5094.2 transcript_id=mCT186544.0 created
FT                   on 30-JUN-2003"
FT   assembly_gap    8290267..8290286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(8298383..8298430,8301895..8301993,8310727..8310861,
FT                   8311791..8311929,8313722..8313880,8313976..8314175,
FT                   8315268..8315399,8315764..8315914,8325263..8325478,
FT                   8327473..8327549,8329339..8329530,8333655..8333899,
FT                   8337208..8337338,8340005..8340244,8344380..8344496,
FT                   8344626..8344739,8346755..8346843)
FT                   /codon_start=1
FT                   /gene="Cdh17"
FT                   /locus_tag="mCG_5094"
FT                   /product="cadherin 17, isoform CRA_b"
FT                   /note="gene_id=mCG5094.2 transcript_id=mCT4043.2
FT                   protein_id=mCP18277.1 isoform=CRA_b"
FT                   /protein_id="EDL05638.1"
FT                   /translation="MVSAQLHFLCLLTLYLTCGYGEEGKFSGPLKPMTFSIFEGQEPSQ
FT                   VIFQFKTNPPAVTFELTGETDGIFKIEKDGLLYHTRALDRETRAVHHLQLAALDSHGAI
FT                   VDGPVPITIEVKDINDNRPTFLQSKYEGSVRQNSRPGKPFMYVNATDLDDPATPNGQLF
FT                   YQIVIQLPQINDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENS
FT                   FSDTTYVDISIRENIWKAPEPVEIRENSTDPHPIKITQVQWNDPGAQYSLVNKEKLSPF
FT                   PFSIDQEGNIYVTQALDREEKNSHVFFATAKDENGKPLAYPLEIYVKVIDINDNPPTCL
FT                   SPVTVFEVQENEPLGNSIGIFEAHDMDEANNINSILKYKLVDQTPKVPSDGLFLIGEYE
FT                   GKVQLSKQSLKKQDSPQYNLSIEVSDVDFKTLCYIQVNVIDINDQIPIFETSNYGSKTL
FT                   SEDTAIGSTILIIQATDADEPFTGSSKILYKIVQGDTEGRLEVVTDPTTNAGYVKIKKP
FT                   LDFETQPVSSIVFQAENPEPLVKGIEYNASSFASFELIVTDVNEVPVFPQRIFQANVSE
FT                   DAAVGSRVGNVTARDPEGLTVSYSLKGNMRGWLKIDSVTGEIFSAAPLDRETESVYRVQ
FT                   VVATEVGGSSLSSTADFHLVLTDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEVTDDDQ
FT                   QSLRRPKFTFALGREGLQSDWEVSKINGTHARLSTRHTRFEEQVYNIPIRINDGGQPPM
FT                   EGTVFLPVTFCQCVEGSCFRPAGRQDGIPTVGMAVGILLTTFLVIGIILAVVFIRMRKD
FT                   KVENPQSPENKPLRS"
FT   CDS             join(8298383..8298430,8301895..8301993,8310727..8310861,
FT                   8311791..8311929,8313722..8313880,8313976..8314175,
FT                   8315268..8315399,8315764..8315914,8325263..8325478,
FT                   8327473..8327549,8329339..8329530,8333655..8333899,
FT                   8337208..8337338,8340005..8340267)
FT                   /codon_start=1
FT                   /gene="Cdh17"
FT                   /locus_tag="mCG_5094"
FT                   /product="cadherin 17, isoform CRA_a"
FT                   /note="gene_id=mCG5094.2 transcript_id=mCT186544.0
FT                   protein_id=mCP107248.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AKS7"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1095414"
FT                   /db_xref="UniProtKB/TrEMBL:A2AKS7"
FT                   /protein_id="EDL05637.1"
FT                   /translation="MVSAQLHFLCLLTLYLTCGYGEEGKFSGPLKPMTFSIFEGQEPSQ
FT                   VIFQFKTNPPAVTFELTGETDGIFKIEKDGLLYHTRALDRETRAVHHLQLAALDSHGAI
FT                   VDGPVPITIEVKDINDNRPTFLQSKYEGSVRQNSRPGKPFMYVNATDLDDPATPNGQLF
FT                   YQIVIQLPQINDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENS
FT                   FSDTTYVDISIRENIWKAPEPVEIRENSTDPHPIKITQVQWNDPGAQYSLVNKEKLSPF
FT                   PFSIDQEGNIYVTQALDREEKNSHVFFATAKDENGKPLAYPLEIYVKVIDINDNPPTCL
FT                   SPVTVFEVQENEPLGNSIGIFEAHDMDEANNINSILKYKLVDQTPKVPSDGLFLIGEYE
FT                   GKVQLSKQSLKKQDSPQYNLSIEVSDVDFKTLCYIQVNVIDINDQIPIFETSNYGSKTL
FT                   SEDTAIGSTILIIQATDADEPFTGSSKILYKIVQGDTEGRLEVVTDPTTNAGYVKIKKP
FT                   LDFETQPVSSIVFQAENPEPLVKGIEYNASSFASFELIVTDVNEVPVFPQRIFQANVSE
FT                   DAAVGSRVGNVTARDPEGLTVSYSLKGNMRGWLKIDSVTGEIFSAAPLDRETESVYRVQ
FT                   VVATEVGGSSLSSTADFHLVLTDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEVTDDDQ
FT                   QSLRRPKFTFALGREGLQSDWEVSKINGELSNVQ"
FT   assembly_gap    8311069..8311088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8316879..8316911
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    8375580..8375679
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    8383414..8383508
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    8386008..8386091
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    8386383..8386510
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    8419667..8419686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8473735..8474441
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   gene            complement(8489710..8496560)
FT                   /locus_tag="mCG_54027"
FT                   /note="gene_id=mCG54027.2"
FT   mRNA            complement(join(8489710..8492386,8496438..8496560))
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, transcript variant mCT54210"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT54210.2 created
FT                   on 30-JAN-2003"
FT   mRNA            complement(join(8489710..8492386,8495766..8495800,
FT                   8496438..8496560))
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, transcript variant mCT179272"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT179272.0 created
FT                   on 30-JAN-2003"
FT   mRNA            complement(join(8489710..8492386,8495766..8495864))
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, transcript variant mCT179271"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT179271.0 created
FT                   on 30-JAN-2003"
FT   CDS             complement(join(8490726..8492386,8495766..8495829))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, isoform CRA_c"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT179271.0
FT                   protein_id=mCP102193.0 isoform=CRA_c"
FT                   /protein_id="EDL05636.1"
FT                   /translation="MLSAPCCDDRRMCVCPGPRRIGIPVRTSSLPLFSDAMPAPTQLFF
FT                   PLVRNCELSRIYGTACYCHHKHLCCSPPYIPQNRLRYTPHPAYATFCRPRENWWQYTQG
FT                   RRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRR
FT                   SAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRAL
FT                   LPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESADIDVKEALINAFKRLDN
FT                   DISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGS
FT                   WSAVTLSNDHNAQNERELERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKWSID
FT                   LQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGLWE
FT                   TMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRAKMSSVFEDQNAATH
FT                   LIRHAVGNNEFGAVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQEQ"
FT   CDS             complement(join(8490726..8492386,8495766..8495796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, isoform CRA_a"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT179272.0
FT                   protein_id=mCP102194.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AJP9"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:2685870"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJP9"
FT                   /protein_id="EDL05634.1"
FT                   /translation="MCVCPGPRRIGIPVRTSSLPLFSDAMPAPTQLFFPLVRNCELSRI
FT                   YGTACYCHHKHLCCSPPYIPQNRLRYTPHPAYATFCRPRENWWQYTQGRRYASTPQKFY
FT                   LTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGM
FT                   LLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPN
FT                   DYFSKEASKLYFNSLRTYWQELIDLNTGESADIDVKEALINAFKRLDNDISLEAQVGDP
FT                   NSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHN
FT                   AQNERELERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPD
FT                   QLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGLWETMHRQDVVRIV
FT                   GEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRAKMSSVFEDQNAATHLIRHAVGNNEF
FT                   GAVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQEQ"
FT   CDS             complement(8490726..8492342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54027"
FT                   /product="mCG54027, isoform CRA_b"
FT                   /note="gene_id=mCG54027.2 transcript_id=mCT54210.2
FT                   protein_id=mCP38897.2 isoform=CRA_b"
FT                   /db_xref="GOA:A8Y5Q1"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:2685870"
FT                   /db_xref="UniProtKB/TrEMBL:A8Y5Q1"
FT                   /protein_id="EDL05635.1"
FT                   /translation="MPAPTQLFFPLVRNCELSRIYGTACYCHHKHLCCSPPYIPQNRLR
FT                   YTPHPAYATFCRPRENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGK
FT                   NVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYI
FT                   AVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDL
FT                   NTGESADIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDG
FT                   VDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKNEAKSVVKQ
FT                   DRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEP
FT                   EVTYHRLRPQDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQM
FT                   HGLLTERRAKMSSVFEDQNAATHLIRHAVGNNEFGAVDHERLSKMLSLPEELARMYRDD
FT                   ITIIVVQFNSHVVGAYQNQEQ"
FT   assembly_gap    8496009..8496265
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   gene            <8496699..8524543
FT                   /locus_tag="mCG_123729"
FT                   /note="gene_id=mCG123729.1"
FT   mRNA            join(<8496699..8496819,8506580..8506723,8507593..8507706,
FT                   8510278..8510544,8524128..8524543)
FT                   /locus_tag="mCG_123729"
FT                   /product="mCG123729, transcript variant mCT124965"
FT                   /note="gene_id=mCG123729.1 transcript_id=mCT124965.1
FT                   created on 09-JAN-2003"
FT   mRNA            join(<8496699..8496819,8524128..8524543)
FT                   /locus_tag="mCG_123729"
FT                   /product="mCG123729, transcript variant mCT178402"
FT                   /note="gene_id=mCG123729.1 transcript_id=mCT178402.0
FT                   created on 09-JAN-2003"
FT   CDS             join(<8507604..8507706,8510278..8510544,8524128..8524270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123729"
FT                   /product="mCG123729, isoform CRA_a"
FT                   /note="gene_id=mCG123729.1 transcript_id=mCT124965.1
FT                   protein_id=mCP67970.1 isoform=CRA_a"
FT                   /protein_id="EDL05632.1"
FT                   /translation="SPSCTSATDVWRGLSPAPECTLVGASVSESPKGPGLHPSSGLRSG
FT                   HPEEKDFEVLRGLASRSGGKGTTNGDEICLYFPDVPGLQSQSHEPWKGGVGKDAVSDVT
FT                   FYAQKCLCLASLCDFSWIPVTAAFKVKSGMFQGTGHETFKSLEKRQTLSVQGQRQVKEP
FT                   WLQFVDQ"
FT   assembly_gap    8515135..8515314
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   CDS             <8524239..8524412
FT                   /codon_start=1
FT                   /locus_tag="mCG_123729"
FT                   /product="mCG123729, isoform CRA_b"
FT                   /note="gene_id=mCG123729.1 transcript_id=mCT178402.0
FT                   protein_id=mCP101324.0 isoform=CRA_b"
FT                   /protein_id="EDL05633.1"
FT                   /translation="RSHGYSLWTSSLWTPSLQTLRPGLESQILLFGTVSELGIDMESGR
FT                   IENRTYTDTLPW"
FT   assembly_gap    8525352..8525533
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            complement(8529707..8539279)
FT                   /locus_tag="mCG_147152"
FT                   /note="gene_id=mCG147152.0"
FT   mRNA            complement(join(8529707..8530210,8539085..8539279))
FT                   /locus_tag="mCG_147152"
FT                   /product="mCG147152"
FT                   /note="gene_id=mCG147152.0 transcript_id=mCT187415.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8529964..8530068)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147152"
FT                   /product="mCG147152"
FT                   /note="gene_id=mCG147152.0 transcript_id=mCT187415.0
FT                   protein_id=mCP108346.0"
FT                   /protein_id="EDL05631.1"
FT                   /translation="MLQLTYLSHLEEMGTSPAGEVEHRPFLKAAFVKG"
FT   assembly_gap    8558824..8558843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8568834..8569663
FT                   /estimated_length=830
FT                   /gap_type="unknown"
FT   gene            complement(8571218..8672290)
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /note="gene_id=mCG123730.2"
FT   mRNA            complement(join(8571218..8571994,8572737..8572879,
FT                   8577940..8578044,8578148..8578264,8579343..8579459,
FT                   8579955..8580035,8583345..8583485,8585404..8585543,
FT                   8585632..8585731,8586703..8586789,8586988..8587086,
FT                   8589273..8589371,8590478..8590534,8593712..8593817,
FT                   8594992..8595115,8595631..8595787,8600856..8600921,
FT                   8601404..8601481,8602227..8602335,8602439..8602593,
FT                   8605694..8605756,8607255..8607329,8607423..8607492,
FT                   8609136..8609235,8611677..8611770,8668328..8668416,
FT                   8670131..8670417,8671702..8672290))
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, transcript variant
FT                   mCT124966"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT124966.2
FT                   created on 25-APR-2003"
FT   CDS             complement(join(8572766..8572879,8577940..8578044,
FT                   8578148..8578264,8579343..8579459,8579955..8580035,
FT                   8583345..8583485,8585404..8585543,8585632..8585731,
FT                   8586703..8586789,8586988..8587086,8589273..8589371,
FT                   8590478..8590534,8593712..8593817,8594992..8595115,
FT                   8595631..8595787,8600856..8600921,8601404..8601481,
FT                   8602227..8602335,8602439..8602593,8605694..8605756,
FT                   8607255..8607329,8607423..8607492,8609136..8609235,
FT                   8611677..8611770,8668328..8668416,8670131..8670417,
FT                   8671702..8671844))
FT                   /codon_start=1
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, isoform CRA_c"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT124966.2
FT                   protein_id=mCP67971.2 isoform=CRA_c"
FT                   /protein_id="EDL05629.1"
FT                   /translation="METTLPSGPDKPMHRLSAHAQSRPNQPPLGALNARAQTYCFGYSD
FT                   WRVSADSPRRLLGSWRLRTQDMGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLVLCEVSW
FT                   AQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPS
FT                   IICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELC
FT                   DESENSFTKANALGTRCVRCEPTFVNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTA
FT                   RYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNMNSYDSTTLDACRLF
FT                   HYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFV
FT                   AASYDIRGNFIKWQPLEGGVLQLCPDTERRLDAAYAFGTTYQQNCEISLSKLLVDFSSP
FT                   VFYDVYLEYTDEEQHRYLWPIPVLNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGR
FT                   ENDLGNQPRVIRVATQISLSIRLVPNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKISFS
FT                   VKYEMNQGDASVHTDIALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQTVMKFLLYYAG
FT                   DLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPVQEERFVTYVGCAFAMKALQFLHKF
FT                   ISQISIDIFFIDWERPKGKVLKAVEGEGGVRSATVPVSIWRTYFVANEWNEIQTVRKIN
FT                   PLFQVLTTLFFLEVVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYAVATAIWLVIGII
FT                   QVVFFAAFYERFIEDKIRQFVDLCSMSNVSVFLLSHRCFGYYIHGRSVHGHADTNMEEM
FT                   NMNLKREAENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTRRNGPARLLSSSG
FT                   STFEQSIKAYHAMNKFLGSFIDHMKAILSAVCCIMGTRPRSSSLICCSSVLWIWLARTL
FT                   F"
FT   assembly_gap    8575281..8576372
FT                   /estimated_length=1092
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8592009..8593817,8594992..8595115,
FT                   8595631..8595787,8600856..8600921,8601404..8601481,
FT                   8602227..8602335,8602439..8602593,8605694..8605756,
FT                   8607255..8607329,8607423..8607492,8609136..8609235,
FT                   8611677..8611770,8668328..8668416,8670131..8670417,
FT                   8671702..8672290))
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, transcript variant
FT                   mCT182049"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT182049.0
FT                   created on 25-APR-2003"
FT   CDS             complement(join(8593664..8593817,8594992..8595115,
FT                   8595631..8595787,8600856..8600921,8601404..8601481,
FT                   8602227..8602335,8602439..8602593,8605694..8605756,
FT                   8607255..8607329,8607423..8607492,8609136..8609235,
FT                   8611677..8611770,8668328..8668416,8670131..8670417,
FT                   8671702..8671844))
FT                   /codon_start=1
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, isoform CRA_a"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT182049.0
FT                   protein_id=mCP104972.0 isoform=CRA_a"
FT                   /protein_id="EDL05627.1"
FT                   /translation="METTLPSGPDKPMHRLSAHAQSRPNQPPLGALNARAQTYCFGYSD
FT                   WRVSADSPRRLLGSWRLRTQDMGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLVLCEVSW
FT                   AQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPS
FT                   IICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELC
FT                   DESENSFTKANALGTRCVRCEPTFVNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTA
FT                   RYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNMNSYDSTTLDACRLF
FT                   HYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFV
FT                   AASYDIRGNFIKWQPLEGGVLQLCPDTERRLDAAYAFGTTYQQNCEISLSKLLVDFSSP
FT                   VFYDVYLEYTDEEQHRYLWPIPVLNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGR
FT                   ENDLGNQPRVIRVATQISLSIRLVPNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKVSSS
FT                   LFSALVFINTT"
FT   assembly_gap    8598947..8598966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8600451..8600921,8601404..8601481,
FT                   8602227..8602335,8602439..8602593,8605694..8605756,
FT                   8607255..8607329,8607423..8607492,8609136..8609235,
FT                   8611677..8611770,8668328..8668416,8670131..8670417,
FT                   8671702..8672290))
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, transcript variant
FT                   mCT178403"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT178403.1
FT                   created on 25-APR-2003"
FT   CDS             complement(join(8600787..8600921,8601404..8601481,
FT                   8602227..8602335,8602439..8602593,8605694..8605756,
FT                   8607255..8607329,8607423..8607492,8609136..8609235,
FT                   8611677..8611770,8668328..8668416,8670131..8670417,
FT                   8671702..8671844))
FT                   /codon_start=1
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, isoform CRA_d"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT178403.1
FT                   protein_id=mCP101325.1 isoform=CRA_d"
FT                   /protein_id="EDL05630.1"
FT                   /translation="METTLPSGPDKPMHRLSAHAQSRPNQPPLGALNARAQTYCFGYSD
FT                   WRVSADSPRRLLGSWRLRTQDMGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLVLCEVSW
FT                   AQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPS
FT                   IICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELC
FT                   DESENSFTKANALGTRCVRCEPTFVNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTA
FT                   RYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNMNSYDSTTLDACRLF
FT                   HYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFV
FT                   AASYDIRGNFIKWQPLEGGVLQLCPDTERRLDAAYAFGTTYQQNVSVTLFARQPVFSLR
FT                   STDWNDR"
FT   assembly_gap    8604056..8604233
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8610388..8611770,8668328..8668416,
FT                   8670131..8670417,8671702..8672290))
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, transcript variant
FT                   mCT182050"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT182050.0
FT                   created on 25-APR-2003"
FT   CDS             complement(join(8611588..8611770,8668328..8668416,
FT                   8670131..8670417,8671702..8671844))
FT                   /codon_start=1
FT                   /gene="Tmem67"
FT                   /locus_tag="mCG_123730"
FT                   /product="transmembrane protein 67, isoform CRA_b"
FT                   /note="gene_id=mCG123730.2 transcript_id=mCT182050.0
FT                   protein_id=mCP104971.0 isoform=CRA_b"
FT                   /protein_id="EDL05628.1"
FT                   /translation="METTLPSGPDKPMHRLSAHAQSRPNQPPLGALNARAQTYCFGYSD
FT                   WRVSADSPRRLLGSWRLRTQDMGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLVLCEVSW
FT                   AQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPS
FT                   IICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILGKNNIYKIMVMNFCVYFI
FT                   KDINLNGFVVV"
FT   assembly_gap    8617899..8619382
FT                   /estimated_length=1484
FT                   /gap_type="unknown"
FT   assembly_gap    8622102..8622121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8638495..8640915
FT                   /pseudo
FT                   /locus_tag="mCG_142129"
FT                   /note="gene_id=mCG142129.0"
FT   mRNA            join(8638495..8638992,8639392..8640915)
FT                   /pseudo
FT                   /locus_tag="mCG_142129"
FT                   /note="gene_id=mCG142129.0 transcript_id=mCT161069.2
FT                   created on 30-JAN-2003"
FT   assembly_gap    8639016..8639389
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   gene            8649217..8651857
FT                   /pseudo
FT                   /locus_tag="mCG_1040577"
FT                   /note="gene_id=mCG1040577.2"
FT   mRNA            join(8649217..8649900,8650999..8651857)
FT                   /pseudo
FT                   /locus_tag="mCG_1040577"
FT                   /note="gene_id=mCG1040577.2 transcript_id=mCT124962.1
FT                   created on 30-JAN-2003"
FT   assembly_gap    8649901..8650998
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    8653159..8653178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8655300..8656449)
FT                   /pseudo
FT                   /locus_tag="mCG_1056"
FT                   /note="gene_id=mCG1056.1"
FT   mRNA            complement(8655300..8656449)
FT                   /pseudo
FT                   /locus_tag="mCG_1056"
FT                   /note="gene_id=mCG1056.1 transcript_id=mCT8703.1 created on
FT                   30-JAN-2003"
FT   assembly_gap    8662597..8664677
FT                   /estimated_length=2081
FT                   /gap_type="unknown"
FT   assembly_gap    8667993..8668012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8671801..8675812
FT                   /locus_tag="mCG_123728"
FT                   /note="gene_id=mCG123728.1"
FT   mRNA            join(8671801..8672142,8672500..8672549,8673092..8675812)
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, transcript variant mCT124964"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT124964.1
FT                   created on 09-JAN-2003"
FT   mRNA            join(8671804..8671939,8672078..8672142,8672500..8672549,
FT                   8673092..8675812)
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, transcript variant mCT178401"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT178401.0
FT                   created on 09-JAN-2003"
FT   mRNA            join(8671804..8671939,8672500..8672549,8673092..8675812)
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, transcript variant mCT178400"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT178400.0
FT                   created on 09-JAN-2003"
FT   assembly_gap    8672291..8672310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             8673120..8675624
FT                   /codon_start=1
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, isoform CRA_a"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT124964.1
FT                   protein_id=mCP67969.1 isoform=CRA_a"
FT                   /protein_id="EDL05624.1"
FT                   /translation="MAVVIRLLGLPFIAGPVDIRHFFKGLTIPDGGVHIIGGKVGEAFI
FT                   IFATDEDARRAISRSGGFIKDSSVELFLSSKVEMQKTIEMKRTARVGRGRPGSGASGVG
FT                   NVYHFSDALKEEESYSGYGSSVNRDAGFHTNGTGLDLRPRKTRPLKAENPYLFLRGLPY
FT                   LVNEDDVRVFFSGLCVDGVILLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFI
FT                   EVMQGSEQQWIEFGGTATEGGDTPRMRSEEHSPSRRINGRHFRKRSHSKSPRARSRSPL
FT                   GFYVHLKNLSLNTNKRDLRNLFRDTDLTNDQIKFVYKDERRTRYAFVMFKNQKDYNTAL
FT                   GLHKTVLQYRPVLIDPVSRKEMVRIIECYEKKRPESLEKERPGRVSQKYSQEGFSGSGQ
FT                   KLCIYIRNLPFDVTKGEVQKFFADFSLVEDDIYLLCDDKGVGLGEALVRFKSEEQAMKA
FT                   ERLNRQRFLGIEVLLRLISEEQMQEFGIKSSWLSNERTQACSRSHDGDDCSCLFDLKDP
FT                   SSCSFGQSESLRYHPKDLRKMGHFKHPQGYFRQSDRCSPEDFRHSPEDYRHPWEEHTSH
FT                   SREEDWRLPLEDWPQEDDFRQCHEKDHRQLRSPWEEDFRRPSQEHFRRSYQEHIRRPPQ
FT                   EHFRRSREEDFRHVADEDFRQASDEDFRISQEDLRYPTDEDFRRVSVEDLREVPEKDLR
FT                   LPKNFRSPGEEFWTPPDFRGQHPFGNFDHLQGGKFDFEKYKFGSFPDAKVTSDLNLNCV
FT                   SDKIIPVKISNLPFKANASEILDFFHGYKVIPDSVSLQYNEQGLPIGEAIVAMTNYNEA
FT                   LAAVKDLSGRPVGPRKVKLSLL"
FT   CDS             8673120..8675624
FT                   /codon_start=1
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, isoform CRA_a"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT178400.0
FT                   protein_id=mCP101323.0 isoform=CRA_a"
FT                   /protein_id="EDL05625.1"
FT                   /translation="MAVVIRLLGLPFIAGPVDIRHFFKGLTIPDGGVHIIGGKVGEAFI
FT                   IFATDEDARRAISRSGGFIKDSSVELFLSSKVEMQKTIEMKRTARVGRGRPGSGASGVG
FT                   NVYHFSDALKEEESYSGYGSSVNRDAGFHTNGTGLDLRPRKTRPLKAENPYLFLRGLPY
FT                   LVNEDDVRVFFSGLCVDGVILLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFI
FT                   EVMQGSEQQWIEFGGTATEGGDTPRMRSEEHSPSRRINGRHFRKRSHSKSPRARSRSPL
FT                   GFYVHLKNLSLNTNKRDLRNLFRDTDLTNDQIKFVYKDERRTRYAFVMFKNQKDYNTAL
FT                   GLHKTVLQYRPVLIDPVSRKEMVRIIECYEKKRPESLEKERPGRVSQKYSQEGFSGSGQ
FT                   KLCIYIRNLPFDVTKGEVQKFFADFSLVEDDIYLLCDDKGVGLGEALVRFKSEEQAMKA
FT                   ERLNRQRFLGIEVLLRLISEEQMQEFGIKSSWLSNERTQACSRSHDGDDCSCLFDLKDP
FT                   SSCSFGQSESLRYHPKDLRKMGHFKHPQGYFRQSDRCSPEDFRHSPEDYRHPWEEHTSH
FT                   SREEDWRLPLEDWPQEDDFRQCHEKDHRQLRSPWEEDFRRPSQEHFRRSYQEHIRRPPQ
FT                   EHFRRSREEDFRHVADEDFRQASDEDFRISQEDLRYPTDEDFRRVSVEDLREVPEKDLR
FT                   LPKNFRSPGEEFWTPPDFRGQHPFGNFDHLQGGKFDFEKYKFGSFPDAKVTSDLNLNCV
FT                   SDKIIPVKISNLPFKANASEILDFFHGYKVIPDSVSLQYNEQGLPIGEAIVAMTNYNEA
FT                   LAAVKDLSGRPVGPRKVKLSLL"
FT   CDS             8673120..8675624
FT                   /codon_start=1
FT                   /locus_tag="mCG_123728"
FT                   /product="mCG123728, isoform CRA_a"
FT                   /note="gene_id=mCG123728.1 transcript_id=mCT178401.0
FT                   protein_id=mCP101322.0 isoform=CRA_a"
FT                   /protein_id="EDL05626.1"
FT                   /translation="MAVVIRLLGLPFIAGPVDIRHFFKGLTIPDGGVHIIGGKVGEAFI
FT                   IFATDEDARRAISRSGGFIKDSSVELFLSSKVEMQKTIEMKRTARVGRGRPGSGASGVG
FT                   NVYHFSDALKEEESYSGYGSSVNRDAGFHTNGTGLDLRPRKTRPLKAENPYLFLRGLPY
FT                   LVNEDDVRVFFSGLCVDGVILLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFI
FT                   EVMQGSEQQWIEFGGTATEGGDTPRMRSEEHSPSRRINGRHFRKRSHSKSPRARSRSPL
FT                   GFYVHLKNLSLNTNKRDLRNLFRDTDLTNDQIKFVYKDERRTRYAFVMFKNQKDYNTAL
FT                   GLHKTVLQYRPVLIDPVSRKEMVRIIECYEKKRPESLEKERPGRVSQKYSQEGFSGSGQ
FT                   KLCIYIRNLPFDVTKGEVQKFFADFSLVEDDIYLLCDDKGVGLGEALVRFKSEEQAMKA
FT                   ERLNRQRFLGIEVLLRLISEEQMQEFGIKSSWLSNERTQACSRSHDGDDCSCLFDLKDP
FT                   SSCSFGQSESLRYHPKDLRKMGHFKHPQGYFRQSDRCSPEDFRHSPEDYRHPWEEHTSH
FT                   SREEDWRLPLEDWPQEDDFRQCHEKDHRQLRSPWEEDFRRPSQEHFRRSYQEHIRRPPQ
FT                   EHFRRSREEDFRHVADEDFRQASDEDFRISQEDLRYPTDEDFRRVSVEDLREVPEKDLR
FT                   LPKNFRSPGEEFWTPPDFRGQHPFGNFDHLQGGKFDFEKYKFGSFPDAKVTSDLNLNCV
FT                   SDKIIPVKISNLPFKANASEILDFFHGYKVIPDSVSLQYNEQGLPIGEAIVAMTNYNEA
FT                   LAAVKDLSGRPVGPRKVKLSLL"
FT   assembly_gap    8681932..8681951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8682197..8700834)
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /note="gene_id=mCG1057.2"
FT   mRNA            complement(join(8682197..8682766,8684441..8684560,
FT                   8686443..8686556,8692884..8692988,8697067..8697162,
FT                   8697803..8697871,8699822..8700056,8700536..8700834))
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, transcript variant
FT                   mCT178249"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT178249.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(8682197..8682766,8684441..8684560,
FT                   8686443..8686556,8692884..8692988,8697061..8697162,
FT                   8697803..8697871,8699822..8700056,8700536..8700834))
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, transcript variant
FT                   mCT8704"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT8704.2 created on
FT                   03-JAN-2003"
FT   CDS             complement(join(8682683..8682766,8684441..8684560,
FT                   8686443..8686556,8692884..8692988,8697067..8697162,
FT                   8697803..8697871,8699822..8700056,8700536..8700561))
FT                   /codon_start=1
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, isoform CRA_a"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT178249.0
FT                   protein_id=mCP101171.0 isoform=CRA_a"
FT                   /protein_id="EDL05621.1"
FT                   /translation="MLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLR
FT                   DKADLLVNEINLYASTETPNLKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGT
FT                   IVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHAETELQRATIDATRTSRHLEE
FT                   TIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSLY
FT                   LSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRTRKDQQVEDEDDEELDVTEDE
FT                   N"
FT   CDS             complement(join(8682683..8682766,8684441..8684560,
FT                   8686443..8686556,8692884..8692988,8697061..8697162,
FT                   8697803..8697871,8699822..8700056,8700536..8700561))
FT                   /codon_start=1
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, isoform CRA_c"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT8704.2
FT                   protein_id=mCP18267.2 isoform=CRA_c"
FT                   /protein_id="EDL05623.1"
FT                   /translation="MLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLR
FT                   DKADLLVNEINLYASTETPNLKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGT
FT                   IVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVIAETELQRATIDATRTSRHL
FT                   EETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNS
FT                   LYLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRTRKDQQVEDEDDEELDVTE
FT                   DEN"
FT   mRNA            complement(join(<8684503..8684560,8686443..8686556,
FT                   8692884..8692988,8697067..8697162,8697803..8697871,
FT                   8698796..8698816,8699822..>8700006))
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, transcript variant
FT                   mCT189837"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT189837.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<8684503..8684560,8686443..8686556,
FT                   8692884..8692988,8697067..8697162,8697803..8697871,
FT                   8698796..8698816,8699822..>8700004))
FT                   /codon_start=1
FT                   /gene="6720467C03Rik"
FT                   /locus_tag="mCG_1057"
FT                   /product="RIKEN cDNA 6720467C03, isoform CRA_b"
FT                   /note="gene_id=mCG1057.2 transcript_id=mCT189837.0
FT                   protein_id=mCP110810.0 isoform=CRA_b"
FT                   /protein_id="EDL05622.1"
FT                   /translation="FGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPNLKQGLK
FT                   DFADEFAKLQDYRQAEMLMNMAKVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNRE
FT                   AKQLSQLERTRQRNPSDRHAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSE
FT                   FITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSLYLSDYPSRLDIVR"
FT   assembly_gap    8694318..8694337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8705674..8705693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8717279..8717298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8741184..8746701
FT                   /estimated_length=5518
FT                   /gap_type="unknown"
FT   assembly_gap    8750872..8750891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8760746..8762353
FT                   /locus_tag="mCG_50656"
FT                   /note="gene_id=mCG50656.1"
FT   mRNA            join(8760746..8761555,8761796..8762353)
FT                   /locus_tag="mCG_50656"
FT                   /product="mCG50656"
FT                   /note="gene_id=mCG50656.1 transcript_id=mCT50839.1 created
FT                   on 12-FEB-2003"
FT   CDS             join(8760784..8761555,8761796..8761839)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50656"
FT                   /product="mCG50656"
FT                   /note="gene_id=mCG50656.1 transcript_id=mCT50839.1
FT                   protein_id=mCP38886.1"
FT                   /protein_id="EDL05620.1"
FT                   /translation="MEVKPPPGCPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDDYGGGGNYNDFGKL"
FT   assembly_gap    8761775..8761794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8788679..8788789
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    8792009..8792028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8806245..8806264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8820741..8820819
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    8835873..8836789
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   assembly_gap    8840596..8840615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8850535..8850671
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    8863132..8863448
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    8879209..8880112
FT                   /estimated_length=904
FT                   /gap_type="unknown"
FT   assembly_gap    8882654..8882673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8883694..8889996
FT                   /estimated_length=6303
FT                   /gap_type="unknown"
FT   assembly_gap    8891980..8891999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8893810..8894462
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    8903059..8903078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8904443..8911346
FT                   /estimated_length=6904
FT                   /gap_type="unknown"
FT   assembly_gap    8914380..8914399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8916638..8916657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8920076..8920365
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    8927604..8927623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8930098..8930117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8934124..8934143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8936074..8936093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8941458..8941477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8944186..8949401
FT                   /estimated_length=5216
FT                   /gap_type="unknown"
FT   assembly_gap    8951913..8951932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8953840..8954062
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    8973177..8973685
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    9008446..9008801
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    9047555..9047971
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    9062731..9062750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9063285..9063304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069908..9069927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9112895..9112954
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9124153..9124172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9163731..9165821
FT                   /estimated_length=2091
FT                   /gap_type="unknown"
FT   assembly_gap    9231382..9232257
FT                   /estimated_length=876
FT                   /gap_type="unknown"
FT   assembly_gap    9236431..9236450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9266297..9266519
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    9315564..9315811
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    9329248..9331409
FT                   /estimated_length=2162
FT                   /gap_type="unknown"
FT   assembly_gap    9337481..9337500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9339890..9339909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9341781..9341800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9342951..9342970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9376020..9376556
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    9400344..9400363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9422169..9422188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9434530..9505558
FT                   /gene="C130086A10"
FT                   /locus_tag="mCG_7288"
FT                   /note="gene_id=mCG7288.2"
FT   mRNA            join(9434530..9434610,9445588..9445737,9487054..9487135,
FT                   9498807..9498892,9504479..9505558)
FT                   /gene="C130086A10"
FT                   /locus_tag="mCG_7288"
FT                   /product="hypothetical protein C130086A10, transcript
FT                   variant mCT178993"
FT                   /note="gene_id=mCG7288.2 transcript_id=mCT178993.0 created
FT                   on 21-JAN-2003"
FT   mRNA            join(9434530..9434610,9445588..9445737,9487057..9487135,
FT                   9498807..9498892,9504479..9505558)
FT                   /gene="C130086A10"
FT                   /locus_tag="mCG_7288"
FT                   /product="hypothetical protein C130086A10, transcript
FT                   variant mCT6397"
FT                   /note="gene_id=mCG7288.2 transcript_id=mCT6397.2 created on
FT                   21-JAN-2003"
FT   assembly_gap    9447453..9448024
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    9457449..9457524
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    9458652..9458671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9464250..9466432
FT                   /estimated_length=2183
FT                   /gap_type="unknown"
FT   assembly_gap    9468357..9469827
FT                   /estimated_length=1471
FT                   /gap_type="unknown"
FT   assembly_gap    9471417..9471516
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    9485428..9485721
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   CDS             9504835..9505137
FT                   /codon_start=1
FT                   /gene="C130086A10"
FT                   /locus_tag="mCG_7288"
FT                   /product="hypothetical protein C130086A10, isoform CRA_a"
FT                   /note="gene_id=mCG7288.2 transcript_id=mCT178993.0
FT                   protein_id=mCP101915.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:3650048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C830"
FT                   /protein_id="EDL05618.1"
FT                   /translation="MVQLNKMVMYFFPDCVPVYIYDSISYKSLNLLYPTYIVIKYVLPF
FT                   AEAYSKSYSESKKEQKAIGNCYLKGSVLSFQTYFMSLGRLSAHTGTVIFFFLANC"
FT   CDS             9504835..9505137
FT                   /codon_start=1
FT                   /gene="C130086A10"
FT                   /locus_tag="mCG_7288"
FT                   /product="hypothetical protein C130086A10, isoform CRA_a"
FT                   /note="gene_id=mCG7288.2 transcript_id=mCT6397.2
FT                   protein_id=mCP12278.2 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:3650048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C830"
FT                   /protein_id="EDL05619.1"
FT                   /translation="MVQLNKMVMYFFPDCVPVYIYDSISYKSLNLLYPTYIVIKYVLPF
FT                   AEAYSKSYSESKKEQKAIGNCYLKGSVLSFQTYFMSLGRLSAHTGTVIFFFLANC"
FT   assembly_gap    9509048..9509067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9521520..9521539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9526750..9543538
FT                   /estimated_length=16789
FT                   /gap_type="unknown"
FT   assembly_gap    9569481..9569911
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    9620687..9620748
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    9636084..9636103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9659598..9659617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9680957..9680976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9693413..9693432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9701922..9701941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9737116..9737260
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    9751433..9751707
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    9764946..9764965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9782051..9782338
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    9783448..9783496
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    9828506..9828590
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    9849411..9849558
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9887994..9889644
FT                   /estimated_length=1651
FT                   /gap_type="unknown"
FT   assembly_gap    9892953..9893189
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    9927444..9927478
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    9932074..9932093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9937392..9937458
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            complement(9995012..>9995535)
FT                   /locus_tag="mCG_7286"
FT                   /note="gene_id=mCG7286.1"
FT   mRNA            complement(9995012..>9995535)
FT                   /locus_tag="mCG_7286"
FT                   /product="mCG7286"
FT                   /note="gene_id=mCG7286.1 transcript_id=mCT6395.1 created on
FT                   30-JAN-2003"
FT   CDS             complement(9995052..>9995303)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7286"
FT                   /product="mCG7286"
FT                   /note="gene_id=mCG7286.1 transcript_id=mCT6395.1
FT                   protein_id=mCP12265.2"
FT                   /protein_id="EDL05617.1"
FT                   /translation="KGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT
FT                   RLKLDKDRKKILERKAKSRQVGKEKGKNKKETIEKMQE"
FT   assembly_gap    10000407..10000426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10076696..10076810
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    10102947..10103568
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    10135784..10135803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10169984..10170003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10177398..10177905
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    10233124..10233161
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    10240041..10240074
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    10242595..10242614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10264082..10264568
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    10276360..10276379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10284878..10404449
FT                   /gene="Runx1t1"
FT                   /locus_tag="mCG_7287"
FT                   /note="gene_id=mCG7287.2"
FT   mRNA            join(10284878..10284944,10349029..10349166,
FT                   10351156..10351397,10355178..10355267,10360158..10360339,
FT                   10373180..10373430,10378573..10378658,10379203..10379404,
FT                   10388812..10388880,10394385..10394575,10402944..10403493)
FT                   /gene="Runx1t1"
FT                   /locus_tag="mCG_7287"
FT                   /product="runt-related transcription factor 1; translocated
FT                   to, 1 (cyclin D-related), transcript variant mCT171414"
FT                   /note="gene_id=mCG7287.2 transcript_id=mCT171414.0 created
FT                   on 02-AUG-2002"
FT   mRNA            join(10298191..10298550,10349029..10349166,
FT                   10351156..10351397,10355178..10355267,10360158..10360339,
FT                   10373180..10373430,10378573..10378658,10379203..10379404,
FT                   10388812..10388880,10394385..10394575,10402944..10404449)
FT                   /gene="Runx1t1"
FT                   /locus_tag="mCG_7287"
FT                   /product="runt-related transcription factor 1; translocated
FT                   to, 1 (cyclin D-related), transcript variant mCT6396"
FT                   /note="gene_id=mCG7287.2 transcript_id=mCT6396.1 created on
FT                   02-AUG-2002"
FT   CDS             join(10298544..10298550,10349029..10349166,
FT                   10351156..10351397,10355178..10355267,10360158..10360339,
FT                   10373180..10373430,10378573..10378658,10379203..10379404,
FT                   10388812..10388880,10394385..10394575,10402944..10403219)
FT                   /codon_start=1
FT                   /gene="Runx1t1"
FT                   /locus_tag="mCG_7287"
FT                   /product="runt-related transcription factor 1; translocated
FT                   to, 1 (cyclin D-related), isoform CRA_b"
FT                   /note="gene_id=mCG7287.2 transcript_id=mCT6396.1
FT                   protein_id=mCP12266.1 isoform=CRA_b"
FT                   /db_xref="GOA:B1AXH9"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR003894"
FT                   /db_xref="InterPro:IPR013289"
FT                   /db_xref="InterPro:IPR013290"
FT                   /db_xref="InterPro:IPR014896"
FT                   /db_xref="MGI:MGI:104793"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXH9"
FT                   /protein_id="EDL05616.1"
FT                   /translation="MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFT
FT                   PTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLT
FT                   TLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLP
FT                   LLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTK
FT                   ENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIA
FT                   HHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDM
FT                   VEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNPDPVAL
FT                   DAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAK
FT                   MERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDW
FT                   EKHHHICGQTLQAPQQGDTPAVSSSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTP
FT                   R"
FT   assembly_gap    10300254..10300310
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    10302523..10302542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10349052..10349166,10351156..10351397,
FT                   10355178..10355267,10360158..10360339,10373180..10373430,
FT                   10378573..10378658,10379203..10379404,10388812..10388880,
FT                   10394385..10394575,10402944..10403219)
FT                   /codon_start=1
FT                   /gene="Runx1t1"
FT                   /locus_tag="mCG_7287"
FT                   /product="runt-related transcription factor 1; translocated
FT                   to, 1 (cyclin D-related), isoform CRA_a"
FT                   /note="gene_id=mCG7287.2 transcript_id=mCT171414.0
FT                   protein_id=mCP94333.0 isoform=CRA_a"
FT                   /protein_id="EDL05615.1"
FT                   /translation="MPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSH
FT                   SPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDIS
FT                   PEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCA
FT                   RLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLH
FT                   SEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHP
FT                   SHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTV
FT                   LRRCQEADREELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNPDPVALDAHREFLHRP
FT                   ASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKR
FT                   QAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQT
FT                   LQAPQQGDTPAVSSSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR"
FT   gene            complement(10433317..>10509603)
FT                   /locus_tag="mCG_145030"
FT                   /note="gene_id=mCG145030.0"
FT   mRNA            complement(join(10433317..10435063,10481548..10481688,
FT                   10509213..>10509603))
FT                   /locus_tag="mCG_145030"
FT                   /product="mCG145030"
FT                   /note="gene_id=mCG145030.0 transcript_id=mCT184454.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10434648..>10434947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145030"
FT                   /product="mCG145030"
FT                   /note="gene_id=mCG145030.0 transcript_id=mCT184454.0
FT                   protein_id=mCP105702.0"
FT                   /protein_id="EDL05614.1"
FT                   /translation="NQQELMVVISVGEDINLMLLLCNIPSNQQIMPKRKNLVLNHHFIA
FT                   SIDTMYVKENEYRVVLLRILNMSRRRSLNRPAYHLCICVKLTMSTWFVLPEGSK"
FT   assembly_gap    10440402..10440456
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    10445122..10457331
FT                   /estimated_length=12210
FT                   /gap_type="unknown"
FT   assembly_gap    10466691..10466742
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    10478840..10478859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10484037..10485351
FT                   /estimated_length=1315
FT                   /gap_type="unknown"
FT   assembly_gap    10519175..10519194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10574731..10574750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10576584..10576603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10577572..10577721
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    10579226..10584105
FT                   /estimated_length=4880
FT                   /gap_type="unknown"
FT   assembly_gap    10585151..10585170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10595945..10595964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10626719..10626738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10642490..10642509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10657612..10657631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10659931..10659950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10677510..10678488
FT                   /pseudo
FT                   /locus_tag="mCG_2664"
FT                   /note="gene_id=mCG2664.1"
FT   mRNA            10677510..10678488
FT                   /pseudo
FT                   /locus_tag="mCG_2664"
FT                   /note="gene_id=mCG2664.1 transcript_id=mCT1909.1 created on
FT                   30-JAN-2003"
FT   assembly_gap    10684551..10684570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10705796..10705815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10727538..>10745480)
FT                   /locus_tag="mCG_1043245"
FT                   /note="gene_id=mCG1043245.0"
FT   mRNA            complement(join(10727538..10727820,10745273..>10745480))
FT                   /locus_tag="mCG_1043245"
FT                   /product="mCG1043245"
FT                   /note="gene_id=mCG1043245.0 transcript_id=mCT160949.0
FT                   created on 09-JAN-2003"
FT   CDS             complement(join(10727587..10727820,10745273..>10745290))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043245"
FT                   /product="mCG1043245"
FT                   /note="gene_id=mCG1043245.0 transcript_id=mCT160949.0
FT                   protein_id=mCP67729.0"
FT                   /protein_id="EDL05613.1"
FT                   /translation="WTVQHKNHKQVTNVRKEKREEGKKEKREGKRRLKERNLFRVLEFY
FT                   SNFIDFLLSFVFKNYFNFYARTSASQDEMCIRFLNFLF"
FT   assembly_gap    10729871..10729890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10748546..10748565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10756646..10757032
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    10760545..10760730
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    10761997..10763543
FT                   /estimated_length=1547
FT                   /gap_type="unknown"
FT   assembly_gap    10768266..10768285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10770726..10770745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10815852..10816638
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    10822984..10828140
FT                   /estimated_length=5157
FT                   /gap_type="unknown"
FT   assembly_gap    10858836..10860720
FT                   /estimated_length=1885
FT                   /gap_type="unknown"
FT   assembly_gap    10866656..10866675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10870216..10870235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10871700..10871719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10874720..10875806
FT                   /estimated_length=1087
FT                   /gap_type="unknown"
FT   assembly_gap    10877175..10877194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10880023..10880042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10881040..10881059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10883412..10883431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10884629..10884648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10885778..10885797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10890399..10890674
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    10905416..10905534
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    10944171..10948084
FT                   /estimated_length=3914
FT                   /gap_type="unknown"
FT   gene            10951887..10952531
FT                   /locus_tag="mCG_48799"
FT                   /note="gene_id=mCG48799.1"
FT   mRNA            10951887..10952531
FT                   /locus_tag="mCG_48799"
FT                   /product="mCG48799"
FT                   /note="gene_id=mCG48799.1 transcript_id=mCT48982.1 created
FT                   on 12-FEB-2003"
FT   CDS             10951934..10952380
FT                   /codon_start=1
FT                   /locus_tag="mCG_48799"
FT                   /product="mCG48799"
FT                   /note="gene_id=mCG48799.1 transcript_id=mCT48982.1
FT                   protein_id=mCP33931.0"
FT                   /protein_id="EDL05612.1"
FT                   /translation="MCDFTEDPTTEFKEAFQLFDRTGDGKILYSQCGDVMWALGQNPTN
FT                   AEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYDDYVECLRVFDKEGNGTV
FT                   MGAEIRHVLVTPGEKMTEEEVEMLVAGHEDSNGCINYEEMVLNS"
FT   assembly_gap    10952854..10952873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10969034..10969053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11017243..11018721
FT                   /estimated_length=1479
FT                   /gap_type="unknown"
FT   assembly_gap    11020425..11020444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11024299..11141684)
FT                   /gene="Slc26a7"
FT                   /locus_tag="mCG_2663"
FT                   /note="gene_id=mCG2663.2"
FT   mRNA            complement(join(11024299..11024604,11025515..11025618,
FT                   11025705..11025759,11029309..11029409,11035315..11035363,
FT                   11038551..11038688,11041989..11042055,11043620..11043726,
FT                   11051716..11051811,11052761..11052838,11063251..11063364,
FT                   11065391..11065538,11067499..11067581,11071450..11071602,
FT                   11084531..11084695,11110150..11110322,11113647..11113757,
FT                   11141119..11141351,11141616..11141684))
FT                   /gene="Slc26a7"
FT                   /locus_tag="mCG_2663"
FT                   /product="solute carrier family 26, member 7"
FT                   /note="gene_id=mCG2663.2 transcript_id=mCT1915.2 created on
FT                   07-DEC-2002"
FT   CDS             complement(join(11024569..11024604,11025515..11025618,
FT                   11025705..11025759,11029309..11029409,11035315..11035363,
FT                   11038551..11038688,11041989..11042055,11043620..11043726,
FT                   11051716..11051811,11052761..11052838,11063251..11063364,
FT                   11065391..11065538,11067499..11067581,11071450..11071602,
FT                   11084531..11084695,11110150..11110322,11113647..11113757,
FT                   11141119..11141311))
FT                   /codon_start=1
FT                   /gene="Slc26a7"
FT                   /locus_tag="mCG_2663"
FT                   /product="solute carrier family 26, member 7"
FT                   /note="gene_id=mCG2663.2 transcript_id=mCT1915.2
FT                   protein_id=mCP12284.2"
FT                   /db_xref="GOA:Q8R2Z3"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR030329"
FT                   /db_xref="MGI:MGI:2384791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2Z3"
FT                   /protein_id="EDL05611.1"
FT                   /translation="MTGAKRKKRSVLWGKMHTPHREDIKQWCKRRLPILEWAPQYNLKE
FT                   NLLPDTVSGIMLAVQQVAQGLSFAMLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTF
FT                   ALTSLISANAVERLVPQSSRNLTTQSNSSVLGLSEFELQRIGVAAAVSFLGGVIQLVMF
FT                   VLQLGSATFLLTEPVISAMTTGAATHVVTSQVKYLLGIKMPYISGPLGFFYIYAYVFEN
FT                   IKSVQLEALLFSLLSIIVLVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENT
FT                   YGLEVVGHIPNGIPPPRAPPMNILSAVLTEAFGVALVGYVASLALAQGSAKKFKYSVDD
FT                   NQEFLAHGLSNVIPSFLFCIPSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGP
FT                   LLYWLPMCVLASIIVVGLKGMLIQFRDLKKYWNVDKIDWGIWISTYIFTICFAANVGLL
FT                   FGVICTIAIVLGRFPRAKTLSITDMKEMELKVKTEMHDETSQQIKIISINNPLVFLNAK
FT                   KFSADLMKIILKESDSNQPLDDVSKCEQNTLLSSLSNGNCNEEASQPCSSEKCSLVLNC
FT                   SGLTFFDYTGVSTLVELYLDCKSRSVDVFLANCTASLIKAMTYYGDLDTEKPIFFDSVP
FT                   AAISIIQSNKNLSKASDHSEV"
FT   assembly_gap    11027712..11027760
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    11062903..11062922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11091165..11091562
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    11102300..11103634
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   assembly_gap    11117780..11117799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11130559..11130648
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    11133736..11133755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11143547..11307165)
FT                   /locus_tag="mCG_2666"
FT                   /note="gene_id=mCG2666.2"
FT   mRNA            complement(join(11143547..11143724,11177766..11177881,
FT                   11215186..11215365,11219890..11219991,11267784..11267855,
FT                   11280618..11280813,11284726..11284798,11286011..11286137,
FT                   11306966..11307165))
FT                   /locus_tag="mCG_2666"
FT                   /product="mCG2666, transcript variant mCT178422"
FT                   /note="gene_id=mCG2666.2 transcript_id=mCT178422.0 created
FT                   on 09-JAN-2003"
FT   assembly_gap    11146661..11146680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11148368..11148666
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    11153985..11154004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11155336..11155355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11171600..11171798
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    11174479..11174769
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11177612..11177881,11215186..11215365,
FT                   11219890..11219991,11267784..11267855,11280618..11280813,
FT                   11284726..11284798,11286011..11286137,11306966..11307165))
FT                   /locus_tag="mCG_2666"
FT                   /product="mCG2666, transcript variant mCT1911"
FT                   /note="gene_id=mCG2666.2 transcript_id=mCT1911.2 created on
FT                   09-JAN-2003"
FT   CDS             complement(join(11177771..11177881,11215186..11215365,
FT                   11219890..11219991,11267784..11267855,11280618..11280813,
FT                   11284726..11284798,11286011..11286137,11306966..11307148))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2666"
FT                   /product="mCG2666, isoform CRA_a"
FT                   /note="gene_id=mCG2666.2 transcript_id=mCT178422.0
FT                   protein_id=mCP101344.0 isoform=CRA_a"
FT                   /protein_id="EDL05609.1"
FT                   /translation="MAERLLVTALKGGKNTKILTLNGKRITKMPSTLEKLPNLKTLDLQ
FT                   NNSISKVCPELRTLTQLTLLNLGNNHLQEVPEEIKYLTSLKNLHLFGNRICRIAPGVFN
FT                   GLHRLIMLNLNDNRLTSLPQEIGRLRSLTYLSLNRNNLTVIPKELCSLEHLSELHLNYN
FT                   QIVYIPEEIKFLKNLQQLFLVRNNIEELPEEICHLEKLRVLDIAGNVIQIFPAGFQNLR
FT                   LTEFYCEGNPLFLKRPFFAVQPKDLWTLREIAARFVLSLLEENDPLIMNVIESYPEVKD
FT                   KLSKAKKCSICRKPFLTEWLECVYFVAPSKNWKISRNLKLIPVQTSVCSYQCFDQRDPD
FT                   VFGIAQE"
FT   CDS             complement(join(11177771..11177881,11215186..11215365,
FT                   11219890..11219991,11267784..11267855,11280618..11280813,
FT                   11284726..11284798,11286011..11286137,11306966..11307148))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2666"
FT                   /product="mCG2666, isoform CRA_a"
FT                   /note="gene_id=mCG2666.2 transcript_id=mCT1911.2
FT                   protein_id=mCP12274.1 isoform=CRA_a"
FT                   /protein_id="EDL05610.1"
FT                   /translation="MAERLLVTALKGGKNTKILTLNGKRITKMPSTLEKLPNLKTLDLQ
FT                   NNSISKVCPELRTLTQLTLLNLGNNHLQEVPEEIKYLTSLKNLHLFGNRICRIAPGVFN
FT                   GLHRLIMLNLNDNRLTSLPQEIGRLRSLTYLSLNRNNLTVIPKELCSLEHLSELHLNYN
FT                   QIVYIPEEIKFLKNLQQLFLVRNNIEELPEEICHLEKLRVLDIAGNVIQIFPAGFQNLR
FT                   LTEFYCEGNPLFLKRPFFAVQPKDLWTLREIAARFVLSLLEENDPLIMNVIESYPEVKD
FT                   KLSKAKKCSICRKPFLTEWLECVYFVAPSKNWKISRNLKLIPVQTSVCSYQCFDQRDPD
FT                   VFGIAQE"
FT   assembly_gap    11186800..11191396
FT                   /estimated_length=4597
FT                   /gap_type="unknown"
FT   assembly_gap    11240427..11240605
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    11240951..11241316
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    11271370..11274817
FT                   /estimated_length=3448
FT                   /gap_type="unknown"
FT   assembly_gap    11275978..11275997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11294530..11294628
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    11301395..11301414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11312368..11312515
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   gene            complement(11320557..11345420)
FT                   /locus_tag="mCG_2665"
FT                   /note="gene_id=mCG2665.2"
FT   mRNA            complement(join(11320557..11322794,11323499..11323605,
FT                   11328940..11329001,11331008..11331320,11336283..11336363,
FT                   11344333..11344487,11345125..11345420))
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, transcript variant mCT179266"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT179266.0 created
FT                   on 30-JAN-2003"
FT   mRNA            complement(join(11320557..11322794,11323499..11323605,
FT                   11328940..11329001,11331502..11331814,11336283..11336363,
FT                   11344333..11344487,11345125..11345420))
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, transcript variant mCT179265"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT179265.0 created
FT                   on 30-JAN-2003"
FT   mRNA            complement(join(11320557..11322794,11323499..11323605,
FT                   11328940..11329001,11331502..11331814,11332421..11332535,
FT                   11336283..11336363,11341486..11341566,11344333..11344487,
FT                   11345125..11345420))
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, transcript variant mCT1910"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT1910.2 created on
FT                   30-JAN-2003"
FT   CDS             complement(join(11322710..11322794,11323499..11323605,
FT                   11328940..11329001,11331008..11331320,11336283..11336363,
FT                   11344333..11344487,11345125..11345206))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, isoform CRA_c"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT179266.0
FT                   protein_id=mCP102188.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8K2H2"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="MGI:MGI:1919451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K2H2"
FT                   /protein_id="EDL05608.1"
FT                   /translation="MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRR
FT                   KQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQK
FT                   RREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGA
FT                   LEDQLREQDCALTVASLRRQTAEYMQSHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVN
FT                   TAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNS
FT                   VTRLVNSATENCS"
FT   CDS             complement(join(11322710..11322794,11323499..11323605,
FT                   11328940..11329001,11331502..11331814,11336283..11336363,
FT                   11344333..11344487,11345125..11345206))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, isoform CRA_a"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT179265.0
FT                   protein_id=mCP102187.0 isoform=CRA_a"
FT                   /protein_id="EDL05606.1"
FT                   /translation="MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRR
FT                   KQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQK
FT                   RREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGA
FT                   LEDQLREQDCALTVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVN
FT                   TAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNS
FT                   VTRLVNSATENCS"
FT   assembly_gap    11326325..11326722
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    11328103..11328122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11329166..11329185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11331414..11331433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(11332521..11332535,11336283..11336363,
FT                   11341486..11341566,11344333..11344487,11345125..11345206))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2665"
FT                   /product="mCG2665, isoform CRA_b"
FT                   /note="gene_id=mCG2665.2 transcript_id=mCT1910.2
FT                   protein_id=mCP12260.2 isoform=CRA_b"
FT                   /protein_id="EDL05607.1"
FT                   /translation="MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRR
FT                   KQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQK
FT                   RRIDSVAVNISNLVLENQPPRISKAQKRRDLIL"
FT   assembly_gap    11333782..11333801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11334986..11335005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11338827..11338846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11339998..11340017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11342691..11342710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11364093..11364112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11370937..11370956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11385412..11385431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11385466..11436379
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /note="gene_id=mCG2667.2"
FT   mRNA            join(11385466..11385829,11391112..11391185,
FT                   11407919..11408067,11414883..11415006,11423847..11423899,
FT                   11433304..11433394,11434596..11436379)
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, transcript variant
FT                   mCT176651"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT176651.0 created
FT                   on 07-DEC-2002"
FT   mRNA            join(11385466..11385829,11407919..11408067,
FT                   11413775..11413881,11414883..11415006,11423847..11423899,
FT                   11433304..11433394,11434596..11436379)
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, transcript variant
FT                   mCT1912"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT1912.2 created on
FT                   07-DEC-2002"
FT   mRNA            join(11385466..11385829,11407919..11408067,
FT                   11413844..11413881,11414883..11415006,11423847..11423899,
FT                   11433304..11433394,11434596..11436379)
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, transcript variant
FT                   mCT176652"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT176652.0 created
FT                   on 07-DEC-2002"
FT   CDS             join(11385724..11385829,11407919..11408067,
FT                   11413775..11413881,11414883..11415006,11423847..11423899,
FT                   11433304..11433394,11434596..11434739)
FT                   /codon_start=1
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, isoform CRA_b"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT1912.2
FT                   protein_id=mCP12263.2 isoform=CRA_b"
FT                   /protein_id="EDL05604.1"
FT                   /translation="MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAI
FT                   ASPGTSGIPVINCRVCQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCL
FT                   LICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLW
FT                   MELRFNTLAKCPHCKKISSVGSALPRRRCCAYVTIGMICIFIAVGLTVGTQDFSRRFHA
FT                   TYVSWAIAYLLGLICLIRACYWGAIRVSYPEHGFA"
FT   CDS             join(11385724..11385829,11407919..11408067,
FT                   11413844..11413881,11414883..11415006,11423847..11423899,
FT                   11433304..11433394,11434596..11434739)
FT                   /codon_start=1
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, isoform CRA_c"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT176652.0
FT                   protein_id=mCP99574.0 isoform=CRA_c"
FT                   /protein_id="EDL05605.1"
FT                   /translation="MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAI
FT                   ASPGTSGIPVINCRVCQSLINLDGKLHQHVVKCTVCNEATDTSRRIGCPRPNCRRIINL
FT                   GPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA
FT                   LPRRRCCAYVTIGMICIFIAVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIRACYWG
FT                   AIRVSYPEHGFA"
FT   CDS             join(11408015..11408067,11414883..11415006,
FT                   11423847..11423899,11433304..11433394,11434596..11434739)
FT                   /codon_start=1
FT                   /gene="Tmem55a"
FT                   /locus_tag="mCG_2667"
FT                   /product="transmembrane protein 55A, isoform CRA_a"
FT                   /note="gene_id=mCG2667.2 transcript_id=mCT176651.0
FT                   protein_id=mCP99573.0 isoform=CRA_a"
FT                   /protein_id="EDL05603.1"
FT                   /translation="MVNFTSMWLSAQFAMKLRRRIINLGPVMLISEEQPAQPALPIQPE
FT                   GTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYVTIGMICIFIAV
FT                   GLTVGTQDFSRRFHATYVSWAIAYLLGLICLIRACYWGAIRVSYPEHGFA"
FT   assembly_gap    11427068..11427822
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    11451337..11451866
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   gene            11457412..11474007
FT                   /locus_tag="mCG_122198"
FT                   /note="gene_id=mCG122198.1"
FT   mRNA            join(11457412..11457516,11459461..11459534,
FT                   11463169..11463244,11468408..11468514,11473598..11474007)
FT                   /locus_tag="mCG_122198"
FT                   /product="mCG122198"
FT                   /note="gene_id=mCG122198.1 transcript_id=mCT123413.1
FT                   created on 09-JAN-2003"
FT   CDS             join(11457438..11457516,11459461..11459534,
FT                   11463169..11463244,11468408..11468514,11473598..11473621)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122198"
FT                   /product="mCG122198"
FT                   /note="gene_id=mCG122198.1 transcript_id=mCT123413.1
FT                   protein_id=mCP67856.1"
FT                   /protein_id="EDL05602.1"
FT                   /translation="MTMETKKLIGKPLQPARPVRHLSSPPGPVFPFNFQNEYPCSTQCL
FT                   QSGVGRCKTNGMQAFSQGLNEQQQHQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPD
FT                   HPIVLQKPENNQSFK"
FT   gene            complement(11473253..11672356)
FT                   /gene="Efcbp1"
FT                   /locus_tag="mCG_122193"
FT                   /note="gene_id=mCG122193.1"
FT   mRNA            complement(join(11473253..11476899,11478804..11478895,
FT                   11480986..11481063,11486883..11486995,11496110..11496163,
FT                   11499133..11499209,11510148..11510269,11526010..11526146,
FT                   11573531..11573628,11586235..11586260,11633785..11633893,
FT                   11662789..11662813,11671380..11671507,11672274..11672356))
FT                   /gene="Efcbp1"
FT                   /locus_tag="mCG_122193"
FT                   /product="EF hand calcium binding protein 1, transcript
FT                   variant mCT178967"
FT                   /note="gene_id=mCG122193.1 transcript_id=mCT178967.0
FT                   created on 21-JAN-2003"
FT   mRNA            complement(join(11473253..11476899,11478804..11478895,
FT                   11480986..11481063,11486883..11486995,11496110..11496163,
FT                   11499133..11499209,11510148..11510269,11526010..11526146,
FT                   11573531..11573628,11586235..11586260,11633785..11633893,
FT                   11662789..11662813,11671380..11671622))
FT                   /gene="Efcbp1"
FT                   /locus_tag="mCG_122193"
FT                   /product="EF hand calcium binding protein 1, transcript
FT                   variant mCT123410"
FT                   /note="gene_id=mCG122193.1 transcript_id=mCT123410.1
FT                   created on 21-JAN-2003"
FT   CDS             complement(join(11476871..11476899,11478804..11478895,
FT                   11480986..11481063,11486883..11486995,11496110..11496163,
FT                   11499133..11499209,11510148..11510269,11526010..11526146,
FT                   11573531..11573628,11586235..11586260,11633785..11633893,
FT                   11662789..11662813,11671380..11671478))
FT                   /codon_start=1
FT                   /gene="Efcbp1"
FT                   /locus_tag="mCG_122193"
FT                   /product="EF hand calcium binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG122193.1 transcript_id=mCT123410.1
FT                   protein_id=mCP67820.1 isoform=CRA_a"
FT                   /protein_id="EDL05600.1"
FT                   /translation="MEDSRETSPSSNNSSEELSSTLQLSKGMSIFLDILRRADKNDDGK
FT                   LSFEEFKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALE
FT                   DLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQ
FT                   ERQGPSKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSSPALLEEDNQWMTQINRLQ
FT                   KLIDRLEKKDLKLEPLEEEIIEENTKPHIMLVQRQMSVTEEDLEEFQLALKHYVESASA
FT                   QSGCLRISIQKLSNESRYMIYEFWENSSVWNRHLQTNYSKTFQRSNVDFLETPELTSTM
FT                   LVPASWWILNNN"
FT   CDS             complement(join(11476871..11476899,11478804..11478895,
FT                   11480986..11481063,11486883..11486995,11496110..11496163,
FT                   11499133..11499209,11510148..11510269,11526010..11526146,
FT                   11573531..11573628,11586235..11586260,11633785..11633893,
FT                   11662789..11662813,11671380..11671478))
FT                   /codon_start=1
FT                   /gene="Efcbp1"
FT                   /locus_tag="mCG_122193"
FT                   /product="EF hand calcium binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG122193.1 transcript_id=mCT178967.0
FT                   protein_id=mCP101889.0 isoform=CRA_a"
FT                   /protein_id="EDL05601.1"
FT                   /translation="MEDSRETSPSSNNSSEELSSTLQLSKGMSIFLDILRRADKNDDGK
FT                   LSFEEFKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALE
FT                   DLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQ
FT                   ERQGPSKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSSPALLEEDNQWMTQINRLQ
FT                   KLIDRLEKKDLKLEPLEEEIIEENTKPHIMLVQRQMSVTEEDLEEFQLALKHYVESASA
FT                   QSGCLRISIQKLSNESRYMIYEFWENSSVWNRHLQTNYSKTFQRSNVDFLETPELTSTM
FT                   LVPASWWILNNN"
FT   assembly_gap    11514467..11514624
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    11539827..11539846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11548747..11548934
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    11568333..11568415
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    11577389..11577408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11599836..11599917
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    11614498..11614517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11615529..11615548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11640101..11640158
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    11646599..11646748
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    11650645..11650908
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    11672800..11672819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11674262..11674281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11698603..11698662
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    11720072..11720298
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    11724612..11724631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11758837..11758856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11770459..11770478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11776893..11777098
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   gene            <11781550..11822512
FT                   /gene="Tmem64"
FT                   /locus_tag="mCG_2670"
FT                   /note="gene_id=mCG2670.2"
FT   mRNA            join(<11781550..11781757,11781872..11782504,
FT                   11796762..11796917,11798914..11799085,11822196..11822512)
FT                   /gene="Tmem64"
FT                   /locus_tag="mCG_2670"
FT                   /product="transmembrane protein 64, transcript variant
FT                   mCT178979"
FT                   /note="gene_id=mCG2670.2 transcript_id=mCT178979.0 created
FT                   on 21-JAN-2003"
FT   mRNA            join(<11781550..11781757,11781872..11782504,
FT                   11796762..11796917,11798914..11802479)
FT                   /gene="Tmem64"
FT                   /locus_tag="mCG_2670"
FT                   /product="transmembrane protein 64, transcript variant
FT                   mCT1857"
FT                   /note="gene_id=mCG2670.2 transcript_id=mCT1857.2 created on
FT                   21-JAN-2003"
FT   assembly_gap    11781758..11781871
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   CDS             join(<11781872..11782504,11796762..11796917,
FT                   11798914..11799085,11822196..11822302)
FT                   /codon_start=1
FT                   /gene="Tmem64"
FT                   /locus_tag="mCG_2670"
FT                   /product="transmembrane protein 64, isoform CRA_a"
FT                   /note="gene_id=mCG2670.2 transcript_id=mCT178979.0
FT                   protein_id=mCP101901.0 isoform=CRA_a"
FT                   /protein_id="EDL05598.1"
FT                   /translation="AAAAAAAASGALLGAYLERHGLPAASDLPAPAGALAGGPGSGGGV
FT                   VVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLL
FT                   GVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLL
FT                   TAWVAARIQNSDKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLM
FT                   ASSAGLLPTQLLNSYLGTTLRTMEDVIAEQSLSGYFVFCLQIVISIGLMFYVVHRAQVE
FT                   LNAAIVACEMELKTSLVKGNQSDPSGSSFYNKRTLTFSGGGKRSTDWPTRCSGTHQLPL
FT                   PQSLAAYLLSGSLLP"
FT   CDS             join(<11781872..11782504,11796762..11796917,
FT                   11798914..11799105)
FT                   /codon_start=1
FT                   /gene="Tmem64"
FT                   /locus_tag="mCG_2670"
FT                   /product="transmembrane protein 64, isoform CRA_b"
FT                   /note="gene_id=mCG2670.2 transcript_id=mCT1857.2
FT                   protein_id=mCP12279.2 isoform=CRA_b"
FT                   /protein_id="EDL05599.1"
FT                   /translation="AAAAAAAASGALLGAYLERHGLPAASDLPAPAGALAGGPGSGGGV
FT                   VVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLL
FT                   GVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLL
FT                   TAWVAARIQNSDKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLM
FT                   ASSAGLLPTQLLNSYLGTTLRTMEDVIAEQSLSGYFVFCLQIVISIGLMFYVVHRAQVE
FT                   LNAAIVACEMELKTSLVKGNQSDPSGSSFYNKRTLTFSGGGINIV"
FT   assembly_gap    11813699..11813718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11824052..11824073
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    11881258..11881743
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    11883721..11883740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11892034..11892456
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    11931723..11931742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11947184..11947203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11948588..11948607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11967629..11967712
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    11981167..11982324
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   assembly_gap    11983260..11984463
FT                   /estimated_length=1204
FT                   /gap_type="unknown"
FT   assembly_gap    11985400..11985459
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    11987056..11987252
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    12011152..12011171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12013427..12013446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12014505..12014524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12026054..12026198
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    12038158..12038177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12048817..12050221
FT                   /estimated_length=1405
FT                   /gap_type="unknown"
FT   assembly_gap    12081781..12081800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12095350..12095369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12099498..12099517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12144908..12145104
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    12193081..12193100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12196817..12196836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12198098..12198117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12220409..12220428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12229544..12229563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12239591..12243729
FT                   /estimated_length=4139
FT                   /gap_type="unknown"
FT   assembly_gap    12246090..12246109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12253134..12254143
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    12255632..12255651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12288341..12288360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12311077..12311096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12333526..12333545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12334729..12335268
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   gene            complement(12340954..12343254)
FT                   /pseudo
FT                   /locus_tag="mCG_50279"
FT                   /note="gene_id=mCG50279.2"
FT   mRNA            complement(join(12340954..12341587,12342012..12343254))
FT                   /pseudo
FT                   /locus_tag="mCG_50279"
FT                   /note="gene_id=mCG50279.2 transcript_id=mCT50462.2 created
FT                   on 30-JAN-2003"
FT   assembly_gap    12365995..12366310
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    12377574..12378920
FT                   /estimated_length=1347
FT                   /gap_type="unknown"
FT   assembly_gap    12380003..12381394
FT                   /estimated_length=1392
FT                   /gap_type="unknown"
FT   assembly_gap    12385126..12386829
FT                   /estimated_length=1704
FT                   /gap_type="unknown"
FT   assembly_gap    12393596..12393615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12395011..12395034
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            12403708..12428880
FT                   /gene="Calb1"
FT                   /locus_tag="mCG_2671"
FT                   /note="gene_id=mCG2671.2"
FT   mRNA            join(12403708..12403923,12404404..12404480,
FT                   12408041..12408115,12417895..12417978,12418083..12418139,
FT                   12421332..12421409,12423222..12423277,12423373..12423415,
FT                   12423542..12423595,12427007..12427078,12427407..12428880)
FT                   /gene="Calb1"
FT                   /locus_tag="mCG_2671"
FT                   /product="calbindin-28K, transcript variant mCT178423"
FT                   /note="gene_id=mCG2671.2 transcript_id=mCT178423.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(12403708..12403923,12404404..12404480,
FT                   12408041..12408115,12417895..12417978,12418083..12418139,
FT                   12421332..12421409,12423222..12423277,12423373..12423412,
FT                   12423542..12423595,12427007..12427078,12427407..12428880)
FT                   /gene="Calb1"
FT                   /locus_tag="mCG_2671"
FT                   /product="calbindin-28K, transcript variant mCT1853"
FT                   /note="gene_id=mCG2671.2 transcript_id=mCT1853.1 created on
FT                   06-JAN-2003"
FT   CDS             join(12403845..12403923,12404404..12404480,
FT                   12408041..12408115,12417895..12417978,12418083..12418139,
FT                   12421332..12421409,12423222..12423277,12423373..12423415,
FT                   12423542..12423595,12427007..12427078,12427407..12427520)
FT                   /codon_start=1
FT                   /gene="Calb1"
FT                   /locus_tag="mCG_2671"
FT                   /product="calbindin-28K, isoform CRA_a"
FT                   /note="gene_id=mCG2671.2 transcript_id=mCT178423.0
FT                   protein_id=mCP101345.0 isoform=CRA_a"
FT                   /protein_id="EDL05596.1"
FT                   /translation="MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQ
FT                   ARKKAGLELSPEMKSFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFM
FT                   KTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLE
FT                   LTEMARLLPVQENFLLKFQVGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEK
FT                   NKQELDINNITTYKKNIMALSDGGKLYRTDLALILSAGDN"
FT   CDS             join(12403845..12403923,12404404..12404480,
FT                   12408041..12408115,12417895..12417978,12418083..12418139,
FT                   12421332..12421409,12423222..12423277,12423373..12423412,
FT                   12423542..12423595,12427007..12427078,12427407..12427520)
FT                   /codon_start=1
FT                   /gene="Calb1"
FT                   /locus_tag="mCG_2671"
FT                   /product="calbindin-28K, isoform CRA_b"
FT                   /note="gene_id=mCG2671.2 transcript_id=mCT1853.1
FT                   protein_id=mCP12285.1 isoform=CRA_b"
FT                   /protein_id="EDL05597.1"
FT                   /translation="MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQ
FT                   ARKKAGLELSPEMKSFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFM
FT                   KTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLE
FT                   LTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKN
FT                   KQELDINNITTYKKNIMALSDGGKLYRTDLALILSAGDN"
FT   assembly_gap    12434455..12434474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12439885..12468009)
FT                   /gene="Decr1"
FT                   /locus_tag="mCG_2672"
FT                   /note="gene_id=mCG2672.1"
FT   mRNA            complement(join(12439885..12441738,12441838..12441900,
FT                   12442475..12442622,12445121..12445193,12446890..12446989,
FT                   12452363..12452510,12453550..12453636,12453761..12453818,
FT                   12455529..12455731,12467919..12468009))
FT                   /gene="Decr1"
FT                   /locus_tag="mCG_2672"
FT                   /product="2,4-dienoyl CoA reductase 1, mitochondrial"
FT                   /note="gene_id=mCG2672.1 transcript_id=mCT1854.1 created on
FT                   02-AUG-2002"
FT   CDS             complement(join(12442482..12442622,12445121..12445193,
FT                   12446890..12446989,12452363..12452510,12453550..12453636,
FT                   12453761..12453818,12455529..12455731,12467919..12467987))
FT                   /codon_start=1
FT                   /gene="Decr1"
FT                   /locus_tag="mCG_2672"
FT                   /product="2,4-dienoyl CoA reductase 1, mitochondrial"
FT                   /note="gene_id=mCG2672.1 transcript_id=mCT1854.1
FT                   protein_id=mCP12293.2"
FT                   /protein_id="EDL05595.1"
FT                   /translation="MALLGRAFFAGVSRLPCDPGPQRFFSFGTKTLYQSKDAPQSKFFQ
FT                   PVLKPMLPPDAFQGKVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIDVLKATAEEIS
FT                   SKTGNKVHAIRCDVRDPDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLTPNGWKT
FT                   ITDIVLNGTAYVTLEIGKQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNK
FT                   SLAAEWGRYGMRFNIIQPGPIKTKGAFSRLDPTGRFEKEMIDRIPCGRLGTMEELANLA
FT                   TFLCSDYASLD"
FT   gene            12480604..12515255
FT                   /gene="Nbn"
FT                   /locus_tag="mCG_121785"
FT                   /note="gene_id=mCG121785.0"
FT   mRNA            join(12480604..12480741,12484927..12485060,
FT                   12486389..12486537,12486864..12487023,12487751..12487854,
FT                   12491962..12492079,12493342..12493535,12494387..12494484,
FT                   12498658..12498787,12501808..12502080,12503974..12504415,
FT                   12506621..12506689,12509176..12509331,12511669..12511782,
FT                   12513849..12513898,12515101..12515255)
FT                   /gene="Nbn"
FT                   /locus_tag="mCG_121785"
FT                   /product="nibrin"
FT                   /note="gene_id=mCG121785.0 transcript_id=mCT122997.0
FT                   created on 02-AUG-2002"
FT   CDS             join(12480705..12480741,12484927..12485060,
FT                   12486389..12486537,12486864..12487023,12487751..12487854,
FT                   12491962..12492079,12493342..12493535,12494387..12494484,
FT                   12498658..12498787,12501808..12502080,12503974..12504415,
FT                   12506621..12506689,12509176..12509331,12511669..12511782,
FT                   12513849..12513898,12515101..12515128)
FT                   /codon_start=1
FT                   /gene="Nbn"
FT                   /locus_tag="mCG_121785"
FT                   /product="nibrin"
FT                   /note="gene_id=mCG121785.0 transcript_id=mCT122997.0
FT                   protein_id=mCP67591.1"
FT                   /protein_id="EDL05594.1"
FT                   /translation="MWKLLPAAGAAPGEPYRLLAGVEYVVGRKNCGILIENDQSISRNH
FT                   AVLTVNFPVTSLSQTDEIPTLTIKDNSKYGTFVNEEKMQTGLSCTLKTGDRVTFGVFES
FT                   KFRVEYEPLVVCSSCLDVSGKTVLNQAILQLGGLTANNWTEECTHLVMSAVKVTIKTIC
FT                   ALICGRPIIKPEYFSEFLKAVESKKQPPDIESFYPPIDEPAIGSKSVDLSGRHERKQIF
FT                   KGKTFVFLNAKQHKKLSSAVAFGGGEARLMAEDDEEEQSFFSAPGTCVVDVGITNTQLI
FT                   ISHSQKKWIHLIMDTLQRNGLRPIPEAEIGLAVIFMTTENYCNPQGQPCTELKTTTPGP
FT                   SLSQVLSANGKIIPSAPVNMTTYVADTESEPADTCMPLSERPEEVKIPGLEQSSRKLSQ
FT                   ETFNIKEAPKPSSKANNVASDTLVRGKTPSYQLSPMKFPVANKNKDWTSQQQQNSIKNY
FT                   FQPCTRKRERDEDNPELSSCKSSRMELSCSLLEQTQPAGPSLWKSKEHQSQNATLDREA
FT                   DTSSVGGMDIELNRKSPDRKPLPTETLRPRKRKDVDLATEEEVLEELLRSTKPELAVQV
FT                   KVEKQEADDTIRKKPRMDAERNRPLNGGSEPESNSALQEDEREKKDELQTESWSTKHEI
FT                   ANSDGLQDSSEELPRKLLLTEFRSLVVSNHNSTSRNLCVNECGPLKNFKKFKKATFPGA
FT                   GKLPHIIGGSDLVGHHARKNTELEEWLKQEMEVQKQQAKEESLADDLFRYNPNVKRR"
FT   assembly_gap    12498966..12499137
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            complement(12519794..12536657)
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /note="gene_id=mCG12403.2"
FT   mRNA            complement(join(12519794..12521667,12524701..12524792,
FT                   12528126..12528317,12529126..12529262,12531370..12531524,
FT                   12536456..12536657))
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, transcript variant
FT                   mCT16073"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT16073.2 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(12519794..12521667,12524701..12524792,
FT                   12528126..12528317,12529126..12529262,12531370..12531639))
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, transcript variant
FT                   mCT176646"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT176646.0 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(12519794..12521667,12524701..12524892))
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, transcript variant
FT                   mCT176645"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT176645.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(12520635..12521667,12524701..12524792,
FT                   12528126..12528317,12529126..12529262,12531370..12531524,
FT                   12536456..12536499))
FT                   /codon_start=1
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, isoform CRA_b"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT16073.2
FT                   protein_id=mCP14560.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TEE9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR029728"
FT                   /db_xref="InterPro:IPR029731"
FT                   /db_xref="MGI:MGI:2384798"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TEE9"
FT                   /protein_id="EDL05592.1"
FT                   /translation="MPVWCCRCSLAGHFRNYSDTETEGEIFNSFVQYFGDNLGPKVKGM
FT                   PLVEETSLLEDSSVTLPMVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEA
FT                   RHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYESPSILHWKLEQHHYIPH
FT                   LVLGKGPPGGAWHNMEGSMLTISFGNWMELPGLQFKDWISSKRRNLKGDRVMPEEIARY
FT                   YKHYVKVMGLQKNFRENTYITSVSRLYRDQGDNGSQDRDISTKHLQNQKSKFIKRNWEI
FT                   RGYQRIAGGSHVPFCLFAENVALATGTLDSPAHLEVEGEEFPFVFHSMPEFGAAINKGK
FT                   LCGRVDPVLIVGSGLTAADAVLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHK
FT                   VYHMMCSQSYSADSGPLSDYTSFPEHRVLSFKADMKCILQSVSGLKKIFKLSAAVILIG
FT                   SHPNLSFLKEQGCYLGRNSSQPITCKGNPVEVDAYTYECVKEANLFALGPLVGDNFVRF
FT                   LKGGALGVTRCLATRQKKKQHLFVQRGGGDGVA"
FT   CDS             complement(join(12520635..12521667,12524701..12524792,
FT                   12528126..12528317,12529126..12529262,12531370..12531436))
FT                   /codon_start=1
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, isoform CRA_c"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT176646.0
FT                   protein_id=mCP99567.0 isoform=CRA_c"
FT                   /protein_id="EDL05593.1"
FT                   /translation="MPLVEETSLLEDSSVTLPMVIIGNGPSGICLSYMLSGYRPYLSSE
FT                   AIHPNTILHSKLEEARHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYESP
FT                   SILHWKLEQHHYIPHLVLGKGPPGGAWHNMEGSMLTISFGNWMELPGLQFKDWISSKRR
FT                   NLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQGDNGSQDRDISTKH
FT                   LQNQKSKFIKRNWEIRGYQRIAGGSHVPFCLFAENVALATGTLDSPAHLEVEGEEFPFV
FT                   FHSMPEFGAAINKGKLCGRVDPVLIVGSGLTAADAVLCAYNNNIPVIHVFRRRVTDPSL
FT                   IFKQLPKKLYPEYHKVYHMMCSQSYSADSGPLSDYTSFPEHRVLSFKADMKCILQSVSG
FT                   LKKIFKLSAAVILIGSHPNLSFLKEQGCYLGRNSSQPITCKGNPVEVDAYTYECVKEAN
FT                   LFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLFVQRGGGDGVA"
FT   CDS             complement(join(12520635..12521667,12524701..12524789))
FT                   /codon_start=1
FT                   /gene="BC010311"
FT                   /locus_tag="mCG_12403"
FT                   /product="cDNA sequence BC010311, isoform CRA_a"
FT                   /note="gene_id=mCG12403.2 transcript_id=mCT176645.0
FT                   protein_id=mCP99568.0 isoform=CRA_a"
FT                   /protein_id="EDL05591.1"
FT                   /translation="MEGSMLTISFGNWMELPGLQFKDWISSKRRNLKGDRVMPEEIARY
FT                   YKHYVKVMGLQKNFRENTYITSVSRLYRDQGDNGSQDRDISTKHLQNQKSKFIKRNWEI
FT                   RGYQRIAGGSHVPFCLFAENVALATGTLDSPAHLEVEGEEFPFVFHSMPEFGAAINKGK
FT                   LCGRVDPVLIVGSGLTAADAVLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHK
FT                   VYHMMCSQSYSADSGPLSDYTSFPEHRVLSFKADMKCILQSVSGLKKIFKLSAAVILIG
FT                   SHPNLSFLKEQGCYLGRNSSQPITCKGNPVEVDAYTYECVKEANLFALGPLVGDNFVRF
FT                   LKGGALGVTRCLATRQKKKQHLFVQRGGGDGVA"
FT   assembly_gap    12522166..12522256
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(12533796..12535095)
FT                   /pseudo
FT                   /locus_tag="mCG_141729"
FT                   /note="gene_id=mCG141729.0"
FT   mRNA            complement(12533796..12535095)
FT                   /pseudo
FT                   /locus_tag="mCG_141729"
FT                   /note="gene_id=mCG141729.0 transcript_id=mCT176629.0
FT                   created on 07-DEC-2002"
FT   assembly_gap    12540828..12540983
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    12563869..12564492
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    12581447..12581466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12603541..12603560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12608677..12608924
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    12612029..12614835
FT                   /estimated_length=2807
FT                   /gap_type="unknown"
FT   gene            complement(12638204..12679083)
FT                   /gene="Ripk2"
FT                   /locus_tag="mCG_19039"
FT                   /note="gene_id=mCG19039.3"
FT   mRNA            complement(join(12638204..12639353,12639887..12640048,
FT                   12643087..12643180,12644489..12644575,12646982..12647105,
FT                   12648236..12648321,12653533..12653694,12654664..12654713,
FT                   12667372..12667529,12670479..12670634,12673723..12673876,
FT                   12678656..>12679075))
FT                   /gene="Ripk2"
FT                   /locus_tag="mCG_19039"
FT                   /product="receptor (TNFRSF)-interacting serine-threonine
FT                   kinase 2, transcript variant mCT189843"
FT                   /note="gene_id=mCG19039.3 transcript_id=mCT189843.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(12638763..12639353,12639887..12640048,
FT                   12643087..12643180,12644489..12644575,12648236..12648321,
FT                   12653533..12653694,12654664..12654713,12667372..12667529,
FT                   12670479..12670634,12673723..12673876,12678656..12679083))
FT                   /gene="Ripk2"
FT                   /locus_tag="mCG_19039"
FT                   /product="receptor (TNFRSF)-interacting serine-threonine
FT                   kinase 2, transcript variant mCT17043"
FT                   /note="gene_id=mCG19039.3 transcript_id=mCT17043.2 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(12639016..12639353,12639887..12640048,
FT                   12643087..12643180,12644489..12644575,12648236..12648321,
FT                   12653533..12653694,12654664..12654713,12667372..12667529,
FT                   12670479..12670634,12673723..12673876,12678656..12678828))
FT                   /codon_start=1
FT                   /gene="Ripk2"
FT                   /locus_tag="mCG_19039"
FT                   /product="receptor (TNFRSF)-interacting serine-threonine
FT                   kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG19039.3 transcript_id=mCT17043.2
FT                   protein_id=mCP22928.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q547H1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR017322"
FT                   /db_xref="MGI:MGI:1891456"
FT                   /db_xref="UniProtKB/TrEMBL:Q547H1"
FT                   /protein_id="EDL05589.1"
FT                   /translation="MNGDAICSALPPIPYHKLADLHYLSRGASGTVSSARHADWRVRVA
FT                   VKHLHIHTPLLDSERNDILREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLN
FT                   ELLHRKTEYPDIAWPLRFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIA
FT                   DFGLSKWRMMSLSQSRSYKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEV
FT                   LSRKQPFEEVTNPLQIMYSVSQGHRPDTSEENLPFDIPHRGLMISLIQSGWAQNPDERP
FT                   SFLKCLIELEPVLRTFEDITFLEAVIQLKKAKIQSSSSTIHLCDKKMDLSLNIPANHPP
FT                   QEESCGSSLLSRNTGSPGPSRSLSAPQDKGFLSGAPQDCSSLKAHHCPGNHSWDGIVSV
FT                   PPGAAFCDRRASSCSLAVISPFLVEKGSERPPIGIAQQWIQSKREAIVSQMTEACLNQS
FT                   LDALLSRDLIMKEDYELISTKPTRTSKVRQLLDTSDIQGEEFAKVVVQKLKDNKQLGLQ
FT                   PYPEVPVLSKAPPSNFPQNKSL"
FT   assembly_gap    12645040..12645103
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             complement(join(12647097..12647105,12648236..12648321,
FT                   12653533..12653694,12654664..12654713,12667372..12667529,
FT                   12670479..12670634,12673723..12673876,12678656..>12679053))
FT                   /codon_start=1
FT                   /gene="Ripk2"
FT                   /locus_tag="mCG_19039"
FT                   /product="receptor (TNFRSF)-interacting serine-threonine
FT                   kinase 2, isoform CRA_b"
FT                   /note="gene_id=mCG19039.3 transcript_id=mCT189843.0
FT                   protein_id=mCP110819.0 isoform=CRA_b"
FT                   /protein_id="EDL05590.1"
FT                   /translation="GVGEGRSPPREGRRREEPAESRRREEDGPPRRGRRPDGLPGTADR
FT                   AGTAAATREWAAPGPSAAARVGRSRRAAGAMNGDAICSALPPIPYHKLADLHYLSRGAS
FT                   GTVSSARHADWRVRVAVKHLHIHTPLLDSERNDILREAEILHKARFSYILPILGICNEP
FT                   EFLGIVTEYMPNGSLNELLHRKTEYPDIAWPLRFRILHEIALGVNYLHNMNPPLLHHDL
FT                   KTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSYKSAPEGGTIIYMPPENYEPGQKSRA
FT                   SVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPDTSEENLPFDIPHRGLM
FT                   ISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDITFLEAVIQLKKAKQN"
FT   assembly_gap    12661323..12661347
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            <12679542..12781421
FT                   /locus_tag="mCG_145903"
FT                   /note="gene_id=mCG145903.0"
FT   mRNA            join(<12679542..12679623,12688270..12688429,
FT                   12726163..12726212,12757376..12757447,12767864..12767973,
FT                   12770148..12770219,12780113..12781421)
FT                   /locus_tag="mCG_145903"
FT                   /product="mCG145903"
FT                   /note="gene_id=mCG145903.0 transcript_id=mCT186011.0
FT                   created on 04-JUL-2003"
FT   assembly_gap    12705542..12705561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<12726211..12726212,12757376..12757447,
FT                   12767864..12767973,12770148..12770219,12780113..12780255)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145903"
FT                   /product="mCG145903"
FT                   /note="gene_id=mCG145903.0 transcript_id=mCT186011.0
FT                   protein_id=mCP107557.0"
FT                   /protein_id="EDL05588.1"
FT                   /translation="ESALFSLGHSYACFPGGLLPSRTTRWRCVKTQKSCSRVTLLLHRA
FT                   SLAIEEVKLNSRQAAQCGSERQPCCGRQNKVSSWEEQCPKYGLSTGERWILESPTVDSG
FT                   QKKDTQATAAGQSALWKLEERYPSARPY"
FT   assembly_gap    12729269..12729569
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    12748288..12748527
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   gene            12761680..12764919
FT                   /pseudo
FT                   /locus_tag="mCG_50516"
FT                   /note="gene_id=mCG50516.2"
FT   mRNA            join(12761680..12762356,12764738..12764919)
FT                   /pseudo
FT                   /locus_tag="mCG_50516"
FT                   /note="gene_id=mCG50516.2 transcript_id=mCT50699.2 created
FT                   on 12-FEB-2003"
FT   assembly_gap    12777689..12777708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12782593..12782728
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    12810996..12811034
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12817964..12823634
FT                   /estimated_length=5671
FT                   /gap_type="unknown"
FT   assembly_gap    12835831..12836185
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    12837450..12838965
FT                   /estimated_length=1516
FT                   /gap_type="unknown"
FT   assembly_gap    12841531..12841644
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    12847328..12850284
FT                   /estimated_length=2957
FT                   /gap_type="unknown"
FT   assembly_gap    12878862..12878881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12901470..12901700
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   gene            complement(12905133..12906335)
FT                   /pseudo
FT                   /locus_tag="mCG_50515"
FT                   /note="gene_id=mCG50515.1"
FT   mRNA            complement(12905133..12906335)
FT                   /pseudo
FT                   /locus_tag="mCG_50515"
FT                   /note="gene_id=mCG50515.1 transcript_id=mCT50698.1 created
FT                   on 03-MAR-2003"
FT   assembly_gap    12931855..12931874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12982317..12982514
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    12987253..12989991
FT                   /estimated_length=2739
FT                   /gap_type="unknown"
FT   assembly_gap    12994841..12994950
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13001395..13001414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13032352..13032371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13062990..13063009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13079061..13079080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13080164..13080183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13087291..13087356
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    13108806..13108825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13121423..13121467
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13158395..13158414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13185968..13185987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13193614..13194312
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    13208582..13208601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13221286..13221832
FT                   /pseudo
FT                   /locus_tag="mCG_49139"
FT                   /note="gene_id=mCG49139.2"
FT   mRNA            13221286..13221832
FT                   /pseudo
FT                   /locus_tag="mCG_49139"
FT                   /note="gene_id=mCG49139.2 transcript_id=mCT49322.2 created
FT                   on 03-MAR-2003"
FT   assembly_gap    13244507..13249023
FT                   /estimated_length=4517
FT                   /gap_type="unknown"
FT   assembly_gap    13269526..13269545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13277122..13277142
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13285764..13286489
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    13292524..13293412
FT                   /estimated_length=889
FT                   /gap_type="unknown"
FT   assembly_gap    13294491..13296199
FT                   /estimated_length=1709
FT                   /gap_type="unknown"
FT   assembly_gap    13312549..13316965
FT                   /estimated_length=4417
FT                   /gap_type="unknown"
FT   assembly_gap    13332533..13333484
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   assembly_gap    13388678..13392264
FT                   /estimated_length=3587
FT                   /gap_type="unknown"
FT   assembly_gap    13394714..13395245
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    13397271..13397305
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    13402158..13402502
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    13414006..13414025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13415488..13415507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13427477..13427496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13476560..13476735
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    13484306..13484655
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    13487836..13487855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13522273..13522913
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    13525254..13526795
FT                   /estimated_length=1542
FT                   /gap_type="unknown"
FT   gene            complement(13543201..13544124)
FT                   /pseudo
FT                   /locus_tag="mCG_1042995"
FT                   /note="gene_id=mCG1042995.1"
FT   mRNA            complement(13543201..13544124)
FT                   /pseudo
FT                   /locus_tag="mCG_1042995"
FT                   /note="gene_id=mCG1042995.1 transcript_id=mCT160699.1
FT                   created on 03-MAR-2003"
FT   assembly_gap    13556787..13557160
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    13583137..13583156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13628116..13628922
FT                   /estimated_length=807
FT                   /gap_type="unknown"
FT   assembly_gap    13636587..13636642
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    13664952..13665362
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    13674795..13674814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13727305..13730447
FT                   /estimated_length=3143
FT                   /gap_type="unknown"
FT   assembly_gap    13739469..13739488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13741936..13741955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13762439..13762467
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    13780828..13780897
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    13789126..13792733
FT                   /estimated_length=3608
FT                   /gap_type="unknown"
FT   assembly_gap    13808980..13812416
FT                   /estimated_length=3437
FT                   /gap_type="unknown"
FT   assembly_gap    13819454..13819692
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    13877106..13877564
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    13882188..13882280
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    13884753..13884772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13888184..13889728
FT                   /estimated_length=1545
FT                   /gap_type="unknown"
FT   assembly_gap    13913072..13919211
FT                   /estimated_length=6140
FT                   /gap_type="unknown"
FT   assembly_gap    13937013..13937333
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    13950273..13958245
FT                   /estimated_length=7973
FT                   /gap_type="unknown"
FT   assembly_gap    13993244..13993263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14000458..14000477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14048744..14048763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14069135..14069154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14076390..14076409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14077957..14083656
FT                   /estimated_length=5700
FT                   /gap_type="unknown"
FT   assembly_gap    14124602..14124621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14136115..14136134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14137958..14137977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14195447..14195576
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    14205671..14205690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14225692..14226013
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    14228454..14228473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14252470..14252489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14254872..14257768
FT                   /estimated_length=2897
FT                   /gap_type="unknown"
FT   assembly_gap    14290707..14292471
FT                   /estimated_length=1765
FT                   /gap_type="unknown"
FT   assembly_gap    14303250..14303394
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            <14362640..14623258
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /note="gene_id=mCG121174.2"
FT   mRNA            join(<14362640..14362846,14363395..14363601,
FT                   14500077..14500225,14508667..14508789,14523980..14524284,
FT                   14557757..14557918,14560402..14560613,14599088..14599226,
FT                   14606752..14606881,14616181..14616331,14617752..14617867,
FT                   14621670..14623258)
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, transcript variant
FT                   mCT189827"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT189827.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(14362640..14362846,14363395..14363601,
FT                   14500077..14500225,14508667..14508789,14523980..14524284,
FT                   14557757..14557918,14560402..14560613,14599088..14599226,
FT                   14616181..14616331,14617752..14617867,14621670..14622419)
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, transcript variant
FT                   mCT160759"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT160759.1
FT                   created on 21-SEP-2002"
FT   CDS             join(<14362823..14362846,14363395..14363601,
FT                   14500077..14500225,14508667..14508789,14523980..14524284,
FT                   14557757..14557918,14560402..14560613,14599088..14599226,
FT                   14606752..14606777)
FT                   /codon_start=1
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, isoform CRA_b"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT189827.0
FT                   protein_id=mCP110812.0 isoform=CRA_b"
FT                   /protein_id="EDL05586.1"
FT                   /translation="EARLRVFRETGSGHSERGRKRRGARPSVEAQFTMILLAFSSGRRL
FT                   DFVHRSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQS
FT                   ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHK
FT                   HITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFA
FT                   SGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHEL
FT                   GHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVP
FT                   PHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFW
FT                   RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKASWMTVFC"
FT   mRNA            join(14362879..14363601,14500077..14500225,
FT                   14508667..14508789,14523980..14524284,14557757..14557918,
FT                   14560402..14560613,14599088..14599226,14616181..14616331,
FT                   14617752..14617867,14621670..14622469)
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, transcript variant
FT                   mCT122371"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT122371.1
FT                   created on 21-SEP-2002"
FT   CDS             join(14363470..14363601,14500077..14500225,
FT                   14508667..14508789,14523980..14524284,14557757..14557918,
FT                   14560402..14560613,14599088..14599226,14616181..14616331,
FT                   14617752..14617867,14621670..14622004)
FT                   /codon_start=1
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, isoform CRA_a"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT160759.1
FT                   protein_id=mCP68005.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTR0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTR0"
FT                   /protein_id="EDL05585.1"
FT                   /translation="MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEV
FT                   WLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVP
FT                   DQTRGSSKFNIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVT
FT                   PLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF
FT                   DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND
FT                   DLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKP
FT                   NICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS
FT                   DGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDR
FT                   YWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKV
FT                   EPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALC
FT                   LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
FT   CDS             join(14363470..14363601,14500077..14500225,
FT                   14508667..14508789,14523980..14524284,14557757..14557918,
FT                   14560402..14560613,14599088..14599226,14616181..14616331,
FT                   14617752..14617867,14621670..14622004)
FT                   /codon_start=1
FT                   /gene="Mmp16"
FT                   /locus_tag="mCG_121174"
FT                   /product="matrix metallopeptidase 16, isoform CRA_a"
FT                   /note="gene_id=mCG121174.2 transcript_id=mCT122371.1
FT                   protein_id=mCP67663.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTR0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTR0"
FT                   /protein_id="EDL05587.1"
FT                   /translation="MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEV
FT                   WLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVP
FT                   DQTRGSSKFNIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVT
FT                   PLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF
FT                   DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND
FT                   DLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKP
FT                   NICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS
FT                   DGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDR
FT                   YWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKV
FT                   EPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALC
FT                   LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
FT   assembly_gap    14394601..14394716
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    14407486..14407539
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    14411730..14415584
FT                   /estimated_length=3855
FT                   /gap_type="unknown"
FT   assembly_gap    14445659..14445711
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    14456584..14456603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14463371..14463390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14464873..14464892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14474699..14474718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14478229..14478248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14521625..14522736)
FT                   /pseudo
FT                   /locus_tag="mCG_19549"
FT                   /note="gene_id=mCG19549.1"
FT   mRNA            complement(14521625..14522736)
FT                   /pseudo
FT                   /locus_tag="mCG_19549"
FT                   /note="gene_id=mCG19549.1 transcript_id=mCT20018.1 created
FT                   on 17-JAN-2003"
FT   assembly_gap    14546963..14547004
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14561989..14562008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14563424..14563448
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    14577180..14577316
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    14596411..14596430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14620586..14621434
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    14633551..14633681
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    14668453..14668472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14718303..14718322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14727114..14732438
FT                   /estimated_length=5325
FT                   /gap_type="unknown"
FT   assembly_gap    14769268..14769287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14787490..14787648
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    14788662..14789011
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    14802651..14802671
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    14821012..14821179
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    14822577..14823587
FT                   /estimated_length=1011
FT                   /gap_type="unknown"
FT   assembly_gap    14827810..14827829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14829784..14829803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14877940..14877959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14879215..14879234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14880951..14880970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14889403..14889612
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    14903988..14904007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14923269..14928735
FT                   /estimated_length=5467
FT                   /gap_type="unknown"
FT   assembly_gap    14935734..14936073
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    14956697..14956753
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    14976016..14976035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14978065..14978084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14984038..14984084
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    14996366..14997406
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    15012056..15012075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15051341..15051390
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    15055850..15056026
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    15088183..15088202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15089691..15089710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15099821..15099840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15164038..15164057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15167694..15168462
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   assembly_gap    15193162..15193325
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    15194511..15195732
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    15205050..15207426
FT                   /estimated_length=2377
FT                   /gap_type="unknown"
FT   assembly_gap    15217423..15217442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15229092..15235065
FT                   /estimated_length=5974
FT                   /gap_type="unknown"
FT   assembly_gap    15247248..15247556
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    15247788..15247851
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   gene            15257027..15375305
FT                   /locus_tag="mCG_147153"
FT                   /note="gene_id=mCG147153.0"
FT   mRNA            join(15257027..15257085,15310246..15310301,
FT                   15347733..15347803,15348045..15348230,15353750..15353940,
FT                   15357967..15358063,15358178..15358401,15374550..15375305)
FT                   /locus_tag="mCG_147153"
FT                   /product="mCG147153"
FT                   /note="gene_id=mCG147153.0 transcript_id=mCT187416.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    15312015..15312123
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(15327158..>15329323)
FT                   /locus_tag="mCG_11288"
FT                   /note="gene_id=mCG11288.2"
FT   mRNA            complement(15327158..>15329323)
FT                   /locus_tag="mCG_11288"
FT                   /product="mCG11288"
FT                   /note="gene_id=mCG11288.2 transcript_id=mCT11297.2 created
FT                   on 17-JAN-2003"
FT   CDS             complement(15327654..>15328784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11288"
FT                   /product="mCG11288"
FT                   /note="gene_id=mCG11288.2 transcript_id=mCT11297.2
FT                   protein_id=mCP22924.2"
FT                   /protein_id="EDL05584.1"
FT                   /translation="SQVSDTLPRDVTDTLPREGLSSPSYDWFQTESSVTIVVYTKQKNI
FT                   SLDSVIVDLQDDSSRADAVIKDHSYLVHVGLSHEVQENFSVRVIENVGKIEIVLQKKES
FT                   VSWQCLGDHLEKHDPFIPKKDTGLYYRRCQLISKEDVTHDTRLFCLMLPPSTHLQVPVG
FT                   QHVYLKLSVTGAEIVKPYTPVSDSLLSDFKEPVLSPNKYIYFLIKIYPAGLFTPELDRL
FT                   QIGDFISVSGPEGNFKVSKLQEVEDLFLLAAGTGFTPMVTVLNYALSHMSSLRKVKLMF
FT                   FNKTEDDIIWRCQLEKLALREKRFDVEFVLPAPSLEWNCKQGHISRALLSEFLQRSSEN
FT                   SRAFLCICGPTPFTDEGIRLMHDLNFSDDEVHGFTA"
FT   assembly_gap    15336021..15336050
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15342419..15342501
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   CDS             join(15358254..15358401,15374550..15374560)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147153"
FT                   /product="mCG147153"
FT                   /note="gene_id=mCG147153.0 transcript_id=mCT187416.0
FT                   protein_id=mCP108347.0"
FT                   /protein_id="EDL05583.1"
FT                   /translation="MLHRNKMKGVVHDGFSLKITILQRLRQEDHEFQMSLSTHRSFKEK
FT                   ETKRVNL"
FT   assembly_gap    15400180..15400226
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    15410830..15411203
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    15440732..15441690
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    15454695..15459649
FT                   /estimated_length=4955
FT                   /gap_type="unknown"
FT   assembly_gap    15470717..15471081
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    15497929..15498074
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    15519461..15519480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15542403..15542950
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    15558344..15559419
FT                   /estimated_length=1076
FT                   /gap_type="unknown"
FT   assembly_gap    15561866..15562335
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    15567420..15567978
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    15571945..15571964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15578881..15579017
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    15644806..15644825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15646560..15646579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15677357..15677694
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    15680732..15681707
FT                   /estimated_length=976
FT                   /gap_type="unknown"
FT   assembly_gap    15688324..15688411
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    15694809..15694960
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            15740638..15741402
FT                   /pseudo
FT                   /locus_tag="mCG_1042992"
FT                   /note="gene_id=mCG1042992.1"
FT   mRNA            15740638..15741402
FT                   /pseudo
FT                   /locus_tag="mCG_1042992"
FT                   /note="gene_id=mCG1042992.1 transcript_id=mCT160696.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    15750030..15750049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15754092..15754631
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    15761579..15761598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15762139..15991922
FT                   /gene="Cngb3"
FT                   /locus_tag="mCG_121247"
FT                   /note="gene_id=mCG121247.0"
FT   mRNA            join(15762139..15762332,15764795..15764870,
FT                   15791081..15791207,15845311..15845468,15847620..15847766,
FT                   15848923..15849131,15856467..15856517,15860531..15860617,
FT                   15877068..15877132,15877822..15877944,15896785..15896926,
FT                   15906629..15906788,15909628..15909725,15942827..15942910,
FT                   15962996..15963114,15985775..15985921,15986486..15986660,
FT                   15989383..15991922)
FT                   /gene="Cngb3"
FT                   /locus_tag="mCG_121247"
FT                   /product="cyclic nucleotide gated channel beta 3"
FT                   /note="gene_id=mCG121247.0 transcript_id=mCT122444.1
FT                   created on 13-DEC-2002"
FT   CDS             join(15762222..15762332,15764795..15764870,
FT                   15791081..15791207,15845311..15845468,15847620..15847766,
FT                   15848923..15849131,15856467..15856517,15860531..15860617,
FT                   15877068..15877132,15877822..15877944,15896785..15896926,
FT                   15906629..15906788,15909628..15909725,15942827..15942910,
FT                   15962996..15963114,15985775..15985921,15986486..15986660,
FT                   15989383..15989388)
FT                   /codon_start=1
FT                   /gene="Cngb3"
FT                   /locus_tag="mCG_121247"
FT                   /product="cyclic nucleotide gated channel beta 3"
FT                   /note="gene_id=mCG121247.0 transcript_id=mCT122444.1
FT                   protein_id=mCP67702.1"
FT                   /protein_id="EDL05582.1"
FT                   /translation="MLKSLTVKFNKVNPMEGRMEKKLCPNLSSLSQPTIAQGDNQSEKE
FT                   PLRSRTPITFEKSHSKEDNSTGENSLRDFTPNPDPECRAELTRTMAEMEKTRTGKERPV
FT                   SFKTKVLETSIINEYTDAHLHNLVERMRERTALYKKTLTEEENFPEVEASSQTAMSTNI
FT                   SPKQENNSKLKEHQDTFSFKPQRVPVKEHLRRMILPRSIDSYTDRVYLLWLLLVTIAYN
FT                   WNCWLLPVRLVFPCQTPDNKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNE
FT                   LKRNYRSSTKFRMDVASLLPFEVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKA
FT                   YVYRVIRTTGYLLFLLHINACVYYWASDYEGIGSTKWVYNGEGNKYLRCFYWAVRTLIT
FT                   IGGLPEPQTSFEIVFQFLNFFSGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYM
FT                   NKYSIPQSVQYRVRTWLEYTWNSQRILDESNLLENLPTAMQLSIALDINFSIIDKVELF
FT                   KGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTL
FT                   KAGSVFGEISLLAKGGGNRRTADVVAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAK
FT                   ILLSQKGKTTQAIPARPGPAFLFPPKEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK
FT                   "
FT   assembly_gap    15765257..15765505
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   gene            15779692..15780792
FT                   /pseudo
FT                   /locus_tag="mCG_1501"
FT                   /note="gene_id=mCG1501.1"
FT   mRNA            15779692..15780792
FT                   /pseudo
FT                   /locus_tag="mCG_1501"
FT                   /note="gene_id=mCG1501.1 transcript_id=mCT7968.1 created on
FT                   17-JAN-2003"
FT   assembly_gap    15786889..15786908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15788189..15788942
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    15832937..15832956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15836777..15836857
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    15841408..15841899
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    15844054..15844113
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    15845830..15846005
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    15857373..15857502
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    15858932..15859026
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    15863756..15863861
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    15869822..15871347
FT                   /estimated_length=1526
FT                   /gap_type="unknown"
FT   assembly_gap    15880606..15880653
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    15908576..15908611
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    15955275..15955294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15971809..15971828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15974262..15974281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16003297..16051453)
FT                   /gene="Cpne3"
FT                   /locus_tag="mCG_1497"
FT                   /note="gene_id=mCG1497.2"
FT   mRNA            complement(join(16003297..16004601,16006313..16006549,
FT                   16007594..16007727,16009370..16009421,16009498..16009552,
FT                   16013742..16013875,16014398..16014457,16016555..16016641,
FT                   16017870..16017968,16022086..16022175,16024605..16024688,
FT                   16031938..16032009,16033595..16033669,16035057..16035236,
FT                   16036700..16036839,16051345..16051453))
FT                   /gene="Cpne3"
FT                   /locus_tag="mCG_1497"
FT                   /product="copine III, transcript variant mCT7964"
FT                   /note="gene_id=mCG1497.2 transcript_id=mCT7964.2 created on
FT                   09-JAN-2003"
FT   CDS             complement(join(16004491..16004601,16006313..16006549,
FT                   16007594..16007727,16009370..16009421,16009498..16009552,
FT                   16013742..16013875,16014398..16014457,16016555..16016641,
FT                   16017870..16017968,16022086..16022175,16024605..16024688,
FT                   16031938..16032009,16033595..16033669,16035057..16035236,
FT                   16036700..16036831))
FT                   /codon_start=1
FT                   /gene="Cpne3"
FT                   /locus_tag="mCG_1497"
FT                   /product="copine III, isoform CRA_b"
FT                   /note="gene_id=mCG1497.2 transcript_id=mCT7964.2
FT                   protein_id=mCP22921.2 isoform=CRA_b"
FT                   /protein_id="EDL05581.1"
FT                   /translation="MAAQCVTKVELNVSCNNLLDADVTSKSDPLCVLFLNTSGHQWYEV
FT                   ERTERIKNSLNPKFSKTFVIDYYFEVVQKLKFGIYDIDNKTIELSDDDFLGECEVTLGQ
FT                   IVSSKKLTRPLVLKNGKPAGKGSITISAEEIKDNRVVLFEMEARKLDNKDLFGKSDPYL
FT                   EFHKQTSDGHWLMVHRTEVIKNNLNPMWKPFKISLNSLCYGDMDKTIKVECYDYDNDGS
FT                   HDLIGTFQTTMTKLKEASRSSPVEYECINEKKRQKKKSYKNSGVISVKHCEITVECTFL
FT                   DYIMGGCQLNFTVGVDFTGSNGDPSSPDSLHYISPNGVNEYLTAIWSVGLVIQDYDADK
FT                   MFPAFGFGAQVPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRTCLPQIRLYGPTNFSP
FT                   IINHVARFAAAATQQQTASQYFVLLIITDGVITDLDETRQAIVNAAKLPMSIIIVGVGG
FT                   ADFSAMEFLDGDGGSLRAPSGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVG
FT                   YFNTYKLLPPKNPAVK"
FT   mRNA            complement(join(16030925..16032009,16033595..16033669,
FT                   16035057..16035236,16036700..16036839,16051345..16051453))
FT                   /gene="Cpne3"
FT                   /locus_tag="mCG_1497"
FT                   /product="copine III, transcript variant mCT178416"
FT                   /note="gene_id=mCG1497.2 transcript_id=mCT178416.0 created
FT                   on 09-JAN-2003"
FT   CDS             complement(join(16031872..16032009,16033595..16033669,
FT                   16035057..16035236,16036700..16036831))
FT                   /codon_start=1
FT                   /gene="Cpne3"
FT                   /locus_tag="mCG_1497"
FT                   /product="copine III, isoform CRA_a"
FT                   /note="gene_id=mCG1497.2 transcript_id=mCT178416.0
FT                   protein_id=mCP101338.0 isoform=CRA_a"
FT                   /protein_id="EDL05580.1"
FT                   /translation="MAAQCVTKVELNVSCNNLLDADVTSKSDPLCVLFLNTSGHQWYEV
FT                   ERTERIKNSLNPKFSKTFVIDYYFEVVQKLKFGIYDIDNKTIELSDDDFLGECEVTLGQ
FT                   IVSSKKLTRPLVLKNGKPAGKGSITISAEEIKDNRVVLFEMEARKLDNKVSTFCVLCKE
FT                   KDHLTPALVPF"
FT   gene            16056549..16087631
FT                   /gene="2410005O16Rik"
FT                   /locus_tag="mCG_1505"
FT                   /note="gene_id=mCG1505.1"
FT   mRNA            join(16056549..16056687,16061727..16061844,
FT                   16068097..16068184,16069845..16070004,16076399..16076488,
FT                   16080982..16081037,16082723..16082810,16083987..16084017,
FT                   16086757..16086890,16087439..16087631)
FT                   /gene="2410005O16Rik"
FT                   /locus_tag="mCG_1505"
FT                   /product="RIKEN cDNA 2410005O16"
FT                   /note="gene_id=mCG1505.1 transcript_id=mCT7972.1 created on
FT                   31-JUL-2002"
FT   CDS             join(16056574..16056687,16061727..16061844,
FT                   16068097..16068184,16069845..16070004,16076399..16076488,
FT                   16080982..16081037,16082723..16082810,16083987..16084017,
FT                   16086757..16086890,16087439..16087477)
FT                   /codon_start=1
FT                   /gene="2410005O16Rik"
FT                   /locus_tag="mCG_1505"
FT                   /product="RIKEN cDNA 2410005O16"
FT                   /note="gene_id=mCG1505.1 transcript_id=mCT7972.1
FT                   protein_id=mCP22913.2"
FT                   /protein_id="EDL05579.1"
FT                   /translation="MALSSRLWRRLPPLRVCQQTRTWSSRGRCGAWGVRACEVIGNTRP
FT                   FKRGFLFSALSYLGFETYQIISQAAVVHATAKVEEILAQADYLYESGETEKLYQLLIQY
FT                   KESEDGELLWRLARASRDIAQLSKTSEEEKKVLVYEALDYAKRALEKKESSSAAHKWYA
FT                   ICISDVGDYEGIKVKIANAYVIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRR
FT                   IAKVLFANPPSSTYEEALRYFHKAEEVDPNFYSKNLLLLGKTYLKLNNKKLAAFWLVKA
FT                   KGYPAHTEEDKQIQTEAAQLLTGL"
FT   gene            complement(16089848..16190080)
FT                   /locus_tag="mCG_1040556"
FT                   /note="gene_id=mCG1040556.4"
FT   mRNA            complement(join(16089848..16093168,16099358..16099430,
FT                   16100229..16100325,16103001..16103105,16104175..16104295,
FT                   16108706..16108846,16108944..16109077,16112118..16112277,
FT                   16116332..16116420,16119687..16119758,16119857..16119932,
FT                   16121034..16121162,16121277..16121361,16121443..16121497,
FT                   16122820..16122994,16124452..16124547,16140674..16140858,
FT                   16143077..16143143,16143233..16143370,16153530..16153654,
FT                   16154267..16154405,16159458..16159548,16168905..16169000,
FT                   16189893..16190080))
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, transcript variant mCT161049"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT161049.4
FT                   created on 27-JUN-2003"
FT   mRNA            complement(join(16089848..16093168,16099358..16099430,
FT                   16100229..16100325,16103001..16103105,16104175..16104295,
FT                   16108706..16108846,16108944..16109077,16112118..16112277,
FT                   16116332..16116420,16119687..16119758,16119857..16119932,
FT                   16121034..16121162,16121277..16121361,16121443..16121497,
FT                   16122820..16122994,16124452..16124547,16131256..16131580,
FT                   16140674..16140858,16143077..16143143,16143233..16143370,
FT                   16153530..16153654,16154267..16154405,16159458..16159548,
FT                   16168905..16169000,16189893..16190080))
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, transcript variant mCT122449"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT122449.3
FT                   created on 27-JUN-2003"
FT   mRNA            complement(join(16089848..16093168,16099358..16099430,
FT                   16100229..16100325,16103001..16103105,16104175..16104295,
FT                   16108706..16108846,16108944..16109077,16112118..16112277,
FT                   16116332..16116420,16119687..16119758,16119857..16119932,
FT                   16121034..16121162,16121277..16121361,16121443..16121497,
FT                   16122820..16122994,16124452..16124547,16131256..16131580,
FT                   16140674..16140858,16153530..16153654,16154267..16154405,
FT                   16156075..16156117,16159458..16159548,16168905..16169000,
FT                   16189893..16190080))
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, transcript variant mCT186453"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT186453.0
FT                   created on 27-JUN-2003"
FT   CDS             complement(join(16093069..16093168,16099358..16099430,
FT                   16100229..16100325,16103001..16103105,16104175..16104295,
FT                   16108706..16108846,16108944..16109077,16112118..16112277,
FT                   16116332..16116420,16119687..16119758,16119857..16119932,
FT                   16121034..16121162,16121277..16121361,16121443..16121497,
FT                   16122820..16122994,16124452..16124547,16131256..16131580,
FT                   16140674..16140858,16143077..16143143,16143233..16143370,
FT                   16153530..16153654,16154267..16154405,16159458..16159527))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, isoform CRA_a"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT122449.3
FT                   protein_id=mCP67924.1 isoform=CRA_a"
FT                   /protein_id="EDL05576.1"
FT                   /translation="MATASPRSDTSDIHSGRLQLKVTVSSAKLKRKKNWFGTAIYTEVI
FT                   VDGEVKKTAKSSSSSNPKWDEQLIVNVTPQTTLEFRVWSHHTLKADALLGKATVDLKQV
FT                   LLTHNRKLEKVKEQLKLSLENKNGIVQTGELTVVLDGLVIEQEPVTNRSSSPPIEIQQN
FT                   GDALHENGDPATRTTPRLPVEGTIGIDNHVSTNTVVPNSCCSHVVNGENTPSSPSQVAA
FT                   RPKNAPAPKPVTSAPTSDTVNGESSSVLADNTSTMGTLLPSEDTTSTSNCTSTTTQEPP
FT                   VQEPPASSEHSECIPSASAEVGPEARSLIDPDSDSRNNSVFDKVRQPEGCVEPLRPQSG
FT                   NTNTEALPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHN
FT                   TRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGW
FT                   EKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRT
FT                   TTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDS
FT                   FQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNY
FT                   CLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLES
FT                   IDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYI
FT                   GLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNT
FT                   VYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCI
FT                   EKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE"
FT   CDS             complement(join(16121485..16121497,16122820..16122994,
FT                   16124452..16124547,16140674..16140858,16143077..16143143,
FT                   16143233..16143370,16153530..16153654,16154267..16154405,
FT                   16159458..16159527))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, isoform CRA_b"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT161049.4
FT                   protein_id=mCP90063.4 isoform=CRA_b"
FT                   /protein_id="EDL05577.1"
FT                   /translation="MATASPRSDTSDIHSGRLQLKVTVSSAKLKRKKNWFGTAIYTEVI
FT                   VDGEVKKTAKSSSSSNPKWDEQLIVNVTPQTTLEFRVWSHHTLKADALLGKATVDLKQV
FT                   LLTHNRKLEKVKEQLKLSLENKNGIVQTGELTVVLDGLVIEQEPVTNRSSSPPIEIQQN
FT                   GDALHENGDPATRTTPRLPVEGTIGIDNHVSTNTVVPNSCCSHVVNGENTPSSPSQVAA
FT                   RPKNAPAPKPVTSAPTSDTGGNREKILMVEPIMWIIILELLHGRDHSLCLQVGKEELMI
FT                   VEEFIMWIITPEQQPGSGLLWNLFEILNSGSLSGINCRELCNNSTNDTSIRLPC"
FT   assembly_gap    16126470..16126603
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   CDS             complement(join(16156089..16156117,16159458..16159527))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040556"
FT                   /product="mCG1040556, isoform CRA_c"
FT                   /note="gene_id=mCG1040556.4 transcript_id=mCT186453.0
FT                   protein_id=mCP107157.0 isoform=CRA_c"
FT                   /protein_id="EDL05578.1"
FT                   /translation="MATASPRSDTSDIHSGRLQLKVTGEKMEGQSR"
FT   assembly_gap    16161148..16161206
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    16196865..16197215
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    16214545..16214770
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    16227126..16228874
FT                   /estimated_length=1749
FT                   /gap_type="unknown"
FT   assembly_gap    16234571..16234666
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    16238469..16238489
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    16241398..16242609
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   gene            16295280..16318986
FT                   /gene="Slc7a13"
FT                   /locus_tag="mCG_119871"
FT                   /note="gene_id=mCG119871.2"
FT   mRNA            join(16295280..16296034,16301126..16301257,
FT                   16316257..16316618,16318375..16318986)
FT                   /gene="Slc7a13"
FT                   /locus_tag="mCG_119871"
FT                   /product="solute carrier family 7, (cationic amino acid
FT                   transporter, y+ system) member 13, transcript variant
FT                   mCT121046"
FT                   /note="gene_id=mCG119871.2 transcript_id=mCT121046.2
FT                   created on 06-JAN-2003"
FT   CDS             join(16295344..16296034,16301126..16301257,
FT                   16316257..16316618,16318375..16318626)
FT                   /codon_start=1
FT                   /gene="Slc7a13"
FT                   /locus_tag="mCG_119871"
FT                   /product="solute carrier family 7, (cationic amino acid
FT                   transporter, y+ system) member 13, isoform CRA_a"
FT                   /note="gene_id=mCG119871.2 transcript_id=mCT121046.2
FT                   protein_id=mCP67720.1 isoform=CRA_a"
FT                   /protein_id="EDL05574.1"
FT                   /translation="MAMDSKKEIRLKRELGYFWGTNFLIINIIGAGIFVSPKGVLQHSS
FT                   MNVGVSLCVWAVCAVLTLTSALCSAEIGITFPYSGAHYYFLKRCFGPLVAFLRLWTSLF
FT                   LGPGLIASQALLLAEYGVQPFYPSCSAPILPRKCLALAMLWIVGILNSRGVKELSWLQT
FT                   VSSVLKVGILGVISLSGLFLLVRGKKENVQRLQNAFDAEFPEVSQLIEAIFQGYFAFSG
FT                   GGCFTCIAGELKKPSKTIPRCIFTGLPLVTVVYLLANISYLTVLTPQEMLSSDAVALTW
FT                   TDRVIPQFTWTVPFAISASLFINLVINVLETSRVLYIASENGQLPLLFCALNVHSSPFI
FT                   AVLLIISMASILIVLTNLIDLINYLYFVVSIWTALSIIGILKLRYQEPNLHRPYKVFLP
FT                   FTFIALGITLSLVLIPLVKSPKLHYIYVFLFLLSGLVFYVPLIHFKVKFVWFQKLTCYL
FT                   QLLFNICIPDVSDDHIHEES"
FT   mRNA            join(16296879..16296900,16301126..16301257,
FT                   16316257..16316618,16318375..16318986)
FT                   /gene="Slc7a13"
FT                   /locus_tag="mCG_119871"
FT                   /product="solute carrier family 7, (cationic amino acid
FT                   transporter, y+ system) member 13, transcript variant
FT                   mCT178399"
FT                   /note="gene_id=mCG119871.2 transcript_id=mCT178399.0
FT                   created on 06-JAN-2003"
FT   assembly_gap    16298089..16299167
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   CDS             join(16301245..16301257,16316257..16316618,
FT                   16318375..16318626)
FT                   /codon_start=1
FT                   /gene="Slc7a13"
FT                   /locus_tag="mCG_119871"
FT                   /product="solute carrier family 7, (cationic amino acid
FT                   transporter, y+ system) member 13, isoform CRA_b"
FT                   /note="gene_id=mCG119871.2 transcript_id=mCT178399.0
FT                   protein_id=mCP101321.0 isoform=CRA_b"
FT                   /protein_id="EDL05575.1"
FT                   /translation="MLSSDAVALTWTDRVIPQFTWTVPFAISASLFINLVINVLETSRV
FT                   LYIASENGQLPLLFCALNVHSSPFIAVLLIISMASILIVLTNLIDLINYLYFVVSIWTA
FT                   LSIIGILKLRYQEPNLHRPYKVFLPFTFIALGITLSLVLIPLVKSPKLHYIYVFLFLLS
FT                   GLVFYVPLIHFKVKFVWFQKLTCYLQLLFNICIPDVSDDHIHEES"
FT   assembly_gap    16306025..16306150
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    16327764..16328820
FT                   /estimated_length=1057
FT                   /gap_type="unknown"
FT   assembly_gap    16337205..16337224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16344198..16344504
FT                   /pseudo
FT                   /locus_tag="mCG_1042991"
FT                   /note="gene_id=mCG1042991.1"
FT   mRNA            16344198..16344504
FT                   /pseudo
FT                   /locus_tag="mCG_1042991"
FT                   /note="gene_id=mCG1042991.1 transcript_id=mCT160695.1
FT                   created on 04-MAR-2003"
FT   gene            complement(16354755..16398126)
FT                   /gene="Atp6v0d2"
FT                   /locus_tag="mCG_1500"
FT                   /note="gene_id=mCG1500.2"
FT   mRNA            complement(join(16354755..16355218,16356843..16356917,
FT                   16358116..16358292,16364156..16364233,16365593..16365672,
FT                   16367527..16367705,16386111..16386282,16397888..16398126))
FT                   /gene="Atp6v0d2"
FT                   /locus_tag="mCG_1500"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit D2"
FT                   /note="gene_id=mCG1500.2 transcript_id=mCT7967.2 created on
FT                   09-JAN-2003"
FT   CDS             complement(join(16355057..16355218,16356843..16356917,
FT                   16358116..16358292,16364156..16364233,16365593..16365672,
FT                   16367527..16367705,16386111..16386282,16397888..16398017))
FT                   /codon_start=1
FT                   /gene="Atp6v0d2"
FT                   /locus_tag="mCG_1500"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit D2"
FT                   /note="gene_id=mCG1500.2 transcript_id=mCT7967.2
FT                   protein_id=mCP22931.2"
FT                   /protein_id="EDL05573.1"
FT                   /translation="MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDL
FT                   KIHLQTTDYGNFLANETNPLTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFLTYMTCSY
FT                   MIDNIILLMNGALQKKSVKEVLAKCHPLGRFTEMEAVNIAETPSDLFKAVLVETPLAPF
FT                   FQDCMSENTLDELNIELLRNKLYKSYLEAFYKFCKDHGDVTADVMCPILEFEADRRALI
FT                   ITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNYGVYKPLFDAV
FT                   GGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHR
FT                   TKINSYIPIL"
FT   assembly_gap    16368049..16368068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16374906..16374925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16439678..16439697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16447977..16448111
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            complement(16457469..16482928)
FT                   /locus_tag="mCG_1050953"
FT                   /note="gene_id=mCG1050953.0"
FT   mRNA            complement(join(16457469..16457844,16461161..16461574,
FT                   16463124..16463330,16482421..16482478,16482805..16482928))
FT                   /locus_tag="mCG_1050953"
FT                   /product="mCG1050953"
FT                   /note="gene_id=mCG1050953.0 transcript_id=mCT194742.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    16460824..16460843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(16463125..16463330,16482421..16482466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050953"
FT                   /product="mCG1050953"
FT                   /note="gene_id=mCG1050953.0 transcript_id=mCT194742.0
FT                   protein_id=mCP115771.0"
FT                   /protein_id="EDL05572.1"
FT                   /translation="MAQRLRALAAVTEDPEAPDPLELWLLAVMSCFMWLLGTKCGPSAR
FT                   AACALSIPGTHDFHTTGTANREYLIRCQNGIITNMSSI"
FT   assembly_gap    16464053..16464072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16480139..16480158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16485206..16508320
FT                   /gene="Ttpa"
FT                   /locus_tag="mCG_1498"
FT                   /note="gene_id=mCG1498.2"
FT   mRNA            join(16485206..16485541,16491853..16492006,
FT                   16498432..16498625,16501025..16501135,16505906..16508320)
FT                   /gene="Ttpa"
FT                   /locus_tag="mCG_1498"
FT                   /product="tocopherol (alpha) transfer protein, transcript
FT                   variant mCT178417"
FT                   /note="gene_id=mCG1498.2 transcript_id=mCT178417.0 created
FT                   on 09-JAN-2003"
FT   mRNA            join(16485550..16485838,16491853..16492006,
FT                   16498432..16498625,16501025..16501135,16505906..16508320)
FT                   /gene="Ttpa"
FT                   /locus_tag="mCG_1498"
FT                   /product="tocopherol (alpha) transfer protein, transcript
FT                   variant mCT7966"
FT                   /note="gene_id=mCG1498.2 transcript_id=mCT7966.2 created on
FT                   09-JAN-2003"
FT   CDS             join(16485635..16485838,16491853..16492006,
FT                   16498432..16498625,16501025..16501135,16505906..16506079)
FT                   /codon_start=1
FT                   /gene="Ttpa"
FT                   /locus_tag="mCG_1498"
FT                   /product="tocopherol (alpha) transfer protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1498.2 transcript_id=mCT7966.2
FT                   protein_id=mCP22922.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q499J3"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="MGI:MGI:1354168"
FT                   /db_xref="UniProtKB/TrEMBL:Q499J3"
FT                   /protein_id="EDL05571.1"
FT                   /translation="MAEMRPGPLVGKQLNELPDHSPLLQPGLAELRRRVQEAGVPQTPQ
FT                   PLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVL
FT                   RSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW
FT                   QVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRI
FT                   HLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISETIQ"
FT   CDS             join(16491856..16492006,16498432..16498625,
FT                   16501025..16501135,16505906..16506079)
FT                   /codon_start=1
FT                   /gene="Ttpa"
FT                   /locus_tag="mCG_1498"
FT                   /product="tocopherol (alpha) transfer protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1498.2 transcript_id=mCT178417.0
FT                   protein_id=mCP101339.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8Y5N9"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="MGI:MGI:1354168"
FT                   /db_xref="UniProtKB/TrEMBL:A8Y5N9"
FT                   /protein_id="EDL05570.1"
FT                   /translation="MKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRV
FT                   LIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITP
FT                   SVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSS
FT                   MLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISETIQ"
FT   assembly_gap    16501960..16502277
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    16514817..16514870
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    16519194..16519370
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            16519534..16544141
FT                   /gene="Ggh"
FT                   /locus_tag="mCG_1496"
FT                   /note="gene_id=mCG1496.2"
FT   mRNA            join(16519534..16519606,16523513..16523624,
FT                   16527626..16527676,16530525..16530609,16531907..16532046,
FT                   16535751..16535857,16535953..16536043,16541818..16541955,
FT                   16543560..16544141)
FT                   /gene="Ggh"
FT                   /locus_tag="mCG_1496"
FT                   /product="gamma-glutamyl hydrolase"
FT                   /note="gene_id=mCG1496.2 transcript_id=mCT7963.2 created on
FT                   31-JUL-2002"
FT   assembly_gap    16524204..16524267
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    16525270..16525834
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    16529512..16529531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16531917..16532046,16535751..16535857,
FT                   16535953..16536043,16541818..16541955,16543560..16543681)
FT                   /codon_start=1
FT                   /gene="Ggh"
FT                   /locus_tag="mCG_1496"
FT                   /product="gamma-glutamyl hydrolase"
FT                   /note="gene_id=mCG1496.2 transcript_id=mCT7963.2
FT                   protein_id=mCP22916.2"
FT                   /protein_id="EDL05569.1"
FT                   /translation="MEAIFPVWGTCLGFEELSVLVSGENLLTSTDTKSKKLPLNFTEGA
FT                   RKSRMFKHFPTELLDSLALENLTANFHKWSLSVKNFTENEKLKKFFNILTTNTDGKTEF
FT                   ISSMEGFKYPVYAVQWHPEKAAFEWKNLGGISHAPNAVKTSFYLAEFLVSEARKNSHHF
FT                   ENVVKETASLIYKVYPIYTGNISSFQQAYMFD"
FT   assembly_gap    16548270..16552344
FT                   /estimated_length=4075
FT                   /gap_type="unknown"
FT   assembly_gap    16561033..16561066
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(16589675..17245004)
FT                   /gene="E130310K16Rik"
FT                   /locus_tag="mCG_10984"
FT                   /note="gene_id=mCG10984.2"
FT   mRNA            complement(join(16589675..16590527,16625942..16626002,
FT                   16754019..16754216,16941956..16942036,16957450..16957587,
FT                   17244403..17245004))
FT                   /gene="E130310K16Rik"
FT                   /locus_tag="mCG_10984"
FT                   /product="RIKEN cDNA E130310K16, transcript variant
FT                   mCT178966"
FT                   /note="gene_id=mCG10984.2 transcript_id=mCT178966.0 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(16590514..16590527,16625942..16626002,
FT                   16754019..16754216,16941956..16942036,16957450..16957587,
FT                   17244403..17244456))
FT                   /codon_start=1
FT                   /gene="E130310K16Rik"
FT                   /locus_tag="mCG_10984"
FT                   /product="RIKEN cDNA E130310K16, isoform CRA_b"
FT                   /note="gene_id=mCG10984.2 transcript_id=mCT178966.0
FT                   protein_id=mCP101888.0 isoform=CRA_b"
FT                   /protein_id="EDL05567.1"
FT                   /translation="MGCCTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHII
FT                   VVILGLFGTIQYRPRYIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHR
FT                   SWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCVVDFQYLEVIHSAVQILLSLVGFVY
FT                   ACYVISISMEEEDTCRNK"
FT   assembly_gap    16593812..16593997
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    16612686..16613730
FT                   /estimated_length=1045
FT                   /gap_type="unknown"
FT   assembly_gap    16641016..16641035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16650466..16650555
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    16653615..16653634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16655311..16655330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16662461..16662680
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    16664100..16664206
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    16667510..16667572
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    16669857..16669912
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    16681980..16681999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16690885..16690904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16709595..16709614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(16713421..16714808,16754019..16754216,
FT                   16941956..16942036,16957450..16957587,17244403..17245004))
FT                   /gene="E130310K16Rik"
FT                   /locus_tag="mCG_10984"
FT                   /product="RIKEN cDNA E130310K16, transcript variant
FT                   mCT10908"
FT                   /note="gene_id=mCG10984.2 transcript_id=mCT10908.2 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(16714779..16714808,16754019..16754216,
FT                   16941956..16942036,16957450..16957587,17244403..17244456))
FT                   /codon_start=1
FT                   /gene="E130310K16Rik"
FT                   /locus_tag="mCG_10984"
FT                   /product="RIKEN cDNA E130310K16, isoform CRA_a"
FT                   /note="gene_id=mCG10984.2 transcript_id=mCT10908.2
FT                   protein_id=mCP16549.2 isoform=CRA_a"
FT                   /protein_id="EDL05566.1"
FT                   /translation="MGCCTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHII
FT                   VVILGLFGTIQYRPRYIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHR
FT                   SWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCVVDFQYLEVIHSAVQILLSVRRTKT
FT                   GLL"
FT   assembly_gap    16718613..16718632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16737909..16737928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16749863..16750057
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    16751411..16751595
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    16774409..16776621
FT                   /estimated_length=2213
FT                   /gap_type="unknown"
FT   assembly_gap    16779761..16779780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16781819..16781838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16798938..16798957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16804952..16805108
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    16807372..16807604
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            <16816392..16820490
FT                   /locus_tag="mCG_145027"
FT                   /note="gene_id=mCG145027.0"
FT   mRNA            join(<16816392..16816584,16817515..16817660,
FT                   16818609..16820490)
FT                   /locus_tag="mCG_145027"
FT                   /product="mCG145027"
FT                   /note="gene_id=mCG145027.0 transcript_id=mCT184451.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    16816626..16816645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <16818914..16819159
FT                   /codon_start=1
FT                   /locus_tag="mCG_145027"
FT                   /product="mCG145027"
FT                   /note="gene_id=mCG145027.0 transcript_id=mCT184451.0
FT                   protein_id=mCP105697.0"
FT                   /protein_id="EDL05568.1"
FT                   /translation="YGPSPFLVFSLFSFPLKQMVFMVLTASGERHSAIRNLPSFSFSVA
FT                   KCQYFQGKTGSLWHRQNMQAEDQSSFWTNMIMYLDF"
FT   assembly_gap    16821691..16821710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16827224..16827638
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    16830072..16833105
FT                   /estimated_length=3034
FT                   /gap_type="unknown"
FT   gene            16864022..16865322
FT                   /pseudo
FT                   /locus_tag="mCG_20278"
FT                   /note="gene_id=mCG20278.1"
FT   mRNA            16864022..16865322
FT                   /pseudo
FT                   /locus_tag="mCG_20278"
FT                   /note="gene_id=mCG20278.1 transcript_id=mCT19769.1 created
FT                   on 17-JAN-2003"
FT   assembly_gap    16866497..16866516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16873810..16874008
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    16894312..16898019
FT                   /estimated_length=3708
FT                   /gap_type="unknown"
FT   assembly_gap    16929875..16929894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17020141..17020160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17062728..17062747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17066518..17066539
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    17207966..17208017
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    17264462..17264481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17267168..17268336
FT                   /estimated_length=1169
FT                   /gap_type="unknown"
FT   assembly_gap    17269958..17270787
FT                   /estimated_length=830
FT                   /gap_type="unknown"
FT   assembly_gap    17275066..17277305
FT                   /estimated_length=2240
FT                   /gap_type="unknown"
FT   assembly_gap    17354812..17354831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17362418..17362437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17364483..17364502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17365941..17365960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17398109..17398128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17408002..17408021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17463802..17463902
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    17488745..17488764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17491094..17491147
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    17520136..17520155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17528370..17528389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17532567..17532776
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    17564673..17566079
FT                   /estimated_length=1407
FT                   /gap_type="unknown"
FT   assembly_gap    17566851..17567303
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    17574399..17574582
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    17590826..17591356
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    17609827..17609906
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    17626798..17626817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17635253..17635299
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    17642891..17643722
FT                   /estimated_length=832
FT                   /gap_type="unknown"
FT   assembly_gap    17649885..17650095
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    17665476..17675547
FT                   /estimated_length=10072
FT                   /gap_type="unknown"
FT   assembly_gap    17705500..17705546
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    17715861..17715885
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    17717206..17717225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17728456..17728475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17741255..17741274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17742618..17742637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17744461..17745370
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    17745963..17746365
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    17749123..17749498
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    17770599..17771620
FT                   /estimated_length=1022
FT                   /gap_type="unknown"
FT   assembly_gap    17773199..17773233
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    17775284..17775924
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    17778165..17778184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17796759..17796778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17809659..17809919
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    17821453..17821549
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    17825346..17826693
FT                   /estimated_length=1348
FT                   /gap_type="unknown"
FT   assembly_gap    17832393..17850174
FT                   /estimated_length=17782
FT                   /gap_type="unknown"
FT   assembly_gap    17931756..17938095
FT                   /estimated_length=6340
FT                   /gap_type="unknown"
FT   assembly_gap    17939342..17939802
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    17973591..17982439
FT                   /estimated_length=8849
FT                   /gap_type="unknown"
FT   assembly_gap    18032958..18032999
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    18043783..18044579
FT                   /estimated_length=797
FT                   /gap_type="unknown"
FT   assembly_gap    18059722..18059741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18070259..18070278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18073153..18073181
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    18079660..18081091
FT                   /estimated_length=1432
FT                   /gap_type="unknown"
FT   assembly_gap    18094822..18095744
FT                   /estimated_length=923
FT                   /gap_type="unknown"
FT   assembly_gap    18100629..18100648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18103405..18103424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18106304..18106323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18107620..18107639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18109142..18109469
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    18110207..18115054
FT                   /estimated_length=4848
FT                   /gap_type="unknown"
FT   assembly_gap    18125578..18125664
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   gene            complement(<18142562..>18150333)
FT                   /locus_tag="mCG_4142"
FT                   /note="gene_id=mCG4142.2"
FT   mRNA            complement(join(<18142562..18144303,18147776..18147896,
FT                   18148216..18148347,18149883..>18150333))
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, transcript variant mCT3155"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT3155.2 created on
FT                   29-JAN-2003"
FT   CDS             complement(join(18142562..18144303,18147776..18147896,
FT                   18148216..18148347,18149883..>18150332))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, isoform CRA_c"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT3155.2
FT                   protein_id=mCP11780.2 isoform=CRA_c partial"
FT                   /protein_id="EDL05565.1"
FT                   /translation="IQRPRLCRGLREPLHVTLSGGTLQLLHSATLSPNSAPLRSQCQKA
FT                   PARIEKAQCMPAHVTPRTEDARRGAGPSSACGCSWFCHLRPVEDPASPSVCLAAVATMH
FT                   GTSRTSATSVNADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESG
FT                   GSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
FT                   IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSGGGGRAFLPQEHAARP
FT                   GASPVAEGLGLPPKPTVPDLTAPVQAIALRPQAPAAQLAQACGARESIKREASLAPLAT
FT                   SPPPGKWGTPKKGKEQPDRAHSQFLGIVGGSSGGGGGLPFYPGVRSAFKPAGLARAAAQ
FT                   SDPYREEGGGKGPGLALGRLLGGGRAGGRPGSGESPAGHHHHHHHAHHHHHXXXXXXXX
FT                   PKCLLAGEPPPAGLPCPGALRAFPLLAGHPEEASAFKHVERAPPAAATTSLPSARYAAL
FT                   PAPGLPVERCALQPLDGGSLKAYPGGGGGGECSPLPAVMPAFTVYSGDLLYGPPAAYYP
FT                   LKLHLGGLLKYPESISYLSGPAAAAAAAAAAAAAAAAIGPAELGSLASIDREIAMHTQQ
FT                   LSEMAAGKSRARLDSGTLPPAVVAATGPGGGGGGGSAAGKPKTGHLCLYCGKLYSRKYG
FT                   LKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLE
FT                   RHVKSRHPGQSLMAKAGDGPGPEPSYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEH
FT                   DS"
FT   mRNA            complement(join(<18142562..18144303,18147776..18147896,
FT                   18149927..18150155))
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, transcript variant mCT179267"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT179267.0 created
FT                   on 29-JAN-2003"
FT   mRNA            complement(join(<18142562..18144303,18147776..18147896,
FT                   18148216..18148347,18149927..18150155))
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, transcript variant mCT179268"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT179268.0 created
FT                   on 30-JAN-2003"
FT   CDS             complement(join(18142562..18144303,18147776..18147896,
FT                   18148216..18148341))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, isoform CRA_b"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT179268.0
FT                   protein_id=mCP102190.0 isoform=CRA_b partial"
FT                   /protein_id="EDL05564.1"
FT                   /translation="MVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFY
FT                   RALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKA
FT                   HLRFHCVLSGGGGRAFLPQEHAARPGASPVAEGLGLPPKPTVPDLTAPVQAIALRPQAP
FT                   AAQLAQACGARESIKREASLAPLATSPPPGKWGTPKKGKEQPDRAHSQFLGIVGGSSGG
FT                   GGGLPFYPGVRSAFKPAGLARAAAQSDPYREEGGGKGPGLALGRLLGGGRAGGRPGSGE
FT                   SPAGHHHHHHHAHHHHHXXXXXXXXPKCLLAGEPPPAGLPCPGALRAFPLLAGHPEEAS
FT                   AFKHVERAPPAAATTSLPSARYAALPAPGLPVERCALQPLDGGSLKAYPGGGGGGECSP
FT                   LPAVMPAFTVYSGDLLYGPPAAYYPLKLHLGGLLKYPESISYLSGPAAAAAAAAAAAAA
FT                   AAAIGPAELGSLASIDREIAMHTQQLSEMAAGKSRARLDSGTLPPAVVAATGPGGGGGG
FT                   GSAAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIR
FT                   LHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLMAKAGDGPGPEPSYALEPGDPK
FT                   SEDSDVDVCFTDDQSDPEAGGRGEHDS"
FT   CDS             complement(18142562..18143341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4142"
FT                   /product="mCG4142, isoform CRA_a"
FT                   /note="gene_id=mCG4142.2 transcript_id=mCT179267.0
FT                   protein_id=mCP102189.0 isoform=CRA_a partial"
FT                   /protein_id="EDL05563.1"
FT                   /translation="MPAFTVYSGDLLYGPPAAYYPLKLHLGGLLKYPESISYLSGPAAA
FT                   AAAAAAAAAAAAAIGPAELGSLASIDREIAMHTQQLSEMAAGKSRARLDSGTLPPAVVA
FT                   ATGPGGGGGGGSAAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFG
FT                   DPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLMAKAGDGPGPEP
FT                   SYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEHDS"
FT   assembly_gap    18143635..18143654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18152152..18152171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18186206..18186611
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   gene            <18192098..18214942
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /note="gene_id=mCG4143.3"
FT   mRNA            join(<18192098..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18211972,18212533..18213614)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT189842"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT189842.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<18192099..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18211930)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_d"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT189842.0
FT                   protein_id=mCP110824.0 isoform=CRA_d"
FT                   /protein_id="EDL05560.1"
FT                   /translation="AQCCRPASRRRGCCSLPPAAVAVEFSPASLVGAQSSGLCLWSLRG
FT                   PLCWLVHLYQGKQYYSMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIF
FT                   FTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGV
FT                   VSNTRLIAATTSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQ
FT                   YVQDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAEL
FT                   SVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNRSSLSDSPLMAGPE
FT                   AAR"
FT   mRNA            join(18192101..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18212533..18214942)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT3153"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT3153.2 created on
FT                   06-JAN-2003"
FT   mRNA            join(18192101..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199864,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18212533..18214942)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT178427"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178427.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(18192101..18192313,18194795..18194901,
FT                   18196888..18196957,18199817..18199868,18204990..18205045,
FT                   18206351..18206386,18207009..18207100,18207643..18207710,
FT                   18210746..18210825,18211052..18211170,18212533..18214942)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT178425"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178425.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(18192101..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18212356)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT178426"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178426.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(<18192157..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199864,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18212339)
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, transcript variant mCT189841"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT189841.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(18192282..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18212533..18212587)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_e"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT3153.2
FT                   protein_id=mCP11786.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q62447"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR031658"
FT                   /db_xref="MGI:MGI:1858199"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62447"
FT                   /protein_id="EDL05561.1"
FT                   /translation="MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFT
FT                   NVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVS
FT                   NTRLIAATTSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYV
FT                   QDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSV
FT                   DMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYS
FT                   QS"
FT   CDS             join(18192282..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18211930)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_f"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178426.0
FT                   protein_id=mCP101348.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q8CAS3"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR031658"
FT                   /db_xref="MGI:MGI:1858199"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAS3"
FT                   /protein_id="EDL05562.1"
FT                   /translation="MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFT
FT                   NVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVS
FT                   NTRLIAATTSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYV
FT                   QDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSV
FT                   DMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNRSSLSDSPLMAGPEAA
FT                   R"
FT   CDS             join(18192282..18192313,18194795..18194901,
FT                   18196617..18196701,18196888..18196957,18199817..18199864,
FT                   18204990..18204992)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_b"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178427.0
FT                   protein_id=mCP101347.0 isoform=CRA_b"
FT                   /protein_id="EDL05558.1"
FT                   /translation="MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFT
FT                   NVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVS
FT                   NTRLIAATTS"
FT   CDS             join(<18196888..18196957,18199817..18199864,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18211879..18211930)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_c"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT189841.0
FT                   protein_id=mCP110823.0 isoform=CRA_c"
FT                   /protein_id="EDL05559.1"
FT                   /translation="VFSEKYRSCINGAYMCVSGIQSRGIWCCLKYKIDCCYYFLKTRFS
FT                   YAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIV
FT                   NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYE
FT                   QWKNFDERKEMATILSKMPKPKPPPNRSSLSDSPLMAGPEAAR"
FT   CDS             join(18196919..18196957,18199817..18199868,
FT                   18204990..18205045,18206351..18206386,18207009..18207100,
FT                   18207643..18207710,18210746..18210825,18211052..18211170,
FT                   18212533..18212587)
FT                   /codon_start=1
FT                   /gene="Ccnc"
FT                   /locus_tag="mCG_4143"
FT                   /product="cyclin C, isoform CRA_a"
FT                   /note="gene_id=mCG4143.3 transcript_id=mCT178425.0
FT                   protein_id=mCP101349.0 isoform=CRA_a"
FT                   /protein_id="EDL05557.1"
FT                   /translation="MAPTCVFLASKVEEFGVVSNTRLIAATTSVLKTRFSYAFPKEFPY
FT                   RMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIVNDTYRTDLC
FT                   LLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERK
FT                   EMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS"
FT   gene            complement(18221764..18231597)
FT                   /locus_tag="mCG_4140"
FT                   /note="gene_id=mCG4140.1"
FT   mRNA            complement(join(18221764..18222855,18223750..18223909,
FT                   18224003..18224173,18231431..18231597))
FT                   /locus_tag="mCG_4140"
FT                   /product="mCG4140"
FT                   /note="gene_id=mCG4140.1 transcript_id=mCT3159.1 created on
FT                   08-JAN-2003"
FT   CDS             complement(join(18222783..18222855,18223750..18223909,
FT                   18224003..18224173,18231431..18231500))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4140"
FT                   /product="mCG4140"
FT                   /note="gene_id=mCG4140.1 transcript_id=mCT3159.1
FT                   protein_id=mCP11790.2"
FT                   /protein_id="EDL05556.1"
FT                   /translation="MLARLVLGTSGRAALGSVEPALGGLKSIWRCSQAFCSTPKGVTYR
FT                   ELKSLLNSKDIMLIDVRNTWEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKP
FT                   SKSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEWVTYEISEEKQES"
FT   gene            18231536..18301943
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /note="gene_id=mCG4141.2"
FT   mRNA            join(18231536..18231625,18244723..18244832,
FT                   18246118..18246290,18246785..18246861,18247265..18247368,
FT                   18249059..18249159,18261158..18261300,18261667..18261762,
FT                   18262977..18263107,18268604..18268691,18275119..18275200,
FT                   18279684..18279775,18281259..18281315,18281878..18282021,
FT                   18288794..18289454,18290531..18290628,18294348..18294434,
FT                   18296095..18296248,18298366..18298502)
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, transcript
FT                   variant mCT176653"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT176653.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(18240642..18240698,18244723..18244832,
FT                   18246118..18246290,18247265..18247368,18249059..18249159,
FT                   18261158..18261300,18261667..18261762,18262977..18263107,
FT                   18268604..18268691,18275119..18275200,18279684..18279775,
FT                   18281259..18281315,18281878..18282021,18288794..18289454,
FT                   18290531..18290628,18294348..18294434,18296095..18296248,
FT                   18298366..18298702,18300705..18300865,18300948..18301943)
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, transcript
FT                   variant mCT3160"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT3160.2 created on
FT                   06-DEC-2002"
FT   mRNA            join(<18240668..18240698,18244723..18244832,
FT                   18246118..18246290,18247265..18247368,18249059..18249159,
FT                   18261158..18261300,18261667..18261762,18262977..18263107,
FT                   18268604..18268691,18275119..18275200,18279684..18279775,
FT                   18281259..18281315,18288794..18289454,18290531..18290628,
FT                   18294348..18294434,18296095..18296248,18298366..18298780)
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, transcript
FT                   variant mCT189839"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT189839.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<18244730..18244832,18246118..18246290,
FT                   18247265..18247368,18249059..18249159,18261158..18261300,
FT                   18261667..18261762,18262977..18263107,18268604..18268691,
FT                   18275119..18275200,18279684..18279775,18281259..18281315,
FT                   18288794..18289454,18290531..18290628,18294348..18294434,
FT                   18296095..18296248,18298366..18298496)
FT                   /codon_start=1
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, isoform CRA_b"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT189839.0
FT                   protein_id=mCP110822.0 isoform=CRA_b"
FT                   /protein_id="EDL05554.1"
FT                   /translation="QMRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAVGLTCQHVSYA
FT                   VSVNHVKKAVAESLWSVCSECLKERRFCDGQPVLPADVWLCLKCGLQGCGKNSESQHSL
FT                   RHFKSSGTESHCVVISLSTWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTGAF
FT                   SRIIKLCEEKREAGEIKKGKKGCTVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNE
FT                   IKEDGTKFKISLSSAPQLEPLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQL
FT                   CQKAPRFKGFQQQDSQELLHHLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVK
FT                   AYGKEGVKMNFIDRIFIGELTSTVMCEECANISTMKDPFIDISLPIIEERNQLSHDRKH
FT                   LRKWPSEEEKTVVTHPKNDNLEASPPASTLSTEASLNESLTDGSERDASLESSVDADSE
FT                   ASEPEIASKQPVLLRSRGDSCGHAEQHPHLPLASELPQAKETHGGEEEMAEAIAELHLS
FT                   GTVTGNRDFHREKQPLNVPNNLCFSEGKHTRLHSAQNAFQTLSQSYVTTSKECSVQSCL
FT                   YQFTSMELLMGNNKLLCEDCTEKRRKCHKETSSAEKKAGGVYTNARKQLLISAVPAILI
FT                   LHLKRFHQAGLSLRKVNRHVDFPLTLDLAPFCAATCKNISVGEKVLYGLYGIVEHSGSM
FT                   RGGHYTAYVKVRVPSRKLSECITGRKTAAGLKEPDGELGGHWVHVSDTYVQVVPESRAL
FT                   SAQAYLLFYERIL"
FT   CDS             join(18244733..18244832,18246118..18246290,
FT                   18247265..18247368,18249059..18249159,18261158..18261300,
FT                   18261667..18261762,18262977..18263107,18268604..18268691,
FT                   18275119..18275200,18279684..18279775,18281259..18281315,
FT                   18281878..18282021,18288794..18289454,18290531..18290628,
FT                   18294348..18294434,18296095..18296248,18298366..18298496)
FT                   /codon_start=1
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, isoform CRA_c"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT3160.2
FT                   protein_id=mCP11779.2 isoform=CRA_c"
FT                   /protein_id="EDL05555.1"
FT                   /translation="MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAVGLTCQHVSYAV
FT                   SVNHVKKAVAESLWSVCSECLKERRFCDGQPVLPADVWLCLKCGLQGCGKNSESQHSLR
FT                   HFKSSGTESHCVVISLSTWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTGAFS
FT                   RIIKLCEEKREAGEIKKGKKGCTVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNEI
FT                   KEDGTKFKISLSSAPQLEPLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQLC
FT                   QKAPRFKGFQQQDSQELLHHLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKA
FT                   YGKEGVKMNFIDRIFIGELTSTVMCEECANISTMKDPFIDISLPIIEERVSKPVLLGKM
FT                   SKCRSLQETDQDHNKGTVTVGNAHQPRASRKHSSPNDKNQLSHDRKHLRKWPSEEEKTV
FT                   VTHPKNDNLEASPPASTLSTEASLNESLTDGSERDASLESSVDADSEASEPEIASKQPV
FT                   LLRSRGDSCGHAEQHPHLPLASELPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHRE
FT                   KQPLNVPNNLCFSEGKHTRLHSAQNAFQTLSQSYVTTSKECSVQSCLYQFTSMELLMGN
FT                   NKLLCEDCTEKRRKCHKETSSAEKKAGGVYTNARKQLLISAVPAILILHLKRFHQAGLS
FT                   LRKVNRHVDFPLTLDLAPFCAATCKNISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVR
FT                   VPSRKLSECITGRKTAAGLKEPDGELGGHWVHVSDTYVQVVPESRALSAQAYLLFYERI
FT                   L"
FT   CDS             join(18246808..18246861,18247265..18247368,
FT                   18249059..18249159,18261158..18261300,18261667..18261762,
FT                   18262977..18263107,18268604..18268691,18275119..18275200,
FT                   18279684..18279775,18281259..18281315,18281878..18282021,
FT                   18288794..18289454,18290531..18290628,18294348..18294434,
FT                   18296095..18296248,18298366..18298496)
FT                   /codon_start=1
FT                   /gene="Usp45"
FT                   /locus_tag="mCG_4141"
FT                   /product="ubiquitin specific petidase 45, isoform CRA_a"
FT                   /note="gene_id=mCG4141.2 transcript_id=mCT176653.0
FT                   protein_id=mCP99575.0 isoform=CRA_a"
FT                   /protein_id="EDL05553.1"
FT                   /translation="MLQAVCVTQRLPKPSGRKGCGKNSESQHSLRHFKSSGTESHCVVI
FT                   SLSTWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTGAFSRIIKLCEEKREAGE
FT                   IKKGKKGCTVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNEIKEDGTKFKISLSSA
FT                   PQLEPLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQLCQKAPRFKGFQQQDS
FT                   QELLHHLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRI
FT                   FIGELTSTVMCEECANISTMKDPFIDISLPIIEERVSKPVLLGKMSKCRSLQETDQDHN
FT                   KGTVTVGNAHQPRASRKHSSPNDKNQLSHDRKHLRKWPSEEEKTVVTHPKNDNLEASPP
FT                   ASTLSTEASLNESLTDGSERDASLESSVDADSEASEPEIASKQPVLLRSRGDSCGHAEQ
FT                   HPHLPLASELPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHREKQPLNVPNNLCFSE
FT                   GKHTRLHSAQNAFQTLSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRRK
FT                   CHKETSSAEKKAGGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTL
FT                   DLAPFCAATCKNISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKLSECITGRK
FT                   TAAGLKEPDGELGGHWVHVSDTYVQVVPESRALSAQAYLLFYERIL"
FT   assembly_gap    18293296..18293315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18297808..18297980
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    18300866..18300947
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            complement(18311149..18312522)
FT                   /locus_tag="mCG_147147"
FT                   /note="gene_id=mCG147147.0"
FT   mRNA            complement(18311149..18312522)
FT                   /locus_tag="mCG_147147"
FT                   /product="mCG147147"
FT                   /note="gene_id=mCG147147.0 transcript_id=mCT187410.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(18311945..18312151)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147147"
FT                   /product="mCG147147"
FT                   /note="gene_id=mCG147147.0 transcript_id=mCT187410.0
FT                   protein_id=mCP108342.0"
FT                   /protein_id="EDL05552.1"
FT                   /translation="MLLLLHEQDKMAPGGSHPEVNDNNIRFSAEVTLILSQAYDHVILP
FT                   TGRVRAIFVEGKPNPPRVGPSCV"
FT   gene            18312119..18340548
FT                   /locus_tag="mCG_2929"
FT                   /note="gene_id=mCG2929.3"
FT   mRNA            join(18312119..18312211,18318419..18318517,
FT                   18321252..18321440,18323156..18323379,18324892..18325063,
FT                   18326059..18326249,18329949..18330086,18333588..18333687,
FT                   18334425..18334478,18335511..18335681,18337659..18340548)
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, transcript variant mCT2376"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT2376.3 created on
FT                   27-JUN-2003"
FT   mRNA            join(18312119..18312211,18318419..18318517,
FT                   18321252..18321440,18323156..18323379,18324892..18325063,
FT                   18326059..18326249,18329949..18330086,18333588..18333687,
FT                   18334425..18334478,18335511..18335681,18337659..18338745,
FT                   18338986..18340548)
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, transcript variant mCT186470"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT186470.0 created
FT                   on 27-JUN-2003"
FT   mRNA            join(18312119..18312211,18318419..18318517,
FT                   18321252..18321440,18323156..18323379,18324892..18325063,
FT                   18326059..18326249,18329949..18330086,18333588..18335415)
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, transcript variant mCT186471"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT186471.0 created
FT                   on 27-JUN-2003"
FT   CDS             join(18318430..18318517,18321252..18321440,
FT                   18323156..18323379,18324892..18325063,18326059..18326249,
FT                   18329949..18330086,18333588..18333687,18334425..18334478,
FT                   18335511..18335681,18337659..18338745,18338986..18339016)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, isoform CRA_c"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT186470.0
FT                   protein_id=mCP107175.0 isoform=CRA_c"
FT                   /protein_id="EDL05551.1"
FT                   /translation="MWDQGGQPWQQWPLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQR
FT                   EASGQQSIVEQPPGMMPNGQDMSAMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPP
FT                   PEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGGPPDNFAVGPVNQ
FT                   FDYQHGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPP
FT                   QIDAVKRRTLPAWIREGLEKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPR
FT                   LPQRSKFDSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQMMLLTKM
FT                   LLTEILLDVTDEEIYYVAKDAHRKATKAPAKQLAQSSALASLTGLGGLGGYGSGDSEDE
FT                   RSDRGSESSDTDDEELRHRIRQKQEAFWRKEKEQQLLQDKQIEEEKQQTERVTKEMNEF
FT                   IHREQNSLSLLEASEADGDAVNDKKRTPNEAPSVLEPKREHKGKEKERGSRSGSSSSGS
FT                   SSSGSRTSSSSSSVSSSSYSSSSGSSCTSSRSSSPKRRKRPSRSRSPPAKARRSRSRSY
FT                   SRRVKVDSSRTRGKLRDRRRSNRSSIERERRRNRSPSRDRRRSRSRSRDRRTNRSSRSR
FT                   SRDRRKIEDPRGNLSGNSHKHKGEAKEQDRKKERSRSVDKDRRKKDKERDRELDKRKEK
FT                   QKREEKDFKFSSQDDRLKRKRESERTFCRSGSISVKVIRHDSRQDSKKNATKDSKRHSG
FT                   SDSSGRSSSESPGSSKEKKAKKPKHSRSRSLEKSQRSGKKASRKHKSKSRSRSTTPPRR
FT                   KR"
FT   CDS             join(18318430..18318517,18321252..18321440,
FT                   18323156..18323379,18324892..18325063,18326059..18326249,
FT                   18329949..18330086,18333588..18333687,18334425..18334478,
FT                   18335511..18335681,18337659..18338749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, isoform CRA_b"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT2376.3
FT                   protein_id=mCP11782.2 isoform=CRA_b"
FT                   /protein_id="EDL05550.1"
FT                   /translation="MWDQGGQPWQQWPLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQR
FT                   EASGQQSIVEQPPGMMPNGQDMSAMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPP
FT                   PEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGGPPDNFAVGPVNQ
FT                   FDYQHGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPP
FT                   QIDAVKRRTLPAWIREGLEKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPR
FT                   LPQRSKFDSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQMMLLTKM
FT                   LLTEILLDVTDEEIYYVAKDAHRKATKAPAKQLAQSSALASLTGLGGLGGYGSGDSEDE
FT                   RSDRGSESSDTDDEELRHRIRQKQEAFWRKEKEQQLLQDKQIEEEKQQTERVTKEMNEF
FT                   IHREQNSLSLLEASEADGDAVNDKKRTPNEAPSVLEPKREHKGKEKERGSRSGSSSSGS
FT                   SSSGSRTSSSSSSVSSSSYSSSSGSSCTSSRSSSPKRRKRPSRSRSPPAKARRSRSRSY
FT                   SRRVKVDSSRTRGKLRDRRRSNRSSIERERRRNRSPSRDRRRSRSRSRDRRTNRSSRSR
FT                   SRDRRKIEDPRGNLSGNSHKHKGEAKEQDRKKERSRSVDKDRRKKDKERDRELDKRKEK
FT                   QKREEKDFKFSSQDDRLKRKRESERTFCRSGSISVKVIRHDSRQDSKKNATKDSKRHSG
FT                   SDSSGRSSSESPGSSKEKKAKKPKHSRSRSLEKSQRSGKKASRKHKSKSRSR"
FT   CDS             join(18318430..18318517,18321252..18321440,
FT                   18323156..18323379,18324892..18325063,18326059..18326249,
FT                   18329949..18330086,18333588..18333707)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2929"
FT                   /product="mCG2929, isoform CRA_a"
FT                   /note="gene_id=mCG2929.3 transcript_id=mCT186471.0
FT                   protein_id=mCP107174.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR031937"
FT                   /db_xref="MGI:MGI:1913875"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJT3"
FT                   /protein_id="EDL05549.1"
FT                   /translation="MWDQGGQPWQQWPLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQR
FT                   EASGQQSIVEQPPGMMPNGQDMSAMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPP
FT                   PEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGGPPDNFAVGPVNQ
FT                   FDYQHGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPP
FT                   QIDAVKRRTLPAWIREGLEKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPR
FT                   LPQRSKFDSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQMMLLTKM
FT                   LLTEILLDVTDEEIYYVAKDAHRKATKGTLWVL"
FT   gene            18343750..18376029
FT                   /gene="Coq3"
FT                   /locus_tag="mCG_2931"
FT                   /note="gene_id=mCG2931.2"
FT   mRNA            join(18343750..18343871,18356829..18356955,
FT                   18360584..18360736,18362983..18363082,18364189..18364431,
FT                   18372353..18372512,18374289..18376029)
FT                   /gene="Coq3"
FT                   /locus_tag="mCG_2931"
FT                   /product="coenzyme Q3 homolog, methyltransferase (yeast)"
FT                   /note="gene_id=mCG2931.2 transcript_id=mCT2373.2 created on
FT                   21-JAN-2003"
FT   CDS             join(18343763..18343871,18356829..18356955,
FT                   18360584..18360736,18362983..18363082,18364189..18364431,
FT                   18372353..18372512,18374289..18374509)
FT                   /codon_start=1
FT                   /gene="Coq3"
FT                   /locus_tag="mCG_2931"
FT                   /product="coenzyme Q3 homolog, methyltransferase (yeast)"
FT                   /note="gene_id=mCG2931.2 transcript_id=mCT2373.2
FT                   protein_id=mCP11784.0"
FT                   /protein_id="EDL05548.1"
FT                   /translation="MWRGGRLGSRGVRLLETLGFGCPSAVAQPPRLTSRSAYSGTQLTR
FT                   NLQIKPWELGEHGTMCFRSYRMALSCLSRVKTYRTPWKRLYSTSQTTVDSREVKNFQAL
FT                   AHTWWDEYGKFAPLHSMNDLRVPFIRDNLLKTSASHHPGKPLSGMKILDVGCGGGLLTE
FT                   PLGRLGASVVGIDPVAENIKIAQHHKSFDPVLDKRIQYKVCSLEEAVDESAECFDAVVA
FT                   SEVVEHVSHLEMFIQCCYQVLKPGGSLFITTVNKTQLSYALGIVFAEQIAGIVPKGTHT
FT                   WEKFVSPEKLESILEPNGLSVETVAGLVYNPFSGYWHWSENTSLNYAAHAVRSRAQEHQ
FT                   EPAESALKGETGALHANTSGSPSVREEQRT"
FT   assembly_gap    18352697..18352718
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    18359250..18359855
FT                   /estimated_length=606
FT                   /gap_type="unknown"
FT   assembly_gap    18362564..18362583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18371045..18371161
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    18389713..18403537
FT                   /estimated_length=13825
FT                   /gap_type="unknown"
FT   gene            <18403538..18466498
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /note="gene_id=mCG2927.2"
FT   mRNA            join(18403538..18404006,18408820..18408955,
FT                   18420614..18420810,18430366..18430589,18454218..18454334,
FT                   18465111..18466498)
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, transcript variant
FT                   mCT2377"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT2377.2 created on
FT                   08-JAN-2003"
FT   mRNA            join(18403538..18404006,18408820..18408955,
FT                   18420614..18420810,18454218..18454334,18465111..18466498)
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, transcript variant
FT                   mCT178424"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT178424.0 created
FT                   on 08-JAN-2003"
FT   mRNA            join(<18403538..18404006,18408820..18408955,
FT                   18454218..18454334,18465111..18465971)
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, transcript variant
FT                   mCT189834"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT189834.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<18403657..18404006,18408820..18408955,
FT                   18454218..18454328)
FT                   /codon_start=1
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, isoform CRA_b"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT189834.0
FT                   protein_id=mCP110820.0 isoform=CRA_b"
FT                   /protein_id="EDL05546.1"
FT                   /translation="TRPLARAPASSHAGGAGPGRGARSQPRSMHWGVGFASSRPCVVDL
FT                   SWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLTGGALLA
FT                   AAAYLLHELLVIRKQQELDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQV
FT                   TRSTSWDPSFPLLMPLSLDTWHRRCGPYQGQDRSG"
FT   CDS             join(18403741..18404006,18408820..18408955,
FT                   18420614..18420810,18430366..18430589,18454218..18454334,
FT                   18465111..18465400)
FT                   /codon_start=1
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, isoform CRA_c"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT2377.2
FT                   protein_id=mCP11778.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UMF9"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR033468"
FT                   /db_xref="MGI:MGI:1923382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UMF9"
FT                   /protein_id="EDL05547.1"
FT                   /translation="MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAF
FT                   PLQDYGGIMAGLGSDPWWKKTLYLTGGALLAAAAYLLHELLVIRKQQELDSKDAIILHQ
FT                   FARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIEYNNEKVSGTEFI
FT                   IDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSG
FT                   GGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIM
FT                   GPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDN
FT                   TIYESEESSEGSKTHTPMLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVEM
FT                   DDYTDHEQCK"
FT   CDS             join(18403741..18404006,18408820..18408955,
FT                   18420614..18420810,18454218..18454221)
FT                   /codon_start=1
FT                   /gene="6230409E13Rik"
FT                   /locus_tag="mCG_2927"
FT                   /product="RIKEN cDNA 6230409E13, isoform CRA_a"
FT                   /note="gene_id=mCG2927.2 transcript_id=mCT178424.0
FT                   protein_id=mCP101346.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BHV1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="MGI:MGI:1923382"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BHV1"
FT                   /protein_id="EDL05545.1"
FT                   /translation="MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAF
FT                   PLQDYGGIMAGLGSDPWWKKTLYLTGGALLAAAAYLLHELLVIRKQQELDSKDAIILHQ
FT                   FARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIEYNNEKVSGTEFI
FT                   IDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYW"
FT   assembly_gap    18411695..18412214
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    18435416..18435771
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    18451025..18451168
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    18455116..18455823
FT                   /estimated_length=708
FT                   /gap_type="unknown"
FT   assembly_gap    18476132..18476151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18508847..18508925
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    18549811..18550236
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    18587919..18587938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18593345..18593794
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    18611111..18611872
FT                   /estimated_length=762
FT                   /gap_type="unknown"
FT   assembly_gap    18672629..18672738
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    18692783..18693364
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    18732329..18733488
FT                   /estimated_length=1160
FT                   /gap_type="unknown"
FT   assembly_gap    18735274..18735293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18748287..18748781
FT                   /pseudo
FT                   /locus_tag="mCG_1042990"
FT                   /note="gene_id=mCG1042990.1"
FT   mRNA            18748287..18748781
FT                   /pseudo
FT                   /locus_tag="mCG_1042990"
FT                   /note="gene_id=mCG1042990.1 transcript_id=mCT160694.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    18749935..18749954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18751092..18751864
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    18760465..18760592
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    18782628..18782647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18798419..18798438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18831247..18907619
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /note="gene_id=mCG2930.2"
FT   mRNA            join(18831247..18831369,18849180..18849289,
FT                   18850015..18850596,18859425..18859770,18864199..18864443,
FT                   18877052..18877265,18896245..18897455,18900674..18900986,
FT                   18907095..18907619)
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4,
FT                   transcript variant mCT178980"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT178980.0 created
FT                   on 21-JAN-2003"
FT   mRNA            join(18831247..18831369,18849180..18849289,
FT                   18850015..18850596,18859425..18859770,18864199..18864443,
FT                   18877052..18877265,18896245..18896316,18900674..18900986,
FT                   18907095..18907619)
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4,
FT                   transcript variant mCT2372"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT2372.2 created on
FT                   21-JAN-2003"
FT   mRNA            join(18831247..18831369,18849180..18849289,
FT                   18850015..18850596,18859425..18859770,18864236..18864443,
FT                   18877052..18877265,18896245..18896316,18900674..18900986,
FT                   18907095..18907619)
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4,
FT                   transcript variant mCT178981"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT178981.0 created
FT                   on 21-JAN-2003"
FT   mRNA            join(18831304..18831369,18849180..18849289,
FT                   18850015..18850596,18859425..18859770,18864199..18864443,
FT                   18877052..18877265,18896245..18896316,18900674..18900986,
FT                   18906674..18906786,18907095..18907594)
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4,
FT                   transcript variant mCT189826"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT189826.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    18845311..18846253
FT                   /estimated_length=943
FT                   /gap_type="unknown"
FT   CDS             join(18850085..18850596,18859425..18859770,
FT                   18864199..18864443,18877052..18877265,18896245..18896316,
FT                   18900674..18900986,18907095..18907258)
FT                   /codon_start=1
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT2372.2
FT                   protein_id=mCP11783.2 isoform=CRA_d"
FT                   /protein_id="EDL05544.1"
FT                   /translation="MSPVFPMLTVLTMFYYMCLRRRARTATRGDMMNSHRTIVSNSRTS
FT                   PLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWW
FT                   DQCPSASLPFRRTPSSFQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYS
FT                   PNPPAEVRWEILWSERPMKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDA
FT                   VVLHGTKDKPLLSLKTALVDMNDLEDDDYEEKDGCEMDALNKKFSSAALGDGPHNGYFD
FT                   KLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQPYWARLDDTSLEFL
FT                   QARCVLVQWLNLSWTGNRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCLEVISEM
FT                   CPNLQDLNLSSCDKLPPQAFGHIAKLCSLKRLVLYRTKVEQTALLSILNFCAELQHLSL
FT                   GSCVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELDLGWCPT
FT                   LQSSTGCFVRLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVSPAS
FT                   LRKLLESCKDLSLLDVSFCSQIDNKAVLELNASFPKVFIKKSFTQ"
FT   CDS             join(18850085..18850596,18859425..18859770,
FT                   18864199..18864443,18877052..18877265,18896245..18896316,
FT                   18900674..18900986,18906674..18906720)
FT                   /codon_start=1
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT189826.0
FT                   protein_id=mCP110821.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2140367"
FT                   /db_xref="UniProtKB/TrEMBL:V9GXH8"
FT                   /protein_id="EDL05542.1"
FT                   /translation="MSPVFPMLTVLTMFYYMCLRRRARTATRGDMMNSHRTIVSNSRTS
FT                   PLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWW
FT                   DQCPSASLPFRRTPSSFQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYS
FT                   PNPPAEVRWEILWSERPMKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDA
FT                   VVLHGTKDKPLLSLKTALVDMNDLEDDDYEEKDGCEMDALNKKFSSAALGDGPHNGYFD
FT                   KLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQPYWARLDDTSLEFL
FT                   QARCVLVQWLNLSWTGNRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCLEVISEM
FT                   CPNLQDLNLSSCDKLPPQAFGHIAKLCSLKRLVLYRTKVEQTALLSILNFCAELQHLSL
FT                   GSCVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELDLGWCPT
FT                   LQSSTGCFVRLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGLKQVFKTV
FT                   RIVAPL"
FT   CDS             join(18850085..18850596,18859425..18859770,
FT                   18864199..18864443,18877052..18877265,18896245..18896328)
FT                   /codon_start=1
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT178980.0
FT                   protein_id=mCP101902.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2140367"
FT                   /db_xref="UniProtKB/TrEMBL:V9GWT8"
FT                   /protein_id="EDL05543.1"
FT                   /translation="MSPVFPMLTVLTMFYYMCLRRRARTATRGDMMNSHRTIVSNSRTS
FT                   PLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWW
FT                   DQCPSASLPFRRTPSSFQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYS
FT                   PNPPAEVRWEILWSERPMKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDA
FT                   VVLHGTKDKPLLSLKTALVDMNDLEDDDYEEKDGCEMDALNKKFSSAALGDGPHNGYFD
FT                   KLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQPYWARLDDTSLEFL
FT                   QARCVLVQWLNLSWTGNRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCLEVISEM
FT                   CPNLQDLNLSSCDKLPPQAFGHIAKLCSLKRLVLYRTKVEQTALLSILNFCAELQHLSL
FT                   GSCVMVST"
FT   CDS             join(18850085..18850596,18859425..18859770,
FT                   18864236..18864250)
FT                   /codon_start=1
FT                   /gene="Fbxl4"
FT                   /locus_tag="mCG_2930"
FT                   /product="F-box and leucine-rich repeat protein 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2930.2 transcript_id=mCT178981.0
FT                   protein_id=mCP101903.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:2140367"
FT                   /db_xref="UniProtKB/TrEMBL:V9GWU9"
FT                   /protein_id="EDL05541.1"
FT                   /translation="MSPVFPMLTVLTMFYYMCLRRRARTATRGDMMNSHRTIVSNSRTS
FT                   PLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWW
FT                   DQCPSASLPFRRTPSSFQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYS
FT                   PNPPAEVRWEILWSERPMKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDA
FT                   VVLHGTKDKPLLSLKTALVDMNDLEDDDYEEKDGCEMDALNKKFSSAALGDGPHNGYFD
FT                   KLPYETCVD"
FT   assembly_gap    18928801..18928896
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    18939037..18939140
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    18947658..18947722
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    18951057..18951322
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    18959953..18960161
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(18960356..>18961429)
FT                   /gene="Pou3f2"
FT                   /locus_tag="mCG_2933"
FT                   /note="gene_id=mCG2933.2"
FT   mRNA            complement(18960356..>18961429)
FT                   /gene="Pou3f2"
FT                   /locus_tag="mCG_2933"
FT                   /product="POU domain, class 3, transcription factor 2"
FT                   /note="gene_id=mCG2933.2 transcript_id=mCT2375.2 created on
FT                   31-JUL-2002"
FT   CDS             complement(18960490..>18961428)
FT                   /codon_start=1
FT                   /gene="Pou3f2"
FT                   /locus_tag="mCG_2933"
FT                   /product="POU domain, class 3, transcription factor 2"
FT                   /note="gene_id=mCG2933.2 transcript_id=mCT2375.2
FT                   protein_id=mCP11777.1"
FT                   /protein_id="EDL05540.1"
FT                   /translation="QQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAH
FT                   LPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHP
FT                   HQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLA
FT                   LGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGR
FT                   KRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRM
FT                   TPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ"
FT   assembly_gap    18961430..18962521
FT                   /estimated_length=1092
FT                   /gap_type="unknown"
FT   assembly_gap    18965137..18965156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18966332..18966424
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    18972188..18976524
FT                   /estimated_length=4337
FT                   /gap_type="unknown"
FT   gene            18992842..18993367
FT                   /pseudo
FT                   /locus_tag="mCG_2932"
FT                   /note="gene_id=mCG2932.1"
FT   mRNA            18992842..18993367
FT                   /pseudo
FT                   /locus_tag="mCG_2932"
FT                   /note="gene_id=mCG2932.1 transcript_id=mCT2374.1 created on
FT                   29-JAN-2003"
FT   gene            complement(19001730..19002279)
FT                   /pseudo
FT                   /locus_tag="mCG_1042988"
FT                   /note="gene_id=mCG1042988.1"
FT   mRNA            complement(19001730..19002279)
FT                   /pseudo
FT                   /locus_tag="mCG_1042988"
FT                   /note="gene_id=mCG1042988.1 transcript_id=mCT160692.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    19009235..19009254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19044360..19044379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19047747..19047849
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    19074625..19075189
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    19078899..19079028
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    19086548..19086567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19099595..19100065
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   assembly_gap    19130174..19130193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19173386..19173405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19187177..19187196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19211849..19211868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19212939..19212958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19263401..19263420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19271411..19271430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19275441..19275460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19288074..19288316
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    19291892..19292648
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    19294931..19295239
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    19313801..19313820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19319571..19319742
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    19326277..19326863
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    19388093..19388993
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    19402665..19402877
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            complement(<19409997..19420265)
FT                   /locus_tag="mCG_147154"
FT                   /note="gene_id=mCG147154.0"
FT   mRNA            complement(join(<19409997..19410141,19419956..19420265))
FT                   /locus_tag="mCG_147154"
FT                   /product="mCG147154"
FT                   /note="gene_id=mCG147154.0 transcript_id=mCT187417.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<19409997..19410141,19419956..19420146))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147154"
FT                   /product="mCG147154"
FT                   /note="gene_id=mCG147154.0 transcript_id=mCT187417.0
FT                   protein_id=mCP108349.0"
FT                   /db_xref="GOA:Q9CVV8"
FT                   /db_xref="MGI:MGI:1917234"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CVV8"
FT                   /protein_id="EDL05539.1"
FT                   /translation="MSLTFPASISMSQINNYYFGMIGFFHFYVCTIVSTRNTGYVGTGC
FT                   GTNVGLKLTTVLLPQPSECESLKVPCGPEVCAAWITAEMCISIQRDKGVGFYSQAFCYL
FT                   NKVIGCLM"
FT   assembly_gap    19430367..19430512
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    19459230..19459309
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    19464778..19464797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19484377..19484396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19486239..19486258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19487408..19487427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19504844..19504995
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    19517737..19517974
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    19532937..19532956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19554785..19555502
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    19558007..19558026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19573150..19579163
FT                   /estimated_length=6014
FT                   /gap_type="unknown"
FT   assembly_gap    19585464..19590013
FT                   /estimated_length=4550
FT                   /gap_type="unknown"
FT   assembly_gap    19605136..19605155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19613794..19614510
FT                   /estimated_length=717
FT                   /gap_type="unknown"
FT   assembly_gap    19615661..19615944
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    19616817..19617400
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    19618656..19618727
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    19631501..19631534
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    19658310..19658390
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    19674533..19676334
FT                   /estimated_length=1802
FT                   /gap_type="unknown"
FT   assembly_gap    19677433..19677956
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    19695630..19695873
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    19713183..19713569
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    19731529..19731560
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    19745481..19745594
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    19757939..19759016
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    19803175..19803194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19837675..19837694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19839497..19839516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19841152..19841171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19845035..19845054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19847914..19848324
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    19871838..19871931
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    19881013..19881032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19904584..19904654
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    19906034..19906077
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    19909093..19911411
FT                   /estimated_length=2319
FT                   /gap_type="unknown"
FT   assembly_gap    19932334..19932353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19956029..19956769
FT                   /pseudo
FT                   /locus_tag="mCG_119927"
FT                   /note="gene_id=mCG119927.1"
FT   mRNA            19956029..19956769
FT                   /pseudo
FT                   /locus_tag="mCG_119927"
FT                   /note="gene_id=mCG119927.1 transcript_id=mCT121105.1
FT                   created on 30-JAN-2003"
FT   assembly_gap    19968579..19968687
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(19987481..19990281)
FT                   /pseudo
FT                   /locus_tag="mCG_5737"
FT                   /note="gene_id=mCG5737.2"
FT   mRNA            complement(join(19987481..19989228,19989851..19990018,
FT                   19990111..19990281))
FT                   /pseudo
FT                   /locus_tag="mCG_5737"
FT                   /note="gene_id=mCG5737.2 transcript_id=mCT5148.2 created on
FT                   29-JAN-2003"
FT   assembly_gap    19990038..19990108
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    20028513..20028532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20032966..20033166
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    20061625..20061644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20076327..20076346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20087661..20087786
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    20117474..20124118
FT                   /estimated_length=6645
FT                   /gap_type="unknown"
FT   assembly_gap    20145464..20145483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20146542..20147057
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    20156556..20156575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20167947..20167966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20190916..20191059
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    20195157..20195184
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    20347160..20347179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20353562..20353622
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    20354872..20355208
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    20373774..20373793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20417845..20417864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20421844..20421952
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    20424949..20424968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20435070..20435379
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    20448532..20448551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20461024..20461043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20467168..20467187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20468470..20468555
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    20472924..20473044
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    20485351..20485430
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    20497253..20497832
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    20500793..20500812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20501882..20501901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20535774..20536002
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    20543641..20543660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20559060..20559771
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    20560959..20562320
FT                   /estimated_length=1362
FT                   /gap_type="unknown"
FT   assembly_gap    20563162..20563181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20574182..20574373
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    20579453..20579472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20580574..20580593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20591322..20591603
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    20592678..20592697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20612172..20612191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20630300..20630319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20631147..20631490
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    20679295..20679314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            20700978..20702185
FT                   /pseudo
FT                   /locus_tag="mCG_8957"
FT                   /note="gene_id=mCG8957.2"
FT   mRNA            20700978..20702185
FT                   /pseudo
FT                   /locus_tag="mCG_8957"
FT                   /note="gene_id=mCG8957.2 transcript_id=mCT8900.2 created on
FT                   29-JAN-2003"
FT   assembly_gap    20737902..20738680
FT                   /estimated_length=779
FT                   /gap_type="unknown"
FT   assembly_gap    20748133..20750471
FT                   /estimated_length=2339
FT                   /gap_type="unknown"
FT   assembly_gap    20751715..20752435
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    20753506..20753525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20756278..20763923
FT                   /estimated_length=7646
FT                   /gap_type="unknown"
FT   assembly_gap    20767442..20768287
FT                   /estimated_length=846
FT                   /gap_type="unknown"
FT   assembly_gap    20796613..20796737
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    20830256..20830882
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    20846586..20846627
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    20868380..20868510
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    20871518..20871537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20911040..20911059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20921125..20921261
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    20923602..20923621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20925157..20925176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20926327..20926346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20930030..20932935
FT                   /estimated_length=2906
FT                   /gap_type="unknown"
FT   assembly_gap    20935524..20935543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20937494..20937513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20939185..20939204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20940249..20940268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20949722..20950540
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   gene            20952226..20959180
FT                   /locus_tag="mCG_113554"
FT                   /note="gene_id=mCG113554.1"
FT   mRNA            join(20952226..20952840,20953613..20953738,
FT                   20955812..20955861,20958517..20958604,20958701..20959180)
FT                   /locus_tag="mCG_113554"
FT                   /product="mCG113554"
FT                   /note="gene_id=mCG113554.1 transcript_id=mCT114638.1
FT                   created on 29-JAN-2003"
FT   CDS             join(20952683..20952840,20953613..20953738,
FT                   20955812..20955861,20958517..20958604,20958701..20958887)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113554"
FT                   /product="mCG113554"
FT                   /note="gene_id=mCG113554.1 transcript_id=mCT114638.1
FT                   protein_id=mCP67723.1"
FT                   /db_xref="InterPro:IPR029425"
FT                   /db_xref="MGI:MGI:2684980"
FT                   /db_xref="UniProtKB/TrEMBL:G5E925"
FT                   /protein_id="EDL05538.1"
FT                   /translation="MDGCSAASTFLTDSLELELGTEWCKPPCFSCAFDNREGKFSGESY
FT                   LASGALKRLILNLDPLPTNFEEDTVELFGFQWVTETALVYSCRELFHLFRQQIFNLESL
FT                   VQVSCDFGKIATLHAKADSIRQQCVVFLHYIKVFIFRCLKVQEAESHSRPAHPYEALEA
FT                   QLPSMLVDELRGLLLYIGHLAALPSVTVGAFVNQNQMKV"
FT   gene            20964157..21055717
FT                   /gene="F730047E07Rik"
FT                   /locus_tag="mCG_8961"
FT                   /note="gene_id=mCG8961.2"
FT   mRNA            join(20964157..20964279,20972820..20972996,
FT                   20977001..20977063,20984805..20984924,20988665..20988891,
FT                   20991683..20992192,21030101..21030294,21034474..21034624,
FT                   21035775..21035923,21036823..21036965,21041908..21042067,
FT                   21043928..21044097,21051864..21052027,21054519..21055717)
FT                   /gene="F730047E07Rik"
FT                   /locus_tag="mCG_8961"
FT                   /product="RIKEN cDNA F730047E07"
FT                   /note="gene_id=mCG8961.2 transcript_id=mCT8904.2 created on
FT                   21-JAN-2003"
FT   CDS             join(20964169..20964279,20972820..20972996,
FT                   20977001..20977063,20984805..20984924,20988665..20988891,
FT                   20991683..20992192,21030101..21030294,21034474..21034624,
FT                   21035775..21035923,21036823..21036965,21041908..21042067,
FT                   21043928..21044097,21051864..21051878)
FT                   /codon_start=1
FT                   /gene="F730047E07Rik"
FT                   /locus_tag="mCG_8961"
FT                   /product="RIKEN cDNA F730047E07"
FT                   /note="gene_id=mCG8961.2 transcript_id=mCT8904.2
FT                   protein_id=mCP20508.2"
FT                   /protein_id="EDL05537.1"
FT                   /translation="MPSEALLISHCPCSCVKELWVLLIHLLDHRRKWSVADSFWNWLNK
FT                   LLRTLFEKSSDQRRSSVSLTQAKDPLGFSWWISVHVASLYQIDRHGVSDKMKQMESNWS
FT                   FIEELLKRSVTVQDSILEEQLRMHLHCCLTLCDFWEPNISVVTILWEYYSKNLNSSFSI
FT                   SWLPLKGLTNIIKSPLSMLTLVRNCCSDKQDPDLYKSSSSYIIFLCILAKVVKKAMRTS
FT                   GPHPWKQVKGRIYSKFHQKRMEELTEVGLQNFFSLFLLLAAVAEIEDVASHVLDLLRFL
FT                   RPASMSSHGALVWKGQMAFLLMYAQKNLDIGVWAEKLSCEFQEKAKEFLVSKNDEMVQR
FT                   HALWTLLCIYIDGVQEVFETSSCLYPSHEHLLNDGFSMLLPACRESELRTVLNFLQAVL
FT                   ARIRSVHQQLCQELQRENVDLTVQSSLSAKERPLAAVAGALWRHFFSFLKSQRMTQVVP
FT                   LSQLADAAADFTLLAVDMPNTAPPDLQPQPVISIIQLFGWDDIIWPQVVARYLSHLLQN
FT                   STVYEALSQSSCVSSQSLTIRSWVRCVLQMHIKHLSDPDLLIDVNPEQAVEKEYMEQLA
FT                   EMTRLLFTLSEVKSVFSKAQIEQLPSPDDPKQALIQFLEAVGVTYRTLQTFSDKSAMVT
FT                   KSLEYLGEVLKYIKPYLGKKVSSAGLQLTYGIMGILVKSWAHIFATSKAQKLLFRIIDC
FT                   LLLPHTVLQQDKELPGPMLTAIQKTLPLYLQEILP"
FT   gene            complement(21072993..21201390)
FT                   /locus_tag="mCG_113552"
FT                   /note="gene_id=mCG113552.1"
FT   mRNA            complement(join(21072993..21073269,21082618..21082712,
FT                   21085533..21085725,21089035..21089093,21105870..21106596,
FT                   21138537..21138752,21168822..21168920,21201283..21201390))
FT                   /locus_tag="mCG_113552"
FT                   /product="mCG113552, transcript variant mCT114567"
FT                   /note="gene_id=mCG113552.1 transcript_id=mCT114567.1
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(21072993..21073269,21082618..21082712,
FT                   21085533..21085725,21089035..21089093,21105870..21106596,
FT                   21131515..21131791))
FT                   /locus_tag="mCG_113552"
FT                   /product="mCG113552, transcript variant mCT114636"
FT                   /note="gene_id=mCG113552.1 transcript_id=mCT114636.1
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(21073108..21073269,21082618..21082712,
FT                   21085533..21085725,21089035..21089093,21105870..21106596,
FT                   21138537..21138752,21168822..21168920,21201283..21201387))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113552"
FT                   /product="mCG113552, isoform CRA_a"
FT                   /note="gene_id=mCG113552.1 transcript_id=mCT114567.1
FT                   protein_id=mCP67735.1 isoform=CRA_a"
FT                   /protein_id="EDL05535.1"
FT                   /translation="MFSLCMVESGADEVNLRGVTSLGLKQALEFAYTGQILLEPGVIQD
FT                   VLAAGSHLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFHLTLLEKAVIDFLVKHLSE
FT                   LLKSRPEDVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQHLDELLQYIR
FT                   FGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTL
FT                   YIIGGKKREVCKVKELRYFNPVDQENALIAAIANWSELAPMPVGRSHHCVAVMGDFLFV
FT                   AGGEVEHASGRTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMDEYLYAVGGRNEL
FT                   CQVLPTVERYCPKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYE
FT                   PNQNKWISRSPMLQRRVYHSMAAVQRKLYVLGGNDLDYNNDRILVRHIDSYNIDTDQWT
FT                   RCNFNLLTGQNESGVAVHNGRIYLVGGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLP
FT                   FASNGIAACFLPAPYFTCPNLQTLQVPHHRIGTV"
FT   CDS             complement(join(21073108..21073269,21082618..21082712,
FT                   21085533..21085725,21089035..21089093,21105870..21106518))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113552"
FT                   /product="mCG113552, isoform CRA_b"
FT                   /note="gene_id=mCG113552.1 transcript_id=mCT114636.1
FT                   protein_id=mCP67705.1 isoform=CRA_b"
FT                   /protein_id="EDL05536.1"
FT                   /translation="MDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTR
FT                   RTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENALIAAIANWSELAPMPVGRSHH
FT                   CVAVMGDFLFVAGGEVEHASGRTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMDE
FT                   YLYAVGGRNELCQVLPTVERYCPKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNT
FT                   AQYQNRLMVYEPNQNKWISRSPMLQRRVYHSMAAVQRKLYVLGGNDLDYNNDRILVRHI
FT                   DSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRIYLVGGYSIWTNEPLACIQVLDVSREG
FT                   KEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGTV"
FT   assembly_gap    21082892..21082911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21094003..21094022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21097152..21097171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21112591..21113982
FT                   /estimated_length=1392
FT                   /gap_type="unknown"
FT   assembly_gap    21116524..21116951
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    21132155..21132174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21137458..21137612
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    21140854..21140873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21143311..21143330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21178019..21180371
FT                   /estimated_length=2353
FT                   /gap_type="unknown"
FT   assembly_gap    21189111..21189550
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    21190460..21190526
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    21242044..21242101
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            21245952..21253552
FT                   /locus_tag="mCG_147160"
FT                   /note="gene_id=mCG147160.0"
FT   mRNA            join(21245952..21246173,21253041..21253552)
FT                   /locus_tag="mCG_147160"
FT                   /product="mCG147160"
FT                   /note="gene_id=mCG147160.0 transcript_id=mCT187423.0
FT                   created on 13-JAN-2004"
FT   CDS             21253070..21253348
FT                   /codon_start=1
FT                   /locus_tag="mCG_147160"
FT                   /product="mCG147160"
FT                   /note="gene_id=mCG147160.0 transcript_id=mCT187423.0
FT                   protein_id=mCP108355.0"
FT                   /protein_id="EDL05534.1"
FT                   /translation="MGTGLQAEWPPLTFPLAASQTLDCGAPSRLGAPPHRPAQLILGTS
FT                   GLLLSWVCTALYHQNGFHHGICIAGGVAVSMIEYPVYEGINQILYQS"
FT   assembly_gap    21285210..21285229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21288631..21288814
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    21290785..21290819
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    21297653..21298039
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    21311783..21312119
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    21320815..21320834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21331031..21331050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21352822..21358257
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /note="gene_id=mCG8960.2"
FT   mRNA            join(21352822..21353038,21353309..21353412,
FT                   21356453..21356540,21357891..21358257)
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, transcript variant
FT                   mCT176655"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT176655.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(21352822..21353038,21353309..21353412,
FT                   21356453..21358255)
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, transcript variant
FT                   mCT8903"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT8903.2 created on
FT                   06-DEC-2002"
FT   mRNA            join(21352838..21353412,21356453..21356540,
FT                   21357891..21358257)
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, transcript variant
FT                   mCT176654"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT176654.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(21352903..21353038,21353309..21353412,
FT                   21356453..21356540,21357891..21357955)
FT                   /codon_start=1
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, isoform CRA_a"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT176655.0
FT                   protein_id=mCP99576.0 isoform=CRA_a"
FT                   /protein_id="EDL05531.1"
FT                   /translation="MGARVTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRS
FT                   QYPEIEEVVSKKDNKLLSLLRDVYVDSKDPVPALPVKVEPRQEPKEFRLPIGNHFDKNI
FT                   TDIPKDRHTCLEIPREKMWKMRRIQR"
FT   CDS             join(21352903..21353038,21353309..21353412,
FT                   21356453..21356734)
FT                   /codon_start=1
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, isoform CRA_c"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT8903.2
FT                   protein_id=mCP20507.2 isoform=CRA_c"
FT                   /protein_id="EDL05533.1"
FT                   /translation="MGARVTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRS
FT                   QYPEIEEVVSKKDNKLLSLLRDVYVDSKDPVPALPVKVEPRQEPKEFRLPIGNHFDKNI
FT                   TDIPKGKITVVEALTLLNNHKLSPETWTAEKIAQEYYLELKDVNSLLKYFVTFEVKILP
FT                   PEDRKAIQSK"
FT   CDS             21352903..21353226
FT                   /codon_start=1
FT                   /gene="1110007M04Rik"
FT                   /locus_tag="mCG_8960"
FT                   /product="RIKEN cDNA 1110007M04, isoform CRA_b"
FT                   /note="gene_id=mCG8960.2 transcript_id=mCT176654.0
FT                   protein_id=mCP99577.0 isoform=CRA_b"
FT                   /protein_id="EDL05532.1"
FT                   /translation="MGARVTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRS
FT                   RECSPSQASGDIEVVPARAPGGGGWKESRSPRQPALSPGVCAGCTQTLVQVFAPRCPDD
FT                   FFF"
FT   assembly_gap    21365331..21366121
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    21367209..21367237
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    21370082..21370101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21374054..21374232
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    21400101..21400637
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   gene            complement(21416956..21421710)
FT                   /gene="C230012O17Rik"
FT                   /locus_tag="mCG_147149"
FT                   /note="gene_id=mCG147149.0"
FT   mRNA            complement(join(21416956..21419253,21421009..21421710))
FT                   /gene="C230012O17Rik"
FT                   /locus_tag="mCG_147149"
FT                   /product="RIKEN cDNA C230012O17"
FT                   /note="gene_id=mCG147149.0 transcript_id=mCT187412.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(21421037..21421570)
FT                   /codon_start=1
FT                   /gene="C230012O17Rik"
FT                   /locus_tag="mCG_147149"
FT                   /product="RIKEN cDNA C230012O17"
FT                   /note="gene_id=mCG147149.0 transcript_id=mCT187412.0
FT                   protein_id=mCP108344.0"
FT                   /protein_id="EDL05530.1"
FT                   /translation="MLSLSLEWRAQGGKVPEGHSPPRGLLGGAPAGAPGIKEARSSAGH
FT                   RVAPGSRGRAGSLSGLPAAESAASCRGVRREPRSAPPASPSDRPPARPPAQDALACQGS
FT                   AHTSHKRRRGGTAGSRRPLPPGTLRTSHRSSTAPSPRRRRRPRRRRRVGASPGSASALP
FT                   AAGGSRPRLTSARS"
FT   gene            21428044..21463789
FT                   /gene="Gpr63"
FT                   /locus_tag="mCG_8962"
FT                   /note="gene_id=mCG8962.1"
FT   mRNA            join(21428044..21428310,21461686..21463789)
FT                   /gene="Gpr63"
FT                   /locus_tag="mCG_8962"
FT                   /product="G protein-coupled receptor 63"
FT                   /note="gene_id=mCG8962.1 transcript_id=mCT8906.2 created on
FT                   10-JUN-2003"
FT   assembly_gap    21445440..21445668
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    21449747..21449766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             21461834..21463111
FT                   /codon_start=1
FT                   /gene="Gpr63"
FT                   /locus_tag="mCG_8962"
FT                   /product="G protein-coupled receptor 63"
FT                   /note="gene_id=mCG8962.1 transcript_id=mCT8906.2
FT                   protein_id=mCP20494.1"
FT                   /db_xref="GOA:Q9EQQ3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2135884"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQQ3"
FT                   /protein_id="EDL05529.1"
FT                   /translation="MVVSGVLTAPAVLTAPHSGTSNTTFVVFENSHVNITAPLPFQHPS
FT                   AGPLLRYSLETMTSPGFSSLAVNSTAVTPAPAVFKSLNLAVQIILSAIMIFILFVSFLG
FT                   NLVVCLMVYQKAAMRSAINILLASLAFADMLLAVLNMPFALVTILTTRWIFGKFFCRLS
FT                   AMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWATAFSVAFPLAVG
FT                   NPDLQIPSRAPQCVFGYTTNSGYQAYVILISLISFFIPFLVILYSFMGILNTLRHNALR
FT                   IHSYPEGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIVCWAPFTTYS
FT                   LVATFSKHFYYQHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFL
FT                   PRLPGHTRRRIRPSAVYVCGEHRTVL"
FT   assembly_gap    21464487..21464506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21485014..21485056
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    21502380..21502919
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    21504296..21504542
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    21541760..21542053
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    21564156..21564322
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    21570226..21570447
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    21583754..21583997
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    21585359..21585975
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    21588507..21589924
FT                   /estimated_length=1418
FT                   /gap_type="unknown"
FT   assembly_gap    21594960..21595076
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    21615813..21616707
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    21617414..21617676
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    21619817..21620214
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    21637005..21638727
FT                   /estimated_length=1723
FT                   /gap_type="unknown"
FT   assembly_gap    21642775..21642794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21654485..21697122)
FT                   /gene="Fhl5"
FT                   /locus_tag="mCG_8955"
FT                   /note="gene_id=mCG8955.1"
FT   mRNA            complement(join(21654485..21654717,21661652..21661838,
FT                   21665711..21665880,21668125..21668299,21669141..21669311,
FT                   21697006..21697122))
FT                   /gene="Fhl5"
FT                   /locus_tag="mCG_8955"
FT                   /product="four and a half LIM domains 5"
FT                   /note="gene_id=mCG8955.1 transcript_id=mCT8925.1 created on
FT                   31-JUL-2002"
FT   CDS             complement(join(21654554..21654717,21661652..21661838,
FT                   21665711..21665880,21668125..21668299,21669141..21669299))
FT                   /codon_start=1
FT                   /gene="Fhl5"
FT                   /locus_tag="mCG_8955"
FT                   /product="four and a half LIM domains 5"
FT                   /note="gene_id=mCG8955.1 transcript_id=mCT8925.1
FT                   protein_id=mCP20481.1"
FT                   /protein_id="EDL05528.1"
FT                   /translation="MTSSQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCK
FT                   EPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFH
FT                   CKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYC
FT                   NFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKC
FT                   AACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCGSGAD
FT                   TDA"
FT   assembly_gap    21663618..21663637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21680441..21680460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21702801..21736105)
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /note="gene_id=mCG8956.2"
FT   mRNA            complement(join(21702801..21704985,21705633..21705813,
FT                   21706229..21706314,21706596..21706676,21708893..21709023,
FT                   21709105..21709268,21710332..21710449,21713549..21713671,
FT                   21716540..21716660,21719756..21719935,21722025..21722200,
FT                   21723361..21723507,21724885..21724943,21730132..21730262,
FT                   21732315..21732429,21732930..21733027,21733678..21733706,
FT                   21734955..21735100,21736008..21736105))
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, transcript variant
FT                   mCT8926"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT8926.2 created on
FT                   06-DEC-2002"
FT   mRNA            complement(join(21702898..21704266,21704723..21704985,
FT                   21705633..21705813,21706229..21706314,21706596..21706676,
FT                   21708893..21709023,21709105..21709268,21710332..21710449,
FT                   21713549..21713671,21716540..21716660,21719756..21719935,
FT                   21722025..21722200,21723361..21724943,21730132..21730262,
FT                   21732315..21732429,21732930..21733027,21733678..21733706,
FT                   21734955..21735100,21736008..>21736092))
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, transcript variant
FT                   mCT189828"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT189828.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(21704444..21704985,21705633..21705813,
FT                   21706229..21706314,21706596..21706676,21708893..21709023,
FT                   21709105..21709268,21710332..21710449,21713549..21713671,
FT                   21716540..21716660,21719756..21719935,21722025..21722200,
FT                   21723361..21723507,21724885..21724943,21730132..21730262,
FT                   21732315..21732429,21732930..21733027,21734955..21735100,
FT                   21736008..>21736095))
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, transcript variant
FT                   mCT189829"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT189829.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(21704767..21704985,21705633..21705813,
FT                   21706229..21706314,21706596..21706676,21708893..21709023,
FT                   21709105..21709268,21710332..21710449,21713549..21713671,
FT                   21716540..21716660,21719756..21719935,21722025..21722200,
FT                   21723361..21723507,21724885..21724943,21730132..21730262,
FT                   21732315..21732429,21732930..21733027,21733678..21733706,
FT                   21734955..21735100,21736008..21736084))
FT                   /codon_start=1
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, isoform CRA_c"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT8926.2
FT                   protein_id=mCP20484.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CCJ3"
FT                   /db_xref="InterPro:IPR018611"
FT                   /db_xref="MGI:MGI:1914740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CCJ3"
FT                   /protein_id="EDL05527.1"
FT                   /translation="MADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQL
FT                   EVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLTHIESRVSDIIKSE
FT                   KHVQMVLGQLIDENYLDQLSEEVNDKLQESGQVTVSELCKAYDLPGDFLTQALTQRLGR
FT                   IINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRPTPVNSLVSKYGFQEQLLYSVLE
FT                   DLVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAV
FT                   NYIKKRYKNTQLLFLKATCVGQGLVDQVEASVEEAISSGTWVDISPLLPSSLSVEDAAM
FT                   LLQQVMRPFGKLASAIVFSDTVVVSEKFITDCTGLFSERMHQKAEKEMKNNPVHLITEE
FT                   DLKQISILESVNTSKKDKKDERRKKATEGSGSVRGGGGGNAREYKIKKTKKKGRKDEDS
FT                   DDESQSSHGGKKKPDITFMFQDEIEDCLRKHIQDAPEEFISELAEYLIKPLNKMYLEVV
FT                   RSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKYFADDTQTALTKHLLKTV
FT                   CTDITNLMFNFLASDFLMAVEEPAAITSDIRKKILSKLTEETKVALTKLHNSLNEKSIE
FT                   DFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALCEQLKVTEDPALILHLTAVLLFQ
FT                   LSTHSMLHAPGRCVPQIIAFLHSKIPEDQHTLLVKYQGLVVKQLVSQNKKTGQGEDPSS
FT                   DELDKEQHDVTNATRKELQELSLSIKDLVLKSRKSSVTEE"
FT   CDS             complement(join(21704767..21704985,21705633..21705813,
FT                   21706229..21706314,21706596..21706676,21708893..21709023,
FT                   21709105..21709268,21710332..21710449,21713549..21713671,
FT                   21716540..21716660,21719756..21719935,21722025..21722200,
FT                   21723361..21723507,21724885..21724943,21730132..21730262,
FT                   21732315..21732429,21732930..21733027,21734955..>21734978))
FT                   /codon_start=1
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, isoform CRA_b"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT189829.0
FT                   protein_id=mCP110830.0 isoform=CRA_b"
FT                   /protein_id="EDL05526.1"
FT                   /translation="ETSYMSEVVINVDLTHIESRVSDIIKSEKHVQMVLGQLIDENYLD
FT                   QLSEEVNDKLQESGQVTVSELCKAYDLPGDFLTQALTQRLGRIINGHLDLDNRGVIFTE
FT                   AFVARHKARIRGLFSAITRPTPVNSLVSKYGFQEQLLYSVLEDLVSTGRLRGTVVGGRQ
FT                   DKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVNYIKKRYKNTQLLFLKA
FT                   TCVGQGLVDQVEASVEEAISSGTWVDISPLLPSSLSVEDAAMLLQQVMRPFGKLASAIV
FT                   FSDTVVVSEKFITDCTGLFSERMHQKAEKEMKNNPVHLITEEDLKQISILESVNTSKKD
FT                   KKDERRKKATEGSGSVRGGGGGNAREYKIKKTKKKGRKDEDSDDESQSSHGGKKKPDIT
FT                   FMFQDEIEDCLRKHIQDAPEEFISELAEYLIKPLNKMYLEVVRSVFMSSTSASGTGRKR
FT                   TIKDLQEEVSNLYNNIRLFEKGMKYFADDTQTALTKHLLKTVCTDITNLMFNFLASDFL
FT                   MAVEEPAAITSDIRKKILSKLTEETKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMV
FT                   KKGDKKRERQILFQHRQALCEQLKVTEDPALILHLTAVLLFQLSTHSMLHAPGRCVPQI
FT                   IAFLHSKIPEDQHTLLVKYQGLVVKQLVSQNKKTGQGEDPSSDELDKEQHDVTNATRKE
FT                   LQELSLSIKDLVLKSRKSSVTEE"
FT   CDS             complement(join(21704767..21704985,21705633..21705813,
FT                   21706229..21706314,21706596..21706676,21708893..21709023,
FT                   21709105..21709268,21710332..21710449,21713549..21713671,
FT                   21716540..21716660,21719756..21719935,21722025..21722200,
FT                   21723361..>21723508))
FT                   /codon_start=1
FT                   /gene="1810074P20Rik"
FT                   /locus_tag="mCG_8956"
FT                   /product="RIKEN cDNA 1810074P20, isoform CRA_a"
FT                   /note="gene_id=mCG8956.2 transcript_id=mCT189828.0
FT                   protein_id=mCP110829.0 isoform=CRA_a"
FT                   /protein_id="EDL05525.1"
FT                   /translation="AVLEDLVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQ
FT                   NGYLEFDALSRLGIPDAVNYIKKRYKNTQLLFLKATCVGQGLVDQVEASVEEAISSGTW
FT                   VDISPLLPSSLSVEDAAMLLQQVMRPFGKLASAIVFSDTVVVSEKFITDCTGLFSERMH
FT                   QKAEKEMKNNPVHLITEEDLKQISILESVNTSKKDKKDERRKKATEGSGSVRGGGGGNA
FT                   REYKIKKTKKKGRKDEDSDDESQSSHGGKKKPDITFMFQDEIEDCLRKHIQDAPEEFIS
FT                   ELAEYLIKPLNKMYLEVVRSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMK
FT                   YFADDTQTALTKHLLKTVCTDITNLMFNFLASDFLMAVEEPAAITSDIRKKILSKLTEE
FT                   TKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALCEQLK
FT                   VTEDPALILHLTAVLLFQLSTHSMLHAPGRCVPQIIAFLHSKIPEDQHTLLVKYQGLVV
FT                   KQLVSQNKKTGQGEDPSSDELDKEQHDVTNATRKELQELSLSIKDLVLKSRKSSVTEE"
FT   assembly_gap    21707605..21707624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21737158..21737177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21742123..21742142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21747915..21747934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21794873..21795621)
FT                   /pseudo
FT                   /locus_tag="mCG_1042986"
FT                   /note="gene_id=mCG1042986.1"
FT   mRNA            complement(21794873..21795621)
FT                   /pseudo
FT                   /locus_tag="mCG_1042986"
FT                   /note="gene_id=mCG1042986.1 transcript_id=mCT160690.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    21798474..21799318
FT                   /estimated_length=845
FT                   /gap_type="unknown"
FT   assembly_gap    21803873..21804593
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    21818680..21818699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21828527..21828797
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    21831097..21831652
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    21834185..21834204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21835266..21835285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21840723..21840742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21847587..21848130
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    21850793..21850812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21851957..21851976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21853261..21853280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21854425..21854444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21855937..21855956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21862076..21862095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21863179..21864972
FT                   /pseudo
FT                   /locus_tag="mCG_49971"
FT                   /note="gene_id=mCG49971.2"
FT   mRNA            21863179..21864972
FT                   /pseudo
FT                   /locus_tag="mCG_49971"
FT                   /note="gene_id=mCG49971.2 transcript_id=mCT50154.2 created
FT                   on 12-FEB-2003"
FT   assembly_gap    21875425..21875470
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    21883842..21883862
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    21898878..21899007
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    21901636..21903827
FT                   /estimated_length=2192
FT                   /gap_type="unknown"
FT   assembly_gap    21904681..21905531
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    21923925..21924195
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    21942248..21943822
FT                   /estimated_length=1575
FT                   /gap_type="unknown"
FT   assembly_gap    21944652..21945296
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    21972965..21972984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21978218..21978237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21987232..21987892)
FT                   /pseudo
FT                   /locus_tag="mCG_8954"
FT                   /note="gene_id=mCG8954.2"
FT   mRNA            complement(21987232..21987892)
FT                   /pseudo
FT                   /locus_tag="mCG_8954"
FT                   /note="gene_id=mCG8954.2 transcript_id=mCT8923.2 created on
FT                   12-FEB-2003"
FT   assembly_gap    22008925..22010287
FT                   /estimated_length=1363
FT                   /gap_type="unknown"
FT   gene            complement(22051058..22141491)
FT                   /gene="Fut9"
FT                   /locus_tag="mCG_8953"
FT                   /note="gene_id=mCG8953.1"
FT   mRNA            complement(join(22051058..22053090,22141404..22141491))
FT                   /gene="Fut9"
FT                   /locus_tag="mCG_8953"
FT                   /product="fucosyltransferase 9"
FT                   /note="gene_id=mCG8953.1 transcript_id=mCT8924.0 created on
FT                   31-JUL-2002"
FT   CDS             complement(22052003..22053082)
FT                   /codon_start=1
FT                   /gene="Fut9"
FT                   /locus_tag="mCG_8953"
FT                   /product="fucosyltransferase 9"
FT                   /note="gene_id=mCG8953.1 transcript_id=mCT8924.0
FT                   protein_id=mCP20479.1"
FT                   /db_xref="GOA:Q14AE3"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="InterPro:IPR031481"
FT                   /db_xref="MGI:MGI:1330859"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AE3"
FT                   /protein_id="EDL05524.1"
FT                   /translation="MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESAS
FT                   SVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSH
FT                   AVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSD
FT                   IQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAF
FT                   GEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYI
FT                   PADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDH
FT                   VKRHQEYKSVGNLEKWFWN"
FT   assembly_gap    22056548..22056590
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    22161747..22166084
FT                   /estimated_length=4338
FT                   /gap_type="unknown"
FT   assembly_gap    22167237..22167355
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    22171372..22171541
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    22180061..22180080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22190449..22190468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22197869..22198134
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    22219578..22219928
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   gene            complement(22230220..22232375)
FT                   /locus_tag="mCG_147148"
FT                   /note="gene_id=mCG147148.0"
FT   mRNA            complement(join(22230220..22231811,22232106..22232375))
FT                   /locus_tag="mCG_147148"
FT                   /product="mCG147148"
FT                   /note="gene_id=mCG147148.0 transcript_id=mCT187411.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22230352..22230546)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147148"
FT                   /product="mCG147148"
FT                   /note="gene_id=mCG147148.0 transcript_id=mCT187411.0
FT                   protein_id=mCP108343.0"
FT                   /protein_id="EDL05523.1"
FT                   /translation="MITFKIPPFPLSSILFHFAFLVVLVSGQEQSDQQWFSANVFSCTK
FT                   IHEGQVYYCWFPKYRNLPN"
FT   assembly_gap    22254418..22254437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22267130..22267149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22269243..22272652
FT                   /estimated_length=3410
FT                   /gap_type="unknown"
FT   assembly_gap    22282916..22286458
FT                   /estimated_length=3543
FT                   /gap_type="unknown"
FT   assembly_gap    22295171..22295190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22300316..22300779)
FT                   /pseudo
FT                   /locus_tag="mCG_1042956"
FT                   /note="gene_id=mCG1042956.1"
FT   mRNA            complement(22300316..22300779)
FT                   /pseudo
FT                   /locus_tag="mCG_1042956"
FT                   /note="gene_id=mCG1042956.1 transcript_id=mCT160660.1
FT                   created on 12-FEB-2003"
FT   assembly_gap    22326355..22326521
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    22338451..22338470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22352367..22352502
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    22381112..22381131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22415888..22415907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22459930..22459949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22487847..22487866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22498060..22498213
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    22530500..22530519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22533397..22533416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22547494..22548832
FT                   /estimated_length=1339
FT                   /gap_type="unknown"
FT   assembly_gap    22560510..22560546
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    22572346..22572535
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    22574558..22577779
FT                   /estimated_length=3222
FT                   /gap_type="unknown"
FT   assembly_gap    22581127..22581510
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    22617729..22622868
FT                   /estimated_length=5140
FT                   /gap_type="unknown"
FT   assembly_gap    22687235..22687254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22695415..22695434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22700338..22700357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22714664..22714711
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    22719997..22720016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22726394..22726413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22729687..22729827
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    22742705..22742724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22751704..22774091)
FT                   /gene="Manea"
FT                   /locus_tag="mCG_6260"
FT                   /note="gene_id=mCG6260.2"
FT   mRNA            complement(join(22751704..22755495,22756273..22756349,
FT                   22763834..22763943,22767632..22768213,22773812..22774091))
FT                   /gene="Manea"
FT                   /locus_tag="mCG_6260"
FT                   /product="mannosidase, endo-alpha"
FT                   /note="gene_id=mCG6260.2 transcript_id=mCT5873.2 created on
FT                   17-JAN-2003"
FT   CDS             complement(join(22754838..22755495,22756273..22756349,
FT                   22763834..22763943,22767632..22768175))
FT                   /codon_start=1
FT                   /gene="Manea"
FT                   /locus_tag="mCG_6260"
FT                   /product="mannosidase, endo-alpha"
FT                   /note="gene_id=mCG6260.2 transcript_id=mCT5873.2
FT                   protein_id=mCP20504.2"
FT                   /protein_id="EDL05522.1"
FT                   /translation="MAKFRRRTCILLSLFILFIFSLMMGLKMLWPNAASFGPPFGLDLL
FT                   PELHPLNAHSGNKADFQRSDRINMETNTKALKGAGMTVLPAKASEVNLEELPPLNYFLH
FT                   AFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGQHSPPDDIGSSFYPELGSYSS
FT                   RDPSVIETHMKQMRSASIGVLALSWYPPDSRDDNGEATDHLVPTILDKAHKYNLKVTFH
FT                   IEPYSNRDDQNMHQNIKYIIDKYGNHPAFYRYKTRTGHSLPMFYVYDSYITKPTIWANL
FT                   LTPSGSQSVRSSPYDGLFIALLVEEKHKNDILQSGFDGIYTYFATNGFTYGSSHQNWNN
FT                   LKSFCEKNNLMFIPSVGPGYIDTSIRPWNTQNTRNRVNGKYYEVGLSAALQTHPSLISI
FT                   TSFNEWHEGTQIEKAVPKRTANTIYLDYRPHKPSLYLELTRKWSEKFSKERMTYALDQQ
FT                   QPAS"
FT   assembly_gap    22758125..22758144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22795647..22797517)
FT                   /locus_tag="mCG_16864"
FT                   /note="gene_id=mCG16864.2"
FT   mRNA            complement(22795647..22797517)
FT                   /locus_tag="mCG_16864"
FT                   /product="mCG16864"
FT                   /note="gene_id=mCG16864.2 transcript_id=mCT14268.2 created
FT                   on 21-JAN-2003"
FT   CDS             complement(22796225..22797448)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16864"
FT                   /product="mCG16864"
FT                   /note="gene_id=mCG16864.2 transcript_id=mCT14268.2
FT                   protein_id=mCP4358.2"
FT                   /protein_id="EDL05521.1"
FT                   /translation="MAPVAGKKAKKGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWT
FT                   PEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAAC
FT                   DIARQVADEGDALVAGGVSQTPSYLSCKSEVEVKKIFRQQLEVFMKKNVDFLIAEYFEH
FT                   VEEAVWAVEALKASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIVGVNCHFDPS
FT                   VSLQTVKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDI
FT                   QKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTK
FT                   PWIRARARKEYWQNLRIASGRPYNPSMSRPDAWGVTKGAAELMQQKEATTEQQLRELFE
FT                   KQKFKSAL"
FT   assembly_gap    22805674..22805693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22816314..22816678
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    22836195..22836524
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    22846520..22846539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22848062..22848081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22871131..22871903
FT                   /pseudo
FT                   /locus_tag="mCG_6261"
FT                   /note="gene_id=mCG6261.1"
FT   mRNA            22871131..22871903
FT                   /pseudo
FT                   /locus_tag="mCG_6261"
FT                   /note="gene_id=mCG6261.1 transcript_id=mCT5874.1 created on
FT                   17-JAN-2003"
FT   assembly_gap    22885838..22886878
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    22887816..22888232
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    22913410..22913429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22915002..22915021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22916408..22916427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22926239..22926258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22929093..22929112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22931556..22931575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22938109..22938322)
FT                   /pseudo
FT                   /locus_tag="mCG_50768"
FT                   /note="gene_id=mCG50768.2"
FT   mRNA            complement(22938109..22938322)
FT                   /pseudo
FT                   /locus_tag="mCG_50768"
FT                   /note="gene_id=mCG50768.2 transcript_id=mCT50951.2 created
FT                   on 27-MAR-2003"
FT   assembly_gap    22946074..22946093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22949155..22949174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22956205..22956224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22962097..22962116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22964208..22964227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22965322..22965341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22967512..22967686
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    22975980..22976077
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    22998528..22998547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23000721..23000740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23002502..23009741
FT                   /estimated_length=7240
FT                   /gap_type="unknown"
FT   assembly_gap    23012859..23012878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23017289..23017308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23025452..23025471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23052136..23052300
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    23060341..23060360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23073546..>23137540)
FT                   /locus_tag="mCG_145904"
FT                   /note="gene_id=mCG145904.0"
FT   mRNA            complement(join(23073546..23073818,23103381..23103518,
FT                   23137387..>23137540))
FT                   /locus_tag="mCG_145904"
FT                   /product="mCG145904"
FT                   /note="gene_id=mCG145904.0 transcript_id=mCT186012.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(23073792..23073818,23103381..23103518,
FT                   23137387..>23137539))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145904"
FT                   /product="mCG145904"
FT                   /note="gene_id=mCG145904.0 transcript_id=mCT186012.0
FT                   protein_id=mCP107555.0"
FT                   /protein_id="EDL05520.1"
FT                   /translation="SLDWKLLARWGVWMRTVLAAAVVSSEIVRPSLTTKGMKISLFFCF
FT                   LLATRQVFPCSIMGNQSPVRNSGSQTSTKTKEGGLHAQYQTLRNQEYTFVFVVKLDSHI
FT                   L"
FT   assembly_gap    23094744..23094763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23096003..23096022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23100271..23100290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23108073..23108092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23138318..23138640
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    23139448..23144304
FT                   /estimated_length=4857
FT                   /gap_type="unknown"
FT   assembly_gap    23215952..23218209
FT                   /estimated_length=2258
FT                   /gap_type="unknown"
FT   assembly_gap    23220916..23221030
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    23222160..23222398
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    23239623..23239936
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    23254646..23255015
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    23279725..23279744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23319962..23320017
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    23332018..23332037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23335069..23335453
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    23343598..23343978
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    23366056..23366075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23382256..23382380
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    23387173..23387192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23444350..23445159
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    23526846..23526865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23527399..23527667
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    23549298..23549317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23598136..23598636
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    23600902..23601403
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    23646619..23646638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23694338..23694566
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    23702448..23702467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23705598..23705617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23709889..23710101
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    23759827..23760054
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    23775671..23775690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23789211..23789920
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    23798375..23798394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23799982..23803432
FT                   /estimated_length=3451
FT                   /gap_type="unknown"
FT   assembly_gap    23809972..23809991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23817475..23817546
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    23864566..23864585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23877185..23877808
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    23881371..23881532
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    23887907..23889875
FT                   /estimated_length=1969
FT                   /gap_type="unknown"
FT   assembly_gap    23895963..23895982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23897030..23897049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23905869..23905888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23928593..23928612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23983189..23983208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23984603..23984622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24016645..24016664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24017734..24017753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24021110..24021129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24028568..24028587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24039269..24039649
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    24040962..24040981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24042055..24042074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24043135..24044339
FT                   /estimated_length=1205
FT                   /gap_type="unknown"
FT   assembly_gap    24048598..24048617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24050379..24056025
FT                   /estimated_length=5647
FT                   /gap_type="unknown"
FT   assembly_gap    24056969..24056988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24058094..24058113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24065625..24065644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24066448..24066467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24069582..24071839
FT                   /estimated_length=2258
FT                   /gap_type="unknown"
FT   assembly_gap    24073101..24073657
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    24080666..24080774
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    24081512..24081673
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    24082790..24082809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24101971..24101990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24103681..24111038
FT                   /estimated_length=7358
FT                   /gap_type="unknown"
FT   assembly_gap    24112659..24112678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24114833..24114852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24131769..24132456
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    24147285..24147345
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    24176705..24176724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24184132..24184294
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    24214824..24214843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24223249..24223268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24250769..24250788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24251875..24251894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24324603..24324622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24352454..24352473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24353607..24353626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24354810..24354829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24357899..24358526)
FT                   /pseudo
FT                   /locus_tag="mCG_51076"
FT                   /note="gene_id=mCG51076.2"
FT   mRNA            complement(24357899..24358526)
FT                   /pseudo
FT                   /locus_tag="mCG_51076"
FT                   /note="gene_id=mCG51076.2 transcript_id=mCT51259.2 created
FT                   on 19-FEB-2003"
FT   assembly_gap    24380380..24381051
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    24383268..24383287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24413009..24413103
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    24424634..24424653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24434281..24434300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24444848..24444867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24487378..24487701)
FT                   /pseudo
FT                   /locus_tag="mCG_50434"
FT                   /note="gene_id=mCG50434.1"
FT   mRNA            complement(24487378..24487701)
FT                   /pseudo
FT                   /locus_tag="mCG_50434"
FT                   /note="gene_id=mCG50434.1 transcript_id=mCT50617.1 created
FT                   on 12-FEB-2003"
FT   assembly_gap    24487773..24489235
FT                   /estimated_length=1463
FT                   /gap_type="unknown"
FT   assembly_gap    24497211..24497230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24514892..24514931
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    24524152..24527639
FT                   /estimated_length=3488
FT                   /gap_type="unknown"
FT   assembly_gap    24530234..24530355
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            24558001..24558812
FT                   /pseudo
FT                   /locus_tag="mCG_1042985"
FT                   /note="gene_id=mCG1042985.1"
FT   mRNA            24558001..24558812
FT                   /pseudo
FT                   /locus_tag="mCG_1042985"
FT                   /note="gene_id=mCG1042985.1 transcript_id=mCT160689.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    24609351..24609370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24626463..24626482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24671179..24671369
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    24677285..24677304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24773153..24773172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24792040..24792059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24828672..24828691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24839581..24839600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24844198..24845180
FT                   /pseudo
FT                   /locus_tag="mCG_14601"
FT                   /note="gene_id=mCG14601.1"
FT   mRNA            24844198..24845180
FT                   /pseudo
FT                   /locus_tag="mCG_14601"
FT                   /note="gene_id=mCG14601.1 transcript_id=mCT18985.1 created
FT                   on 17-JAN-2003"
FT   assembly_gap    24863885..24865174
FT                   /estimated_length=1290
FT                   /gap_type="unknown"
FT   assembly_gap    24872661..24873524
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    24890644..24890663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24907698..24907949
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    24917761..24917780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24918951..24919171
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    24922591..24922645
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    24946924..24946994
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    24949248..24949602
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    24955866..24958926
FT                   /estimated_length=3061
FT                   /gap_type="unknown"
FT   assembly_gap    24976988..24977007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24977313..24977653)
FT                   /pseudo
FT                   /locus_tag="mCG_142563"
FT                   /note="gene_id=mCG142563.0"
FT   mRNA            complement(24977313..24977653)
FT                   /pseudo
FT                   /locus_tag="mCG_142563"
FT                   /note="gene_id=mCG142563.0 transcript_id=mCT180908.0
FT                   created on 04-MAR-2003"
FT   gene            complement(25051400..25051905)
FT                   /pseudo
FT                   /locus_tag="mCG_142558"
FT                   /note="gene_id=mCG142558.0"
FT   mRNA            complement(25051400..25051905)
FT                   /pseudo
FT                   /locus_tag="mCG_142558"
FT                   /note="gene_id=mCG142558.0 transcript_id=mCT180895.0
FT                   created on 04-MAR-2003"
FT   gene            complement(25082845..25083207)
FT                   /pseudo
FT                   /locus_tag="mCG_142564"
FT                   /note="gene_id=mCG142564.0"
FT   mRNA            complement(25082845..25083207)
FT                   /pseudo
FT                   /locus_tag="mCG_142564"
FT                   /note="gene_id=mCG142564.0 transcript_id=mCT180907.0
FT                   created on 04-MAR-2003"
FT   assembly_gap    25096487..25096506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            25103486..25103879
FT                   /pseudo
FT                   /locus_tag="mCG_50483"
FT                   /note="gene_id=mCG50483.2"
FT   mRNA            join(25103486..25103763,25103842..25103879)
FT                   /pseudo
FT                   /locus_tag="mCG_50483"
FT                   /note="gene_id=mCG50483.2 transcript_id=mCT50666.2 created
FT                   on 27-MAR-2003"
FT   assembly_gap    25113418..25116412
FT                   /estimated_length=2995
FT                   /gap_type="unknown"
FT   assembly_gap    25151869..25151888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25153638..25154548
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   assembly_gap    25156488..25156955
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    25158755..25158914
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    25161213..25161240
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    25169248..25169267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25185204..25185305
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    25188436..25188727
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    25192458..25192477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25213688..25213707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25230590..25230609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25255599..25255645
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    25256806..25256920
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    25263151..25266072
FT                   /estimated_length=2922
FT                   /gap_type="unknown"
FT   assembly_gap    25274652..25275755
FT                   /estimated_length=1104
FT                   /gap_type="unknown"
FT   gene            25303678..25457397
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /note="gene_id=mCG14600.2"
FT   mRNA            join(25303678..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25457105..25457397)
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, transcript variant mCT178678"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178678.0 created
FT                   on 17-JAN-2003"
FT   mRNA            join(25303678..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25438105..25438230,25439175..25439360,
FT                   25439906..25439967,25440936..25441145,25441840..25441989,
FT                   25451871..25452064,25452992..25453147,25454471..25455664)
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, transcript variant mCT18984"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT18984.2 created
FT                   on 17-JAN-2003"
FT   mRNA            join(25303678..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25438117..25438230,25439175..25439360,
FT                   25439906..25439967,25440936..25441145,25441840..25441989,
FT                   25451871..25452064,25452992..25453147,25454471..25455664)
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, transcript variant mCT178677"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178677.0 created
FT                   on 17-JAN-2003"
FT   mRNA            join(25303678..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25436796..25437622)
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, transcript variant mCT178676"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178676.0 created
FT                   on 17-JAN-2003"
FT   mRNA            join(25303678..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25364414)
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, transcript variant mCT178675"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178675.0 created
FT                   on 17-JAN-2003"
FT   CDS             join(25303932..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25457105..25457187)
FT                   /codon_start=1
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, isoform CRA_c"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178678.0
FT                   protein_id=mCP101600.0 isoform=CRA_c"
FT                   /protein_id="EDL05517.1"
FT                   /translation="MVVQTRFPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTEL
FT                   EWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKF
FT                   TLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGER
FT                   KMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGS
FT                   EFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGR
FT                   RFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIF
FT                   NINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNY
FT                   VTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRS
FT                   VQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRA
FT                   VTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGF
FT                   IIGRRHCGYSKADQEGDEELYFHSLYRERGDGMEKTQHNKKWMIASCSRL"
FT   CDS             join(25303932..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25438105..25438230,25439175..25439360,
FT                   25439906..25439967,25440936..25441145,25441840..25441989,
FT                   25451871..25452064,25452992..25453147,25454471..25454585)
FT                   /codon_start=1
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, isoform CRA_d"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT18984.2
FT                   protein_id=mCP20473.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q61772"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001090"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001426"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016257"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR027936"
FT                   /db_xref="InterPro:IPR034283"
FT                   /db_xref="MGI:MGI:95276"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61772"
FT                   /protein_id="EDL05518.1"
FT                   /translation="MVVQTRFPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTEL
FT                   EWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKF
FT                   TLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGER
FT                   KMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGS
FT                   EFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGR
FT                   RFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIF
FT                   NINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNY
FT                   VTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRS
FT                   VQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRA
FT                   VTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGF
FT                   IIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKI
FT                   ERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNV
FT                   VHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMG
FT                   YVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRK
FT                   FTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLD
FT                   CWQKDRAERPKFEQIVGILDKMIRNPSSLKTPLGTCSRPLSPLLDQSTPDFTAFCSVGE
FT                   WLQAIKMERYKDNFTAAGYNSLESVARMTIDDVMSLGITLVGHQKKIMSSIQTMRAQML
FT                   HLHGTGIQV"
FT   CDS             join(25303932..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25438117..25438230,25439175..25439360,
FT                   25439906..25439967,25440936..25441145,25441840..25441989,
FT                   25451871..25452064,25452992..25453147,25454471..25454585)
FT                   /codon_start=1
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, isoform CRA_b"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178677.0
FT                   protein_id=mCP101599.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2BDQ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001090"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001426"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016257"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR027936"
FT                   /db_xref="InterPro:IPR034283"
FT                   /db_xref="MGI:MGI:95276"
FT                   /db_xref="UniProtKB/TrEMBL:A2BDQ4"
FT                   /protein_id="EDL05516.1"
FT                   /translation="MVVQTRFPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTEL
FT                   EWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKF
FT                   TLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGER
FT                   KMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGS
FT                   EFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGR
FT                   RFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIF
FT                   NINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNY
FT                   VTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRS
FT                   VQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRA
FT                   VTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGF
FT                   IIGRRHCGYSKADQEGDEELYFHCTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVI
FT                   GAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLE
FT                   GVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHR
FT                   DLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSA
FT                   SDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQK
FT                   DRAERPKFEQIVGILDKMIRNPSSLKTPLGTCSRPLSPLLDQSTPDFTAFCSVGEWLQA
FT                   IKMERYKDNFTAAGYNSLESVARMTIDDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHG
FT                   TGIQV"
FT   CDS             join(25303932..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362608,
FT                   25426281..25426405,25429173..25429356,25433163..25433271,
FT                   25433900..25433955,25436796..25436830)
FT                   /codon_start=1
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, isoform CRA_a"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178676.0
FT                   protein_id=mCP101598.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CC52"
FT                   /db_xref="InterPro:IPR001090"
FT                   /db_xref="InterPro:IPR001426"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR034283"
FT                   /db_xref="MGI:MGI:95276"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CC52"
FT                   /protein_id="EDL05515.1"
FT                   /translation="MVVQTRFPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTEL
FT                   EWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKF
FT                   TLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGER
FT                   KMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGS
FT                   EFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGR
FT                   RFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIF
FT                   NINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNY
FT                   VTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRS
FT                   VQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRA
FT                   VTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGF
FT                   IIGRRHCGYSKADQEGDEELYFHSLVTNEHLSVL"
FT   CDS             join(25303932..25304028,25308076..25308140,
FT                   25311630..25312299,25361126..25361281,25362273..25362640)
FT                   /codon_start=1
FT                   /gene="Epha7"
FT                   /locus_tag="mCG_14600"
FT                   /product="Eph receptor A7, isoform CRA_e"
FT                   /note="gene_id=mCG14600.2 transcript_id=mCT178675.0
FT                   protein_id=mCP101597.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q3V3T7"
FT                   /db_xref="InterPro:IPR001090"
FT                   /db_xref="InterPro:IPR001426"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR034283"
FT                   /db_xref="MGI:MGI:95276"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V3T7"
FT                   /protein_id="EDL05519.1"
FT                   /translation="MVVQTRFPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTEL
FT                   EWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKF
FT                   TLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGER
FT                   KMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGS
FT                   EFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGR
FT                   RFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIF
FT                   NINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNY
FT                   VTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAGKCRGILLSS"
FT   assembly_gap    25304098..25304469
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    25332885..25332904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25361599..25361618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25379056..25379479
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    25408680..25408699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25419813..25420021
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    25479275..25479294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25486033..25486177
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    25524918..25524937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25533875..25533925
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    25539068..25539087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25540281..25540312
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    25542474..25544810
FT                   /estimated_length=2337
FT                   /gap_type="unknown"
FT   assembly_gap    25546564..25548035
FT                   /estimated_length=1472
FT                   /gap_type="unknown"
FT   assembly_gap    25556610..25556862
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    25617397..25617416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25648398..25648828
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            25685928..25686609
FT                   /pseudo
FT                   /locus_tag="mCG_1042983"
FT                   /note="gene_id=mCG1042983.1"
FT   mRNA            25685928..25686609
FT                   /pseudo
FT                   /locus_tag="mCG_1042983"
FT                   /note="gene_id=mCG1042983.1 transcript_id=mCT160687.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    25695420..25695439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25731280..25734045
FT                   /estimated_length=2766
FT                   /gap_type="unknown"
FT   assembly_gap    25742059..25743117
FT                   /estimated_length=1059
FT                   /gap_type="unknown"
FT   assembly_gap    25759930..25764293
FT                   /estimated_length=4364
FT                   /gap_type="unknown"
FT   assembly_gap    25794478..25794497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25807185..25807204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25816544..25816684
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    25834479..25834830
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    25841024..25841043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25898498..25898701
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    25902522..25902541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25904488..25904507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25911213..25911467
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    25956511..25956796
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    25972923..25972942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25995809..25996097
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    26068487..26068800
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    26084225..26084244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26087978..26087997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26089086..26089105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26090278..26090297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26091675..26091694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26112214..26112233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26121581..26121603
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    26124791..26124810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26130491..26130591
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    26208979..26210890
FT                   /estimated_length=1912
FT                   /gap_type="unknown"
FT   assembly_gap    26216194..26220571
FT                   /estimated_length=4378
FT                   /gap_type="unknown"
FT   assembly_gap    26250282..26250481
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    26253061..26253080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26320041..26320688
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    26350436..26350579
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    26366411..26366430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26369120..26369139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26436401..26436420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26457715..26457788
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    26476761..26476829
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    26498471..26498606
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    26519519..26519538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26528354..26528400
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    26563061..26563140
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    26583285..26583610
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    26588059..26588097
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    26601537..26601556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26642566..26642585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26693314..26693333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26736444..26737083
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    26743179..26743317
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    26762018..26762439
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    26795846..26795982
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    26805186..26808745
FT                   /estimated_length=3560
FT                   /gap_type="unknown"
FT   assembly_gap    26848631..26851235
FT                   /estimated_length=2605
FT                   /gap_type="unknown"
FT   assembly_gap    26855665..26855684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26863687..26863827
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    26889898..26890030
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   gene            <26905145..26996749
FT                   /locus_tag="mCG_144558"
FT                   /note="gene_id=mCG144558.0"
FT   mRNA            join(<26905145..26905492,26905700..26906837,
FT                   26921340..26921396,26996436..26996749)
FT                   /locus_tag="mCG_144558"
FT                   /product="mCG144558"
FT                   /note="gene_id=mCG144558.0 transcript_id=mCT183982.0
FT                   created on 05-JUN-2003"
FT   CDS             <26905848..26906225
FT                   /codon_start=1
FT                   /locus_tag="mCG_144558"
FT                   /product="mCG144558"
FT                   /note="gene_id=mCG144558.0 transcript_id=mCT183982.0
FT                   protein_id=mCP105694.0"
FT                   /protein_id="EDL05514.1"
FT                   /translation="CQRDLGTKMTPPGAPAKPSRAGQTPLLWQGRCPDVWSLKRGLFQK
FT                   LSSRNLGGFYRLCAQVTKCWHQLEGNCDPGQSGFPASLMLSQFLSDWIGTEVVFYSLVV
FT                   LRSSGESSRGPWGCLPTLCPR"
FT   assembly_gap    26909512..26909531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26918005..26918199
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    26943334..26943353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26991159..26991916
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    26993435..26993454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26999368..26999483
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    27005417..27008564
FT                   /estimated_length=3148
FT                   /gap_type="unknown"
FT   assembly_gap    27049638..27049657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27097123..27097374
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    27104868..27107929
FT                   /estimated_length=3062
FT                   /gap_type="unknown"
FT   gene            <27137899..27331795
FT                   /locus_tag="mCG_8926"
FT                   /note="gene_id=mCG8926.2"
FT   mRNA            join(<27137899..27137959,27138830..27138948,
FT                   27260428..27260555,27263180..27263281,27295389..27295597,
FT                   27302739..27302858,27331643..27331795)
FT                   /locus_tag="mCG_8926"
FT                   /product="mCG8926"
FT                   /note="gene_id=mCG8926.2 transcript_id=mCT8846.2 created on
FT                   08-JAN-2003"
FT   gene            complement(27175312..27175817)
FT                   /pseudo
FT                   /locus_tag="mCG_142560"
FT                   /note="gene_id=mCG142560.0"
FT   mRNA            complement(27175312..27175817)
FT                   /pseudo
FT                   /locus_tag="mCG_142560"
FT                   /note="gene_id=mCG142560.0 transcript_id=mCT180897.0
FT                   created on 04-MAR-2003"
FT   assembly_gap    27211512..27211531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27212970..27212989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27218399..27218418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27228926..27228945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27234450..27234493
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    27237488..27237649
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    27239087..27239908
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   gene            27240975..27242273
FT                   /pseudo
FT                   /locus_tag="mCG_8925"
FT                   /note="gene_id=mCG8925.1"
FT   mRNA            27240975..27242273
FT                   /pseudo
FT                   /locus_tag="mCG_8925"
FT                   /note="gene_id=mCG8925.1 transcript_id=mCT8845.1 created on
FT                   25-APR-2003"
FT   assembly_gap    27243097..27243116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27244293..27244312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<27263209..27263281,27295389..27295507)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8926"
FT                   /product="mCG8926"
FT                   /note="gene_id=mCG8926.2 transcript_id=mCT8846.2
FT                   protein_id=mCP20495.1"
FT                   /protein_id="EDL05513.1"
FT                   /translation="DCPGTEHKNGTQEHGEKPFNLNFSVLSYRSKTALLYRVLHPIMFM
FT                   FYYDLSSRKPASCQLEHL"
FT   assembly_gap    27271442..27271527
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    27325536..27328261
FT                   /estimated_length=2726
FT                   /gap_type="unknown"
FT   assembly_gap    27341776..27341802
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    27395905..27396389
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    27404371..27404551
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    27405709..27405728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27407142..27407161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27408238..27410261
FT                   /estimated_length=2024
FT                   /gap_type="unknown"
FT   assembly_gap    27413479..27413498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27425155..27425368
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    27441546..27441565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27456814..27456833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27464611..27464714
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    27528936..27533914
FT                   /estimated_length=4979
FT                   /gap_type="unknown"
FT   assembly_gap    27557370..27557487
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    27584668..27584687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27605768..27605787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27641967..27642123
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    27679509..27679587
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    27683657..27684038
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    27691454..27691667
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    27707380..27707611
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    27713960..27713979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27721286..27721305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27739107..27739871
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    27746372..27746391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27757382..27757401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27765266..27765285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27766361..27766380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27778147..27778636
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    27783736..27783794
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    27854010..27854029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27933577..27933596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27947703..27948112
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    27957247..27957308
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    27994593..28001449
FT                   /estimated_length=6857
FT                   /gap_type="unknown"
FT   assembly_gap    28029613..28029632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28033953..28034106
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    28037424..28037804
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    28041413..28041677
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    28060278..28060297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28063470..28063828
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    28080435..28080454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28097629..28097648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28161906..28162599
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    28222590..28222609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28231055..28231074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28243493..28244733
FT                   /estimated_length=1241
FT                   /gap_type="unknown"
FT   assembly_gap    28265156..28265214
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    28267661..28267843
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    28270193..28270221
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    28298561..28298719
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    28355014..28355033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28359241..28359380
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    28376135..28376280
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    28377572..28378533
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    28384823..28388664
FT                   /estimated_length=3842
FT                   /gap_type="unknown"
FT   assembly_gap    28407314..28407333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            28429780..28485241
FT                   /gene="Map3k7"
FT                   /locus_tag="mCG_121930"
FT                   /note="gene_id=mCG121930.1"
FT   mRNA            join(28429780..28430046,28440486..28440596,
FT                   28442994..28443059,28444099..28444144,28445487..28445625,
FT                   28447205..28447329,28449979..28450107,28453176..28453306,
FT                   28454521..28454602,28456179..28456309,28456858..28456987,
FT                   28459341..28459421,28466586..28466650,28474812..28474917,
FT                   28480430..28480491,28481488..28481603,28483950..28485241)
FT                   /gene="Map3k7"
FT                   /locus_tag="mCG_121930"
FT                   /product="mitogen activated protein kinase kinase kinase 7,
FT                   transcript variant mCT178659"
FT                   /note="gene_id=mCG121930.1 transcript_id=mCT178659.0
FT                   created on 17-JAN-2003"
FT   mRNA            join(28429780..28430046,28440486..28440596,
FT                   28442994..28443059,28444099..28444144,28445487..28445625,
FT                   28447205..28447329,28449979..28450107,28453176..28453306,
FT                   28454521..28454602,28456179..28456309,28456858..28456987,
FT                   28466586..28466650,28474812..28474917,28480430..28480491,
FT                   28481488..28481603,28483950..28485241)
FT                   /gene="Map3k7"
FT                   /locus_tag="mCG_121930"
FT                   /product="mitogen activated protein kinase kinase kinase 7,
FT                   transcript variant mCT123144"
FT                   /note="gene_id=mCG121930.1 transcript_id=mCT123144.1
FT                   created on 17-JAN-2003"
FT   CDS             join(28429927..28430046,28440486..28440596,
FT                   28442994..28443059,28444099..28444144,28445487..28445625,
FT                   28447205..28447329,28449979..28450107,28453176..28453306,
FT                   28454521..28454602,28456179..28456309,28456858..28456987,
FT                   28459341..28459421,28466586..28466650,28474812..28474917,
FT                   28480430..28480491,28481488..28481603,28483950..28484130)
FT                   /codon_start=1
FT                   /gene="Map3k7"
FT                   /locus_tag="mCG_121930"
FT                   /product="mitogen activated protein kinase kinase kinase 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG121930.1 transcript_id=mCT178659.0
FT                   protein_id=mCP101581.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q923A8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017421"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346877"
FT                   /db_xref="UniProtKB/TrEMBL:Q923A8"
FT                   /protein_id="EDL05512.1"
FT                   /translation="MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRG
FT                   AFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVM
FT                   EYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLL
FT                   LVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEV
FT                   ITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIV
FT                   KIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPA
FT                   TNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARI
FT                   VATAAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSS
FT                   SPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSK
FT                   ESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLD
FT                   ENKSLSTYYQQCKKQLEVIRSQQQKRQGTS"
FT   CDS             join(28429927..28430046,28440486..28440596,
FT                   28442994..28443059,28444099..28444144,28445487..28445625,
FT                   28447205..28447329,28449979..28450107,28453176..28453306,
FT                   28454521..28454602,28456179..28456309,28456858..28456987,
FT                   28466586..28466650,28474812..28474917,28480430..28480491,
FT                   28481488..28481603,28483950..28484130)
FT                   /codon_start=1
FT                   /gene="Map3k7"
FT                   /locus_tag="mCG_121930"
FT                   /product="mitogen activated protein kinase kinase kinase 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG121930.1 transcript_id=mCT123144.1
FT                   protein_id=mCP67660.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q543B5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017421"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346877"
FT                   /db_xref="UniProtKB/TrEMBL:Q543B5"
FT                   /protein_id="EDL05511.1"
FT                   /translation="MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRG
FT                   AFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVM
FT                   EYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLL
FT                   LVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEV
FT                   ITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIV
FT                   KIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPA
FT                   TNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARI
FT                   VATAGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDD
FT                   STDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLL
FT                   QRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQ
FT                   GTS"
FT   assembly_gap    28486682..28486755
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    28499915..28499934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28501379..28501398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            28506256..28507429
FT                   /pseudo
FT                   /locus_tag="mCG_1042981"
FT                   /note="gene_id=mCG1042981.1"
FT   mRNA            join(28506256..28506604,28507148..28507429)
FT                   /pseudo
FT                   /locus_tag="mCG_1042981"
FT                   /note="gene_id=mCG1042981.1 transcript_id=mCT160685.1
FT                   created on 04-MAR-2003"
FT   assembly_gap    28510021..28510066
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    28511154..28511498
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    28525004..28525023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28543452..28543471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28548452..28548832
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    28556046..28556145
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    28567303..28567322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28572622..28573117
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    28588132..28588286
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   gene            28601393..28601777
FT                   /pseudo
FT                   /locus_tag="mCG_49727"
FT                   /note="gene_id=mCG49727.2"
FT   mRNA            28601393..28601777
FT                   /pseudo
FT                   /locus_tag="mCG_49727"
FT                   /note="gene_id=mCG49727.2 transcript_id=mCT49910.2 created
FT                   on 12-FEB-2003"
FT   assembly_gap    28605880..28605899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28607007..28607026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28627882..28629020
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    28641514..28642776
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    28651066..28651305
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   gene            28671764..28672708
FT                   /pseudo
FT                   /locus_tag="mCG_12756"
FT                   /note="gene_id=mCG12756.2"
FT   mRNA            28671764..28672708
FT                   /pseudo
FT                   /locus_tag="mCG_12756"
FT                   /note="gene_id=mCG12756.2 transcript_id=mCT13470.2 created
FT                   on 21-JAN-2003"
FT   assembly_gap    28700838..28700870
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            28703361..29047932
FT                   /gene="Bach2"
FT                   /locus_tag="mCG_12764"
FT                   /note="gene_id=mCG12764.2"
FT   mRNA            join(28703361..28703647,28781874..28781980,
FT                   28883658..28883806,28967950..28968204,29028344..29029355,
FT                   29029725..29029933,29041834..29042040,29046414..29047932)
FT                   /gene="Bach2"
FT                   /locus_tag="mCG_12764"
FT                   /product="BTB and CNC homology 2"
FT                   /note="gene_id=mCG12764.2 transcript_id=mCT13481.2 created
FT                   on 27-JAN-2003"
FT   assembly_gap    28716375..28716397
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            <28716487..>28730521
FT                   /locus_tag="mCG_12763"
FT                   /note="gene_id=mCG12763.2"
FT   mRNA            join(<28716487..28716536,28716949..28717047,
FT                   28728350..28728487,28730347..>28730521)
FT                   /locus_tag="mCG_12763"
FT                   /product="mCG12763"
FT                   /note="gene_id=mCG12763.2 transcript_id=mCT13480.2 created
FT                   on 25-APR-2003"
FT   assembly_gap    28727482..28727501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <28730352..>28730521
FT                   /codon_start=1
FT                   /locus_tag="mCG_12763"
FT                   /product="mCG12763"
FT                   /note="gene_id=mCG12763.2 transcript_id=mCT13480.2
FT                   protein_id=mCP20482.2"
FT                   /protein_id="EDL05510.1"
FT                   /translation="KQPLRDVRTEPTSCLETTRLLLLVWICVWWWWWWSSNFRFSVLEK
FT                   CIYNVKTRCLL"
FT   assembly_gap    28777794..28777813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            28848552..28858108
FT                   /locus_tag="mCG_147161"
FT                   /note="gene_id=mCG147161.0"
FT   mRNA            join(28848552..28848604,28856769..28858108)
FT                   /locus_tag="mCG_147161"
FT                   /product="mCG147161"
FT                   /note="gene_id=mCG147161.0 transcript_id=mCT187424.0
FT                   created on 13-JAN-2004"
FT   CDS             28857630..28857806
FT                   /codon_start=1
FT                   /locus_tag="mCG_147161"
FT                   /product="mCG147161"
FT                   /note="gene_id=mCG147161.0 transcript_id=mCT187424.0
FT                   protein_id=mCP108356.0"
FT                   /protein_id="EDL05509.1"
FT                   /translation="MLCQCLVMHNLGHPQGSVVSHSPTKIMQGPWYAWPRRESFTKIDK
FT                   RRTRLVKGNPART"
FT   assembly_gap    28932926..28933198
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    28959232..28959358
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   CDS             join(28967962..28968204,29028344..29029355,
FT                   29029725..29029933,29041834..29042040,29046414..29046893)
FT                   /codon_start=1
FT                   /gene="Bach2"
FT                   /locus_tag="mCG_12764"
FT                   /product="BTB and CNC homology 2"
FT                   /note="gene_id=mCG12764.2 transcript_id=mCT13481.2
FT                   protein_id=mCP20476.1"
FT                   /protein_id="EDL05507.1"
FT                   /translation="MSVDEKPGSPMYVYESTVHCANILLGLNDQRKKDILCDVTLIVER
FT                   KEFRAHRAVLAACSEYFWQALVGQTKDDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRE
FT                   NIREVIRCAEFLRMHNLEDSCFSFLQTQLLNREDGLFVCRKDSACQRPQEDHGNSAGEE
FT                   EEEEETMDSETARMACATDQMLPDPISFEATAIPVAEKEEALLPESEVPTDTKENSEKG
FT                   ALTQYPRYKKYQLACTKNVYSAPSHGTSGFASTFSEDSPGNSLKPGLPMGQIKSEPPSE
FT                   ETEEESITLCLSGDETDIKDRPGDVEMDRKQPSPAPTPSTPTGAACLDRSRSVSSPSCL
FT                   RSLFGITKGVESTGLPSTSQQPLVRSSACPFNKGISQGDLKTDYTPLAGNYGQPHVGQK
FT                   DVSNFAMGSPLRGPGPETLCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCE
FT                   QSYGTNSSDESGSFSEADSESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTS
FT                   EQLEFIHDIRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNHLKACMG
FT                   ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLIPMDLPGASVNPPPVGVEQSLAPSPC
FT                   AVGGSVPCCLEPGAAPPGLPWVPSNTSENCTSGRRLEGSDPGTFSERGPPLEARSQSVT
FT                   VDFCQEMTEKCTTDEQPRKDYA"
FT   assembly_gap    29003937..29004168
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    29025802..29026000
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            complement(29026233..29038249)
FT                   /locus_tag="mCG_1050952"
FT                   /note="gene_id=mCG1050952.0"
FT   mRNA            complement(join(29026233..29027126,29028100..29028575,
FT                   29029629..29029792,29032075..29032121,29038171..29038249))
FT                   /locus_tag="mCG_1050952"
FT                   /product="mCG1050952"
FT                   /note="gene_id=mCG1050952.0 transcript_id=mCT194741.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(29028398..29028575,29029629..29029792,
FT                   29032075..29032121,29038171..29038219))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050952"
FT                   /product="mCG1050952"
FT                   /note="gene_id=mCG1050952.0 transcript_id=mCT194741.0
FT                   protein_id=mCP115770.0"
FT                   /protein_id="EDL05508.1"
FT                   /translation="MRLSPGICAQLITMHKDPRKTRRHLHVLCQSLAWFLMFRGKESGS
FT                   LGTGRRGELTEREAAGGAPTPVLCVGIRGAGAGGPSPGLERRIPMVLLGALARTVLSAN
FT                   KQAILPVQELGLQEAEAGVLQIVHAQELSTADDLPDVLSAE"
FT   assembly_gap    29032389..29032917
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    29059540..29059591
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    29060771..29060790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<29067458..>29068975)
FT                   /gene="Gja10"
FT                   /locus_tag="mCG_12762"
FT                   /note="gene_id=mCG12762.0"
FT   mRNA            complement(<29067458..>29068975)
FT                   /gene="Gja10"
FT                   /locus_tag="mCG_12762"
FT                   /product="gap junction membrane channel protein alpha 10"
FT                   /note="gene_id=mCG12762.0 transcript_id=mCT13479.1 created
FT                   on 30-JUL-2002"
FT   CDS             complement(29067458..29068975)
FT                   /codon_start=1
FT                   /gene="Gja10"
FT                   /locus_tag="mCG_12762"
FT                   /product="gap junction membrane channel protein alpha 10"
FT                   /note="gene_id=mCG12762.0 transcript_id=mCT13479.1
FT                   protein_id=mCP20475.0"
FT                   /protein_id="EDL05506.1"
FT                   /translation="MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVW
FT                   DDEQSAFACNTQQPGCNNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRDFE
FT                   KQRQKKKLYLRAQMENPELDLEEQQRVDKELRRLEEQKKIHKVPLKGCLLRTYVLHILT
FT                   RSVLEVGFMIGQYILYGFQMHPIYKCTQAPCPNSVDCFVSRPTEKTIFMLFMHSIAAIS
FT                   LLLNILEIFHLGIRKIMRALDGKSSSGNTENETGPPFHSTNYSGTQQCMICSSLPERIS
FT                   LLQANNKQQVIRVNIPRSKSMWQIPHPRQLEVDVSCGKRDWAEKIESCAQLHVHSPCPH
FT                   DRSARIQHPGQQPCHSVFGPKNAMSQSWFGTMTASQHRPSSALETWERSQGPEASGRSL
FT                   TDRQSHFQGSDGSARESGVWTDRLGPGSRKASFLSRLMSEKGQRHSDSGSSRSLNSSCL
FT                   DFSHGENSPSPLPSATGHRASMVSKSSHVDSPPHSSFIIHETYVYVY"
FT   gene            complement(29074648..29087283)
FT                   /locus_tag="mCG_147157"
FT                   /note="gene_id=mCG147157.0"
FT   mRNA            complement(join(29074648..29074770,29084568..29087283))
FT                   /locus_tag="mCG_147157"
FT                   /product="mCG147157"
FT                   /note="gene_id=mCG147157.0 transcript_id=mCT187420.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(29074756..29074770,29084568..29084822))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147157"
FT                   /product="mCG147157"
FT                   /note="gene_id=mCG147157.0 transcript_id=mCT187420.0
FT                   protein_id=mCP108352.0"
FT                   /protein_id="EDL05505.1"
FT                   /translation="MQEVNLYTRQCANLEFTCLCLLSSGTKGVRHFTSHCSISLYHCVL
FT                   SLEDFFPQFNCCRIFITLQTQDLVIYLFFFFFFFLVFRERGFSV"
FT   assembly_gap    29075940..29075959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            29082142..29119940
FT                   /gene="Casp8ap2"
FT                   /locus_tag="mCG_12760"
FT                   /note="gene_id=mCG12760.1"
FT   mRNA            join(29082142..29082368,29090688..29090770,
FT                   29096780..29096848,29097668..29097768,29098408..29098482,
FT                   29101419..29101534,29106033..29108227,29110216..29113336,
FT                   29114703..29114802,29115849..29115933,29119351..29119940)
FT                   /gene="Casp8ap2"
FT                   /locus_tag="mCG_12760"
FT                   /product="caspase 8 associated protein 2"
FT                   /note="gene_id=mCG12760.1 transcript_id=mCT13477.1 created
FT                   on 30-JUL-2002"
FT   CDS             join(29090716..29090770,29096780..29096848,
FT                   29097668..29097768,29098408..29098482,29101419..29101534,
FT                   29106033..29108227,29110216..29113336,29114703..29114802,
FT                   29115849..29115905)
FT                   /codon_start=1
FT                   /gene="Casp8ap2"
FT                   /locus_tag="mCG_12760"
FT                   /product="caspase 8 associated protein 2"
FT                   /note="gene_id=mCG12760.1 transcript_id=mCT13477.1
FT                   protein_id=mCP20471.1"
FT                   /protein_id="EDL05504.1"
FT                   /translation="MAADDDNGDGTGLFDVCPASPLKNNDEGSLDIYAGLDSAVSDSTA
FT                   RSCVSFRNCLDLYEEILTEEGTAKEATYNDLQIEYGKCQQQMKDLMKRFKEIQTQNLNL
FT                   KNENQSLKKNISALIKTARVEINRKDEEINHLHQRLSEFPHFRNNHKAARTKDSQSTSP
FT                   HLDDCSKTDHGVKSDVQKDVHPNTAQPNLEKEGKSHSEAQNPLHLSTGVEKHCANNVWS
FT                   RSPYQVGEGNSNEDNRRGRSGTRHSQCSRGTDRTQKDLHSSCNDSEPRDKEANSRLQGH
FT                   PEKHGNSEARTESKISESKSSTGMGYKSERSASSWEKETSRERPHTRVESQHDKNLEKQ
FT                   NERLQNMHRKELPSQDKTERKVDVKFKPAGEEQGHRGRVDRALPPHPKNDVKHYGFNKY
FT                   HPEERRGREDCKRDRGMNSHGFQDRRCSSFLSSNRNSKYPHSKEVSVAHQWENTPFKAE
FT                   RHRTEDRRKRERENKEESRHVKSDKKSPPEHLQRTHKDTKKSTADGKRQTEPKHGKGAV
FT                   SNSELSKGTDSKEGATKVESGPNEAKGKDLKLSFMEKLNLTLSPAKKQPACQDNPHQIT
FT                   GVPEPSGTCDSRSLETTGTVACLPSGSEHNREETKSELPEPKEALLATSQLRISIPENK
FT                   MKEEKRLLFKSVENTVPCELLACGTEISLPAPVEIEQARCLLGSVEVEETCGGARTAAS
FT                   VVMHVLPEHASEDASQELDTKRHDGINACAISEGVKTKVILSPKAAAASESHLAPLVEE
FT                   PSISLVNCSGDNNPKLEPSLEERPIVETKSCPLESCLPKETFVPSPQKTELIDHKIETG
FT                   ESNSVYQDDDNSVLSIDFNNLRPIPDPISPLNSPVRPVCKVVSMESSCAIPLYDSSHKD
FT                   EFPSNSTLSTFKSQSDLNKENEKPVPKFDKCSEADSCKHLSLDELEEGEIRSDDEESVA
FT                   QKRLEKSARPRVSAEVQPGKSSPGSRRSTVHVHKDNGRTAVKLPRDRLTWSKRSSESRP
FT                   SNTERKSKTMSISSLEKILPLILVPSSLWEVMHMLRLLGKHVRKNYMKFKIKFSLTQFH
FT                   RIIESAILSFTSLVKCLDLSKICKSVSTLQKSLCEVIESNLKQVKKNGIVDRLFEQQQT
FT                   DMKKKLWKFVDEQLDYLFEKLKKILLKFCDSVNFENENSEGKLGKKYKERTQHSNCQKK
FT                   KMDNKEIRREKVLKSENTVNFKSSLGCEKSEEKHQDQNKTNASIVKHDVKRTFSTCSDN
FT                   TKNAECKEQFLEKSCPSTPRPGKDEGHTEEEAQAAQHASAKSERSFEILTEQQASSLTF
FT                   NLVSDAQMGEIFKSLLQGSDLLDTSGTEKAEWELKTPEKQLLESLKCESAPACATEELV
FT                   SEGASLCPKVISDDNWSLLSSEKGPSLSSGLSLPVHPDVLDENCMFEVSSNTALGKDNV
FT                   YSSEKSKPCISSILLEDLAVSLTVPSPLKSDGHLSFLKPEVLSTSTPEEVISAHFSEDA
FT                   LLEEEDASEQDIHLALESDNSSSKSSCSSWTSRSVASGFQYHPNLPMHAVIMEKSNDHF
FT                   IVKIRRATPSTSPGLKHGVVAEESLTSLPRTGKEAGVATEKEPNLFQSTVLKPVKDLEN
FT                   TDKNIDKSKLTHEEQNSIVQTQVPDIYEFLKDASNKVVHCDQVVDDCFKLHQVWEPKVS
FT                   ENLQELPSMEKIPHSLDNHLPDTHIDLTKDSATETKSLGELMEVTVLNVDHLECSQTNL
FT                   DQDAEITCSSLQPDTIDAFIDLTHDASSESKNEGSEPVLAVEGMGCQVICIDEDTNKEG
FT                   KMGRANSPLESIVEETCIDLTSESPGSCEIKRHNLKSEPPSKLDCLELPETLGNGHKKR
FT                   KNSPGVSHSSQKKQRKDIDLSSEKTQRLSPNSDRNGDAHRKQASKKREPAVNETSLSSE
FT                   ASPEVKGSTAVLAASPASLSAKNVIKKKGEIIVSWTRNDDREILLECQKRMPSLKTFTY
FT                   LAVKLNKNPNQVSERFQQLKKLFEKSKCR"
FT   gene            <29123927..29241646
FT                   /locus_tag="mCG_140986"
FT                   /note="gene_id=mCG140986.0"
FT   mRNA            join(<29123927..29124028,29129521..29129747,
FT                   29133080..29133304,29133778..29133885,29133959..29134151,
FT                   29135488..29135730,29136150..29136281,29137254..29137357,
FT                   29138203..29138317,29139529..29139704,29140683..29140764,
FT                   29141660..29141755,29143471..29143583,29145020..29145168,
FT                   29146252..29146312,29150271..29150482,29151367..29151467,
FT                   29152387..29152531,29153056..29153152,29156226..29156339,
FT                   29157923..29158070,29158457..29158567,29160182..29160333,
FT                   29161245..29161423,29162104..29162312,29162963..29163109,
FT                   29165511..29165652,29165957..29166091,29166170..29166308,
FT                   29166824..29166962,29167097..29167224,29168451..29168595,
FT                   29171300..29171429,29174334..29174552,29175317..29175514,
FT                   29176272..29176480,29177176..29177298,29178855..29179052,
FT                   29180161..29180268,29180602..29180790,29182601..29182690,
FT                   29182776..29183039,29183160..29183421,29185229..29185388,
FT                   29186081..29186197,29187648..29187856,29189159..29189307,
FT                   29189775..29189986,29190366..29190586,29191904..29192017,
FT                   29192718..29192850,29193711..29193826,29194927..29195060,
FT                   29196515..29196672,29196836..29196956,29197165..29197375,
FT                   29197641..29197869,29198094..29198214,29198800..29198970,
FT                   29199631..29199845,29200222..29200609,29201227..29201336,
FT                   29202077..29202779,29205496..29205657,29205790..29206063,
FT                   29206631..29206866,29207260..29207355,29207887..29207981,
FT                   29208213..29208334,29208666..29208812,29209346..29209455,
FT                   29210000..29210073,29210536..29210744,29211433..29211588,
FT                   29212466..29212612,29213325..29213451,29214730..29214835,
FT                   29215461..29215576,29216439..29216921,29217136..29217362,
FT                   29217807..29217962,29218106..29218287,29218925..29219086,
FT                   29221324..29221461,29223271..29223409,29224631..29224800,
FT                   29225250..29225393,29225944..29226091,29227478..29227800,
FT                   29228062..29228229,29229110..29229211,29230015..29230210,
FT                   29231960..29232127,29232513..29232676,29233563..29233652,
FT                   29234390..29234505,29235099..29235273,29236714..29236787,
FT                   29237322..29237436,29238282..29238345,29239705..29239847,
FT                   29240396..29241646)
FT                   /locus_tag="mCG_140986"
FT                   /product="mCG140986"
FT                   /note="gene_id=mCG140986.0 transcript_id=mCT172553.0
FT                   created on 03-SEP-2002"
FT   CDS             join(29123927..29124028,29129521..29129747,
FT                   29133080..29133304,29133778..29133885,29133959..29134151,
FT                   29135488..29135730,29136150..29136281,29137254..29137357,
FT                   29138203..29138317,29139529..29139704,29140683..29140764,
FT                   29141660..29141755,29143471..29143583,29145020..29145168,
FT                   29146252..29146312,29150271..29150482,29151367..29151467,
FT                   29152387..29152531,29153056..29153152,29156226..29156339,
FT                   29157923..29158070,29158457..29158567,29160182..29160333,
FT                   29161245..29161423,29162104..29162312,29162963..29163109,
FT                   29165511..29165652,29165957..29166091,29166170..29166308,
FT                   29166824..29166962,29167097..29167224,29168451..29168595,
FT                   29171300..29171429,29174334..29174552,29175317..29175514,
FT                   29176272..29176480,29177176..29177298,29178855..29179052,
FT                   29180161..29180268,29180602..29180790,29182601..29182690,
FT                   29182776..29183039,29183160..29183421,29185229..29185388,
FT                   29186081..29186197,29187648..29187856,29189159..29189307,
FT                   29189775..29189986,29190366..29190586,29191904..29192017,
FT                   29192718..29192850,29193711..29193826,29194927..29195060,
FT                   29196515..29196672,29196836..29196956,29197165..29197375,
FT                   29197641..29197869,29198094..29198214,29198800..29198970,
FT                   29199631..29199845,29200222..29200609,29201227..29201336,
FT                   29202077..29202779,29205496..29205657,29205790..29206063,
FT                   29206631..29206866,29207260..29207355,29207887..29207981,
FT                   29208213..29208334,29208666..29208812,29209346..29209455,
FT                   29210000..29210073,29210536..29210744,29211433..29211588,
FT                   29212466..29212612,29213325..29213451,29214730..29214835,
FT                   29215461..29215576,29216439..29216921,29217136..29217362,
FT                   29217807..29217962,29218106..29218287,29218925..29219086,
FT                   29221324..29221461,29223271..29223409,29224631..29224800,
FT                   29225250..29225393,29225944..29226091,29227478..29227800,
FT                   29228062..29228229,29229110..29229211,29230015..29230210,
FT                   29231960..29232127,29232513..29232676,29233563..29233652,
FT                   29234390..29234505,29235099..29235273,29236714..29236787,
FT                   29237322..29237436,29238282..29238345,29239705..29239847,
FT                   29240396..29240584)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140986"
FT                   /product="mCG140986"
FT                   /note="gene_id=mCG140986.0 transcript_id=mCT172553.0
FT                   protein_id=mCP95472.0"
FT                   /protein_id="EDL05503.1"
FT                   /translation="MEHLSVELVSGPLRLIAAKNEKSSGELNRFLAKSVWTPQDRQCIL
FT                   DSLAQLLLDKDYTLLLGRQLRPILLDLLERNAKAIKTGGQVNHDLHERLSVSMSKLIGS
FT                   HPDVLPFALRYFKDTYPVFQRLFLESSDANPVRYGRRRMKLRDLMEAANIFLQHRQTVF
FT                   RELWDWSVCVPLLRSHDALVRWHTANCLALVTCMNEEHKLSFLRKIFSSDELVHFRLRL
FT                   LEEAQLQDLEKALVLANPEVSLWHKGEEPQYIQGHLVSADLSSSVAAVCGVVLPKLSSS
FT                   PGEQASDRSSSLEQELALKSFVLVESVCKNLQLLAVSVASQNAVLLEGPIGSGKTSLVE
FT                   HLAAVTGRTKPPQLLKVQLGDQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATKGYWIL
FT                   LEDIDYAPLDVVSVLIPLLEHGELLIPGHGDCLKVAPTFQLFATRRLLSCGGSWYRPMN
FT                   SHATMLDKYWTKIHLHNLNKKDLNESKYPSLLAATDHLLDIYIELTGEKHCCPSVAYDK
FT                   APQEVSEAERENRRVVLEGRELSLRDLLNWCNRVAHGFDPTSSTALLHIFQEAMDCFTA
FT                   MLSEQTKKLRMAEVIGSRLNISKKKAEFYCKLYKPEIVINELDVQVGRVRLLRKQSEVV
FT                   RIQKEKCTFAATRPSSVLLEQLAVCVSQGEPVLLVGETGTGKTSAVQYLAYATGQHLRV
FT                   VNMNQQSDTADLLGGFKPVDHKLIWLPLRETFEELFVQTFSKKQNFTFLGHIQTCYRQK
FT                   RWHDLLKLMLHVQKSASTKGGEQSQPGLLKEKWEAFGLRLNHAQQQMKMTENALLFAFV
FT                   EGTLAQAIKKGEWILLDEINLAAPETLECLSGLLEGSSGSLVLLDRGDTEPLVRHPDFR
FT                   LFACMNPATDVGKRNLPPGIRNRFTELYVEELESKEDLQILIVDYLKGLNVSKNTVQGI
FT                   VNFYTALRKESGTKLVDGTGHRPHYSLRTLCRALRFAASNPCGSIQRSLYEGFCLGFLT
FT                   QLDRASHPVVQKLICQHIISGNVKSLLKQPIPEPKGGRLIQVEGYWISVGDKEPKIDET
FT                   YVLTPSVKLNLRDIARVVSAGTYPVLIQGETSVGKTSLIRWLAAASGNHCVRINNHEHT
FT                   DIQEYIGCYTSDTSGKLVFNEGVLIDAMRKGYWIVLDELNLAPTDVLEALNRLLDDNRE
FT                   LLITETQEVVRAHPRFMLFATQNPPGLYGGRKVLSRAFRNRFVELHFDELPSSELETIL
FT                   HKRCSLPPSYCSKLVKVMLDLQSYRRRSSVFAGKQGFIALRDLFRWAERYRLAEQTQED
FT                   YDWLQHLANDGFMLLAGRVRKQEEADVIQEVLEKHFKKKLCPQSLFSKENVLKLLGKSS
FT                   TQTTVLESKFSHVVWTESMRRLAVLVGRALEFGEPVLLVGDTGCGKTTVCQMFSALANQ
FT                   KLYSVNCHLNMETSDFLGGLRPVRQKPNDKDELDTRLFEWHDGPLVLAMKEDSFFLLDE
FT                   ISLADDSVLERLNSVLEVEKCLVLAEKGSPESKDNEVELLTAGKHFRILATMNPGGDFG
FT                   KKELSPALRNRFTEIWCPQSTKREDLIQIINHNLRPGLSLAGVGHKGADVAEVMLAFIT
FT                   WLTRQEFGRKCVVSIRDILSWVNFMNSMAEDAAVKRPEAISTVTSFVHAACLVYIDGIG
FT                   SGVTSSGFGTALLAREECLKFLIKKLSKVVRLTQRQKDELKIYDRLRHKEFTSIDDFWG
FT                   VHPFFIPRGPVLDGHNTGDYALTAGTTAMNAQRLLRAAKLNKPILLEGSPGVGKTSLVA
FT                   ALAKASGNTLVRINLSEQTDITDLFGADLPVEGGRGGEFAWCDGPLLAALKAGHWVVLD
FT                   ELNLASQSILEGLNACFDHRGEIYVPELGMSFQVQHEKTRIFGCQNPFRQGGGRKGLPK
FT                   SFLNRFTQVFVDPLTVVDMEFIASTLFPTIDKDIVKKMVAFNNHIDHEVTVEKKWGQKG
FT                   GPWEFNLRDLFRWCQLILVDQSPGCYDPGQHVFLVYGERMRTREDKEKVVAVFKDVFAS
FT                   NSMPYIGTRQFHITPYDIQIGYSVLSRSSYVPHPSRRPLSLLHQSFQSLEPIMKCVQMN
FT                   WMVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTELLGGFEQVDIIRPWRLLL
FT                   EKVERTVRVLLRDSLLINSVDTEVVLQAWSHFLLTYKPKCLGEDGKGVTIEIVNKLEAV
FT                   LLLMQRLNNKINSYSKADFAKLVEDFRSFGVKLLQSASGRSHGSFEWVDSMLVQALKSG
FT                   DWLLMDNVNFCNPSVLDRLNALLEPGGVLTINERGMVDGSTCTVTPNPNFRLFLSMDPI
FT                   HGEISRAMRNRGLEIYISGEEDGSIQDNLDLKVLLHSLGLVGDSVCNILLALHTEIQSL
FT                   VRGSPASSVSTLSHTAILIVQYLQRGLSLHKAFFEACWEVYVCSQHSAANQKLVQDLLE
FT                   SHTASLQARETWGHSILATGLWPDSVPSALFATEDSRLSVVRSEGQILAYCLNRMSLKT
FT                   SSWTRSQPLTLQDLENIMQTCSPDDLTFNAVEVDTCWVDEPEVLATAVKLLIERATNQD
FT                   WMLRVKWLCHLAKNIPQGLESVRVHLEASATALRKFYSTSLSAGVSNVLKILQTNITDD
FT                   FVIPLDPRWNMQALDIIRNSLDFDPQSDQAKQLFALLESVANKTFIYLDREKRIFTEAN
FT                   LVSVGSKKLRSSVLRMSFEFHKDPENYHSPPHEIVANLAAFFELIDGLILLWVQSPQGV
FT                   VPDAHINKILGSVQWRDRFWTVADTVTVDASGLALLALHWHWVSKHLIYQIPQLLVNQE
FT                   NKYYKELQTVSEHIHSCLGSPADSFAGVKKLQAFLGRPFPFKDKLVVDCFLQLQALNRA
FT                   LAIGEQLPVFGECGWQEDINRLQVVASEWNLKKSLLQAWGLILRANILEDVNLDELKNL
FT                   VSTQCSELKSRGLSRGFLEKAHDASSPSQPDLSSLVHLTRRVQLWPAAEYLAMLWQYRV
FT                   TADFIAQACLRRSSKHDQMDEEISHHIAFCLKHTPIAPQKLWNLWSLLHIEMLSAQEVS
FT                   CLWSELFTSTFGSSWSSPVTTAPECWLAWSPLPNIQQQEVPRSRWDSTLKGPGSLCRAV
FT                   FSKCCFGVLTNSSRASYWDVSGLPLLSSSHVTLGEWVERAQQLQDISSLLWTNMAVPSV
FT                   AEFRRTDSRLQGLVLCRYLLGLTELLPAHQRQEYMQNCEHLLLGNTQAFHHVDQTMGNI
FT                   GGQEALPKELLCLLLTSLHYFIGEGEGKQNLPEAARRGRLWVSLGLLQIQTWLPRARFD
FT                   PAVKKAYKLRYAQDELRQLQCELKTRNLLSHLQTGRDLEDDIITSHFHPHIKLLPQRIS
FT                   QLESLVHSLSKKQAFRPHLPSYETLVQEIHHYVTSIAKVTAVQDLLMRLLQALHTDGPK
FT                   SAQVLQNLLKEEASWQQSHHQFRKRLVEEYALYPDTVAPLLASILQLQHGMRLVASEVH
FT                   ASLHSGVLCAENLGALAMAVLAFPSVGPSFPTYHAHADALCSVNAAEALRSLGKLMVKR
FT                   AARKEEAKSQQAYPTREQLLMNALLYLRSHVLCKGELDQRALLLFRHLCQEIINEWDEQ
FT                   ERIAQEKAEQESSLYRYRSRSGRTALSEEEEEELELRKLFPLHEKDFADILMEPTLEEK
FT                   KKVSDGREEEAAPDPTLLCQSSMQAVMLIHQQLCLSFARSLWYQQAVPPHEAKHYLSLF
FT                   LSCYQTGASLVTHFYPLMGVELNDQLLGSQLLACTLSSNTLCGEATSDLMMRPDGPYDF
FT                   YQHPNVAEARQCQPVLQGFSEAVSQLLQDWPEHPVLQQLLVVMDRIRGFPLSSPISKFL
FT                   NGLEILLAKAQDWEENASRVLSLRKHLDLVSQMIIRWRKLELNCWSMSLDNTMIRHTEK
FT                   STKHWFSIYQMLEKHMQERTEEQEDDKQMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLV
FT                   FHCHVLLMPQVEGKDSLCSVLWNLYHFYKQFLDPVKAKIMELRSPIEKELKEFVKISKW
FT                   NDVSFWSIKQSVEKTHRTLFKFMKKFEAVLSEPCQSCLVESDKEEQPDCLPKPTEEATM
FT                   ETSPIQGLNNALRETLLAQPVEWKVLACTEQCQDASPLSVEGELLRRLPRLSKRMRKMC
FT                   LVFMKESPLPHLVESLDQFTGGVISSVSELQSLKVDPSAEKEKQHSEAKHILLQKHRAL
FT                   SDLFKHLANIGLSYRKGLAWARSKSPQELLHLHPLDLRSALSIVSSTREADSRLLTEIS
FT                   SLWDGCQKYFYRSLARHTRLTAALATPVKEVSMGTIERCKGFSAHLMKLLIRQRHSLTT
FT                   LTEQWIILRNLLSCVQEIHSRLTGPPVYPVAFPPQDSVQQWTERLQHLAMQSQILLEQF
FT                   SWLFQCCPSAEPTVGHRDAQVQEHPSASHLENIDFKETIAGVMPDLLSSDLSYPSPVPT
FT                   SQLPSACRMRRQDQLWQQSTAGLTEMLKTIKTMKAGVDKIRQQSCETLFHTWEDFEVCS
FT                   SGLNCLSQVSAHLQGLASLFILPGIEVEQTDSRMALVESLDYLRGEVSKAIDDFTAWKA
FT                   RLFVAHKQEGNQMVEESFVEDFSEQVETAIRAILCTIQNLAERNNKKAEDSAVDKRLQE
FT                   EDGGKEEEASFKSLQPGHLTKLLEDDFWASVSTLHVQKIISSVSELLERLKSCSEDGNT
FT                   TKHKVFSQSCGLLVRLIPILCGFSDLVLFFLTVSLATHRSTAKLLSVLAQTFTELSQKG
FT                   FCLPKELMEDSAGEGATQFHDYEGGGIGDGEGMKDVSDRIENEEQVEDTFQKGQEKDEE
FT                   DLDSKPDTKGEDNAIEMSEDFDGKMHDGELEQEEDDEKSDSEDGDLDKQMGNLNGEEAD
FT                   KLDERLWGDDEEEDEDGDGRAEETGPGVDEEDSELVAKDDSLDAGNLNKNKKHQDEKED
FT                   SEPEDVEQGQEKINEQIDEREYDENEVDPYHGNQEKLPEPEALDLPDDLKLDSEDKSGG
FT                   EDTDNEEAEEENPLEIKEKTVDMEETDHEIEEPGAGQDEGESPHEPEEGPSEDKENMDM
FT                   DTGADDQDRDTSSHAEEHSLEEEAEEEEEKGEKEEDKATTDGGGESGVNPVDQGLQPQK
FT                   EEEEEGEQSDAEEQVPEATERKEHATCGQTGVDNVQSAQAVELAGAAPEKEQGKEEHGS
FT                   GAADANQAEGHESNLIARLSSQQHTNKNTQSFKRRPGQADNERSVGDYNERVRKRLRTV
FT                   GTDRETEQEPTQAQVEDADAFEHVKQGSDAYDAQTYDVASSEQQQTAKASGQDQEEEEI
FT                   EDILMDTEEELMRAEDTEQLKPEAVQSETAATSGSSEMEVDMQTLKTKEDQDPRTTTPH
FT                   QETENERPERSRDSTIHTLRQFLVDSVFQPILKDISELRQEMERQLETWQAHDYGNAEE
FT                   EKAAAEMWQNYLVLTASLSQQLCEQLRLLLEPTQAAKLRGDYRTGKRLNMRKIIPYIAS
FT                   QFRKDRIWLRRTKPSKRQYQICLAIDDSSSMVDNHTKQLAFESLAVIGNALTLLEVGQI
FT                   AVCSFGESVKLLHPFHEQFNDSSGTHILRLCTFQQRKTKIAQFLETVAKMFAAAQKLSQ
FT                   NVSPETAQLLLIVSDGRGLFLEGKDRVLAAVQAAQNANIFVIFVVLDNPNSRDSILDIK
FT                   VPIFKGPGEMPEIRSYMEEFPFPFYIILRDVNALPETLSDALRQWFELVTASDHS"
FT   assembly_gap    29166445..29166464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29170896..29170915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29172694..29172713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29226845..29226959
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    29233031..29233050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29234295..29234314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29257199..29257342
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            29259026..29261000
FT                   /gene="2610208E05Rik"
FT                   /locus_tag="mCG_12758"
FT                   /note="gene_id=mCG12758.2"
FT   mRNA            join(29259026..29259100,29259375..29259515,
FT                   29259908..29261000)
FT                   /gene="2610208E05Rik"
FT                   /locus_tag="mCG_12758"
FT                   /product="RIKEN cDNA 2610208E05, transcript variant
FT                   mCT13475"
FT                   /note="gene_id=mCG12758.2 transcript_id=mCT13475.2 created
FT                   on 08-JAN-2003"
FT   mRNA            join(29259043..29259515,29259908..29261000)
FT                   /gene="2610208E05Rik"
FT                   /locus_tag="mCG_12758"
FT                   /product="RIKEN cDNA 2610208E05, transcript variant
FT                   mCT178406"
FT                   /note="gene_id=mCG12758.2 transcript_id=mCT178406.0 created
FT                   on 08-JAN-2003"
FT   CDS             join(29259056..29259100,29259375..29259515,
FT                   29259908..29259988)
FT                   /codon_start=1
FT                   /gene="2610208E05Rik"
FT                   /locus_tag="mCG_12758"
FT                   /product="RIKEN cDNA 2610208E05, isoform CRA_a"
FT                   /note="gene_id=mCG12758.2 transcript_id=mCT13475.2
FT                   protein_id=mCP20498.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R033"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR026868"
FT                   /db_xref="MGI:MGI:1917573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R033"
FT                   /protein_id="EDL05501.1"
FT                   /translation="MAASRLPPAALTLKQFMRRQQVLLLYRKILRAIRQVPSDSDRKYL
FT                   QDWAREEFKRNKSATEEDTIRMMITQGNMQLKELERTLALANS"
FT   CDS             29259056..29259370
FT                   /codon_start=1
FT                   /gene="2610208E05Rik"
FT                   /locus_tag="mCG_12758"
FT                   /product="RIKEN cDNA 2610208E05, isoform CRA_b"
FT                   /note="gene_id=mCG12758.2 transcript_id=mCT178406.0
FT                   protein_id=mCP101328.0 isoform=CRA_b"
FT                   /protein_id="EDL05502.1"
FT                   /translation="MAASRLPPAALTLKQVLLISQPRGGVLCGRAPPATWLAAATAGLG
FT                   RQPQPPEGGAARRAPPSQAARPPVRKDSLLFCLLARTKGLFLLAEWSRLVCGNLSFSFP
FT                   "
FT   gene            complement(29262797..29382170)
FT                   /gene="Ankrd6"
FT                   /locus_tag="mCG_12759"
FT                   /note="gene_id=mCG12759.2"
FT   mRNA            complement(join(29262797..29265408,29267449..29267575,
FT                   29268963..29269076,29273974..29274126,29275649..29275834,
FT                   29276157..29276288,29277343..29277447,29279995..29280072,
FT                   29280891..29280989,29282144..29282242,29283134..29283232,
FT                   29285823..29285921,29287444..29287542,29295108..29295206,
FT                   29319091..29319357,29381963..29382170))
FT                   /gene="Ankrd6"
FT                   /locus_tag="mCG_12759"
FT                   /product="ankyrin repeat domain 6, transcript variant
FT                   mCT13476"
FT                   /note="gene_id=mCG12759.2 transcript_id=mCT13476.2 created
FT                   on 13-DEC-2002"
FT   mRNA            complement(join(29262984..29265408,29267449..29267575,
FT                   29268963..29269076,29273974..29274126,29275649..29275834,
FT                   29276157..29276288,29277343..29277447,29279995..29280072,
FT                   29280891..29280989,29282144..29282242,29283134..29283232,
FT                   29285823..29285921,29287444..29287542,29295108..29295206,
FT                   29319091..29319357,29333065..29333228,29381967..>29382121))
FT                   /gene="Ankrd6"
FT                   /locus_tag="mCG_12759"
FT                   /product="ankyrin repeat domain 6, transcript variant
FT                   mCT189840"
FT                   /note="gene_id=mCG12759.2 transcript_id=mCT189840.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(29264879..29265408,29267449..29267575,
FT                   29268963..29269076,29273974..29274126,29275649..29275834,
FT                   29276157..29276288,29277343..29277447,29279995..29280072,
FT                   29280891..29280989,29282144..29282242,29283134..29283232,
FT                   29285823..29285921,29287444..29287542,29295108..29295206,
FT                   29319091..>29319213))
FT                   /codon_start=1
FT                   /gene="Ankrd6"
FT                   /locus_tag="mCG_12759"
FT                   /product="ankyrin repeat domain 6, isoform CRA_b"
FT                   /note="gene_id=mCG12759.2 transcript_id=mCT189840.0
FT                   protein_id=mCP110816.0 isoform=CRA_b"
FT                   /protein_id="EDL05500.1"
FT                   /translation="FMSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTKHGRT
FT                   PLHLAANKGHLSVVQILLKAGCDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDR
FT                   QDKDGNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLL
FT                   GGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKK
FT                   VVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQILRFSRGRSLRKRRER
FT                   LKEERRAQSVPRDEVAQSKGSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRK
FT                   SRPEVSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRG
FT                   EDGKVMQAPIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQM
FT                   CVLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQMSLVDELKAWCMLKIQSLELRL
FT                   SGESRTFRAKSTPPPSDSTPAVDQPVVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQ
FT                   ELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPS
FT                   GQQPSAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLK
FT                   EHIRSLEEELARLRTKVQK"
FT   CDS             complement(join(29264879..29265408,29267449..29267575,
FT                   29268963..29269076,29273974..29274126,29275649..29275834,
FT                   29276157..29276288,29277343..29277447,29279995..29280072,
FT                   29280891..29280989,29282144..29282242,29283134..29283232,
FT                   29285823..29285921,29287444..29287542,29295108..29295206,
FT                   29319091..29319210))
FT                   /codon_start=1
FT                   /gene="Ankrd6"
FT                   /locus_tag="mCG_12759"
FT                   /product="ankyrin repeat domain 6, isoform CRA_a"
FT                   /note="gene_id=mCG12759.2 transcript_id=mCT13476.2
FT                   protein_id=mCP20499.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q69ZU8"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2154278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q69ZU8"
FT                   /protein_id="EDL05499.1"
FT                   /translation="MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTKHGRTP
FT                   LHLAANKGHLSVVQILLKAGCDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQ
FT                   DKDGNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLG
FT                   GSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKV
FT                   VKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQILRFSRGRSLRKRRERL
FT                   KEERRAQSVPRDEVAQSKGSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKS
FT                   RPEVSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRGE
FT                   DGKVMQAPIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQMC
FT                   VLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQMSLVDELKAWCMLKIQSLELRLS
FT                   GESRTFRAKSTPPPSDSTPAVDQPVVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQE
FT                   LPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSG
FT                   QQPSAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKE
FT                   HIRSLEEELARLRTKVQK"
FT   assembly_gap    29291670..29291691
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    29329366..29329454
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    29330698..29330717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29335350..29337037
FT                   /estimated_length=1688
FT                   /gap_type="unknown"
FT   assembly_gap    29352244..29352580
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    29359654..29359699
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    29381762..29381833
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    29388576..29388791
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    29389590..29390533
FT                   /estimated_length=944
FT                   /gap_type="unknown"
FT   assembly_gap    29392817..29392836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29395915..29396150
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    29402114..29403016
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   assembly_gap    29405588..29406558
FT                   /estimated_length=971
FT                   /gap_type="unknown"
FT   assembly_gap    29407600..29407663
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    29420310..29420931
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   gene            29424630..29425127
FT                   /locus_tag="mCG_12757"
FT                   /note="gene_id=mCG12757.1"
FT   mRNA            29424630..29425127
FT                   /locus_tag="mCG_12757"
FT                   /product="mCG12757"
FT                   /note="gene_id=mCG12757.1 transcript_id=mCT13474.1 created
FT                   on 29-JAN-2003"
FT   CDS             29424743..29425087
FT                   /codon_start=1
FT                   /locus_tag="mCG_12757"
FT                   /product="mCG12757"
FT                   /note="gene_id=mCG12757.1 transcript_id=mCT13474.1
FT                   protein_id=mCP20470.1"
FT                   /protein_id="EDL05498.1"
FT                   /translation="MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVSVEPFWPG
FT                   LFAKALANVNIGCLICNVGAGGPAPTAGAAPAGGAALSTAAAPAEEKKVEAKKEESEES
FT                   EDDMGFGLFD"
FT   assembly_gap    29441733..29441770
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    29442287..29442733
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   gene            29443122..29481337
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /note="gene_id=mCG12768.2"
FT   mRNA            join(29443122..29443355,29455555..29455850,
FT                   29464059..29464258,29465042..29465156,29467038..29467115,
FT                   29472809..29472957,29478553..29478718,29481282..29481337)
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, transcript variant
FT                   mCT178408"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT178408.0 created
FT                   on 08-JAN-2003"
FT   mRNA            join(29443122..29443355,29455555..29455850,
FT                   29464059..29464258,29465042..29465156,29466973..29467115,
FT                   29472809..29472957,29478553..29479167)
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, transcript variant
FT                   mCT13485"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT13485.2 created
FT                   on 08-JAN-2003"
FT   CDS             join(29443211..29443355,29455555..29455850,
FT                   29464059..29464258,29465042..29465156,29466973..29467115,
FT                   29472809..29472957,29478553..29478704)
FT                   /codon_start=1
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, isoform CRA_a"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT13485.2
FT                   protein_id=mCP20489.2 isoform=CRA_a"
FT                   /db_xref="GOA:B1AWT2"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1098604"
FT                   /db_xref="UniProtKB/TrEMBL:B1AWT2"
FT                   /protein_id="EDL05495.1"
FT                   /translation="MSQVLGKPQPQGEDGGEDEEEDELVGLAGYEDGPESSDAELDSGP
FT                   EEGVLDFSDPFSTEVKPRILLMGLRRSGKSSIQKVVFHKMSPSETLFLESTNRICREDV
FT                   SNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTR
FT                   AYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYD
FT                   HSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQT
FT                   YELCCDMIDVVIDISCIYGLKEDGAGAPYDKDSTAIIKLNNTTVLYLKEVTKFLALVCF
FT                   VREESFERKGLIDYNFHCFRKAIHEVFEVRMKMVKSRKAQSRLPKKTGATPNGTPRVLL
FT                   "
FT   CDS             join(29443211..29443355,29455555..29455850,
FT                   29464059..29464258,29465042..29465156,29467038..29467076)
FT                   /codon_start=1
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, isoform CRA_c"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT178408.0
FT                   protein_id=mCP101329.0 isoform=CRA_c"
FT                   /protein_id="EDL05497.1"
FT                   /translation="MSQVLGKPQPQGEDGGEDEEEDELVGLAGYEDGPESSDAELDSGP
FT                   EEGVLDFSDPFSTEVKPRILLMGLRRSGKSSIQKVVFHKMSPSETLFLESTNRICREDV
FT                   SNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTR
FT                   AYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYD
FT                   HSIFEAFSKVVQKLIPQLPTLENLLNIFISHAGGHADVRALL"
FT   mRNA            join(29454836..29454905,29454920..29454949,
FT                   29455555..29455850,29464059..29464258,29465042..29465156,
FT                   29466973..29467115,29472809..29472957,29478553..29479167)
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, transcript variant
FT                   mCT178407"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT178407.0 created
FT                   on 08-JAN-2003"
FT   CDS             join(29454839..29454905,29454920..29454949,
FT                   29455555..29455850,29464059..29464258,29465042..29465156,
FT                   29466973..29467115,29472809..29472957,29478553..29478704)
FT                   /codon_start=1
FT                   /gene="Rragd"
FT                   /locus_tag="mCG_12768"
FT                   /product="Ras-related GTP binding D, isoform CRA_b"
FT                   /note="gene_id=mCG12768.2 transcript_id=mCT178407.0
FT                   protein_id=mCP101330.0 isoform=CRA_b"
FT                   /protein_id="EDL05496.1"
FT                   /translation="MSAGNQASGGAATCWALVVDGALLRRQRQADFFLDFSDPFSTEVK
FT                   PRILLMGLRRSGKSSIQKVVFHKMSPSETLFLESTNRICREDVSNSSFVNFQIWDFPGQ
FT                   IDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHK
FT                   VDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIP
FT                   QLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISC
FT                   IYGLKEDGAGAPYDKDSTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNF
FT                   HCFRKAIHEVFEVRMKMVKSRKAQSRLPKKTGATPNGTPRVLL"
FT   assembly_gap    29462390..29462676
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    29465504..29466433
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    29468812..29468914
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            complement(29488725..29491195)
FT                   /locus_tag="mCG_60907"
FT                   /note="gene_id=mCG60907.2"
FT   mRNA            complement(join(29488725..29490427,29490763..29491195))
FT                   /locus_tag="mCG_60907"
FT                   /product="mCG60907"
FT                   /note="gene_id=mCG60907.2 transcript_id=mCT61090.2 created
FT                   on 08-JAN-2003"
FT   CDS             complement(join(29490275..29490427,29490763..29490828))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60907"
FT                   /product="mCG60907"
FT                   /note="gene_id=mCG60907.2 transcript_id=mCT61090.2
FT                   protein_id=mCP40627.2"
FT                   /protein_id="EDL05494.1"
FT                   /translation="MGQVGLKEMRCVCLFGSWRTEKSSNLASSNLRCSDRPHDQACRGG
FT                   VVVPIRPPARLGRHFALRLSSSSQQWR"
FT   gene            29491409..29510290
FT                   /gene="Ube2j1"
FT                   /locus_tag="mCG_12755"
FT                   /note="gene_id=mCG12755.2"
FT   mRNA            join(29491409..29491522,29496616..29496689,
FT                   29498106..29498237,29500743..29500827,29501366..29501471,
FT                   29503867..29503996,29505090..29505209,29509692..29510290)
FT                   /gene="Ube2j1"
FT                   /locus_tag="mCG_12755"
FT                   /product="ubiquitin-conjugating enzyme E2, J1"
FT                   /note="gene_id=mCG12755.2 transcript_id=mCT13473.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(29491492..29491522,29496616..29496689,
FT                   29498106..29498237,29500743..29500827,29501366..29501471,
FT                   29503867..29503996,29505090..29505209,29509692..29509970)
FT                   /codon_start=1
FT                   /gene="Ube2j1"
FT                   /locus_tag="mCG_12755"
FT                   /product="ubiquitin-conjugating enzyme E2, J1"
FT                   /note="gene_id=mCG12755.2 transcript_id=mCT13473.2
FT                   protein_id=mCP20487.2"
FT                   /protein_id="EDL05493.1"
FT                   /translation="METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTV
FT                   RGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQP
FT                   SWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPL
FT                   KSGSGSSQADQEAKELARQISFKAEVNSSGKTIAESDLNQCFSLNDSQDDLPTTFQGAT
FT                   ASTSYGAQNPSGAPLPQPTQPAPKNTSMSPRQRRAQQQSQRRPSTSPDVLQGQPPRAHH
FT                   TEHGGSAMLIIILTLALAALIFRRIYLANEYIFDFEL"
FT   assembly_gap    29517445..29517709
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   gene            29523081..29560521
FT                   /locus_tag="mCG_12753"
FT                   /note="gene_id=mCG12753.2"
FT   mRNA            join(29523081..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29543195..29543335,29545331..29545471,29548235..29548387,
FT                   29549978..29550174,29559646..29560520)
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, transcript variant mCT13471"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT13471.2 created
FT                   on 08-APR-2002"
FT   mRNA            join(29523082..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29545331..29545471,29548235..29548387,29549978..29550174,
FT                   29559646..29560521)
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, transcript variant mCT167819"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT167819.0 created
FT                   on 08-APR-2002"
FT   mRNA            join(<29523209..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29543195..29543335,29545002..29545154,29549978..29550174,
FT                   29559646..29560235)
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, transcript variant mCT189838"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT189838.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<29523210..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29543195..29543335,29545002..29545154,29549978..29550174,
FT                   29559646..29559957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, isoform CRA_b"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT189838.0
FT                   protein_id=mCP110815.0 isoform=CRA_b"
FT                   /protein_id="EDL05491.1"
FT                   /translation="ALTASQRSADQRLEAGSMVKPGGILPIKSPCTAACCIIDMCRMPY
FT                   LMRLALVLFCLMALVESRKPRRKRWTGLLETSKPSHLYKKNLDVTKMRPGKPRPLLRVE
FT                   DHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWRDERLAFPSSSNK
FT                   SMTFDGRLVKKIWVPDVFFVHSKRSFIHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
FT                   DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRL
FT                   AFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPARVSLGI
FT                   MTVLTMSTIITGVNASMPRVSYIRAVDIYLWVSFVFVFLSVLEYAAVNYLTTLQEQKER
FT                   KFREKLPCMCGMLHSRTMMLDGSYSESEANSLAGYPRSHILPEEERPDNIVVHLALNSE
FT                   LTSSRKKGLLKGQMGLYIFQNTHAIDKYSRLIFPAFYIVFNLIYWSVFS"
FT   CDS             join(29523261..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29545331..29545471,29548235..29548387,29549978..29550174,
FT                   29559646..29559957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, isoform CRA_c"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT167819.0
FT                   protein_id=mCP90828.0 isoform=CRA_c"
FT                   /db_xref="GOA:P56476"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008057"
FT                   /db_xref="InterPro:IPR008059"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95626"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56476"
FT                   /protein_id="EDL05492.1"
FT                   /translation="MVKPGGILPIKSPCTAACCIIDMCRMPYLMRLALVLFCLMALVES
FT                   RKPRRKRWTGLLETSKPSHLYKKNLDVTKMRPGKPRPLLRVEDHDFTMRPAFGGPAIPV
FT                   GVDVQVESLDSISEVDMDFTMTLYLRHYWRDERLAFPSSSNKSMTFDGRLVKKIWVPDV
FT                   FFVHSKRSFIHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNMDFSHFPLDSQTCSLELE
FT                   SYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLAFYSSTGWYNRLYINFT
FT                   LRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPARVSLGIMTVLTMSTIITGVNASM
FT                   PRVSYIRAVDIYLWVSFVFVFLSVLEYAAVNYLTTLQEQKERKFREKLPCMCGMLHSRT
FT                   MMLDGSYSESEANSLAGYPRSHILPEEERPDNIVVHLALNSELTSSRKKGLLKGQMGLY
FT                   IFQNTHAIDKYSRLIFPAFYIVFNLIYWSVFS"
FT   CDS             join(29523336..29523448,29531812..29531918,
FT                   29538090..29538157,29541976..29542199,29542926..29543008,
FT                   29543195..29543335,29545331..29545471,29548235..29548387,
FT                   29549978..29550174,29559646..29559957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12753"
FT                   /product="mCG12753, isoform CRA_a"
FT                   /note="gene_id=mCG12753.2 transcript_id=mCT13471.2
FT                   protein_id=mCP20486.2 isoform=CRA_a"
FT                   /protein_id="EDL05490.1"
FT                   /translation="MPYLMRLALVLFCLMALVESRKPRRKRWTGLLETSKPSHLYKKNL
FT                   DVTKMRPGKPRPLLRVEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYL
FT                   RHYWRDERLAFPSSSNKSMTFDGRLVKKIWVPDVFFVHSKRSFIHDTTTDNIMLRVFPD
FT                   GHVLYSMRITVTAMCNMDFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEK
FT                   ISLSQFLIQKFHTTSRLAFYSSTDAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFH
FT                   TTSRLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPAR
FT                   VSLGIMTVLTMSTIITGVNASMPRVSYIRAVDIYLWVSFVFVFLSVLEYAAVNYLTTLQ
FT                   EQKERKFREKLPCMCGMLHSRTMMLDGSYSESEANSLAGYPRSHILPEEERPDNIVVHL
FT                   ALNSELTSSRKKGLLKGQMGLYIFQNTHAIDKYSRLIFPAFYIVFNLIYWSVFS"
FT   assembly_gap    29525829..29526300
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    29533853..29534052
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    29535644..29535663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29536808..29536827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29538855..29539064
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    29541233..29541440
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    29545187..29545206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29547130..29547856
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    29549181..29549200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29558875..29558958
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    29561404..29561736
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    29566582..29568938
FT                   /estimated_length=2357
FT                   /gap_type="unknown"
FT   assembly_gap    29571374..29571393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29573000..29573019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29574920..29574939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29576063..29576082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29578789..29578808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29580239..29580486
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    29582362..29582381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29589617..29589636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29590954..29590973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29592469..29592488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29593587..29593606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29594873..29595687
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   gene            29603131..29633996
FT                   /locus_tag="mCG_12769"
FT                   /note="gene_id=mCG12769.1"
FT   mRNA            join(29603131..29603350,29617497..29617550,
FT                   29619346..29619452,29621797..29621864,29622860..29623083,
FT                   29627461..29627543,29628438..29628578,29630518..29630670,
FT                   29632031..29632227,29632994..29633996)
FT                   /locus_tag="mCG_12769"
FT                   /product="mCG12769"
FT                   /note="gene_id=mCG12769.1 transcript_id=mCT13486.1 created
FT                   on 30-JUL-2002"
FT   CDS             join(29603247..29603350,29617497..29617550,
FT                   29619346..29619452,29621797..29621864,29622860..29623083,
FT                   29627461..29627543,29628438..29628578,29630518..29630670,
FT                   29632031..29632227,29632994..29633287)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12769"
FT                   /product="mCG12769"
FT                   /note="gene_id=mCG12769.1 transcript_id=mCT13486.1
FT                   protein_id=mCP20488.2"
FT                   /protein_id="EDL05489.1"
FT                   /translation="MKFGIFLLWWGWVLAAESTAHWPGREVHEPSRKGSRPQRQRRGAH
FT                   DDAHKQGSPILRRSSDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLD
FT                   SISEVDMDFTMTLYLRHYWKDERLSFPSSNNLSMTFDGRLVKKIWVPDMFFVHSKRSFI
FT                   HDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLM
FT                   LYWKKGNDSLKTDERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLL
FT                   QTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVD
FT                   IYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLREKISCTCGLPQPRGVMLDSSYSDG
FT                   EVNDLGGYMPENGEKPDRMMVQLTLASERGSPQRKGQRGSYVSMRINTHAIDKYSRIIF
FT                   PAAYILFNLIYWSIFS"
FT   assembly_gap    29615594..29615637
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    29618660..29618679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29632745..29632845
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(29652035..29660156)
FT                   /gene="Acy1l2"
FT                   /locus_tag="mCG_123466"
FT                   /note="gene_id=mCG123466.1"
FT   mRNA            complement(join(29652035..29652274,29653492..29653634,
FT                   29657467..29657615,29659350..29660156))
FT                   /gene="Acy1l2"
FT                   /locus_tag="mCG_123466"
FT                   /product="aminoacylase 1-like 2"
FT                   /note="gene_id=mCG123466.1 transcript_id=mCT124699.1
FT                   created on 01-FEB-2003"
FT   CDS             complement(join(29652099..29652274,29653492..29653634,
FT                   29657467..29657615,29659350..29659799))
FT                   /codon_start=1
FT                   /gene="Acy1l2"
FT                   /locus_tag="mCG_123466"
FT                   /product="aminoacylase 1-like 2"
FT                   /note="gene_id=mCG123466.1 transcript_id=mCT124699.1
FT                   protein_id=mCP68115.1"
FT                   /protein_id="EDL05488.1"
FT                   /translation="MGPVVERPAEPGTSSAAELELLKRRAAERIDEAAERLGALSRAIW
FT                   SAPELAYEEHRAHGELTRFFECEPPAASWAVQPHFGLPTAFRAEWAPPESAAGPRALQV
FT                   AFLCEYDALPALGHACGHNLIAEVGVAAALGLRAALESIAAPPPVKVIVLGTPAEEDGG
FT                   GKIDLIEAGAFENLDVVFMAHPSQENAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNA
FT                   LDAAVLAYTNLSVLRQQMKPTWRVHGIIKNGGVKPNIIPSYSELVYYFRAPSMKELQVL
FT                   TKKAEDCFRAAALATGCTVRAFQN"
FT   assembly_gap    29662863..29662882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29666451..29666470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29679224..29679243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            29679407..29704011
FT                   /gene="Srrp"
FT                   /locus_tag="mCG_49339"
FT                   /note="gene_id=mCG49339.2"
FT   mRNA            join(29679407..29679787,29696636..29696777,
FT                   29701595..29704011)
FT                   /gene="Srrp"
FT                   /locus_tag="mCG_49339"
FT                   /product="serine-arginine repressor protein"
FT                   /note="gene_id=mCG49339.2 transcript_id=mCT49522.1 created
FT                   on 29-JAN-2003"
FT   CDS             join(29679499..29679787,29696636..29696777,
FT                   29701595..29701964)
FT                   /codon_start=1
FT                   /gene="Srrp"
FT                   /locus_tag="mCG_49339"
FT                   /product="serine-arginine repressor protein"
FT                   /note="gene_id=mCG49339.2 transcript_id=mCT49522.1
FT                   protein_id=mCP40625.1"
FT                   /protein_id="EDL05487.1"
FT                   /translation="MRSFSGAVWERQVSLGAPSWPAAMGDRIYSLEARAVARSVLARPR
FT                   RPRAPRPRLRLRGRPGRGRGGLLGAGPREACLATPGPPTPPCSSGTSQTPPAPGQMKSK
FT                   ERHLCSPSDHRRSRSPSQRRSRSRSSSWGRDRRHSDSLKESRHRRSSYSQSKSRSKSLP
FT                   RQSTSLRQSRTPRRNSGSRGRSRSKSLPKRSKSMEKSQSRSPQKQTGSGAKSRPHGRHC
FT                   DSIARSPCKSPRAYTSSGSKTQTTKHSHLRSHSRSRSYHHKNSW"
FT   assembly_gap    29695525..29695719
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    29700711..29700833
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    29710553..29711734
FT                   /estimated_length=1182
FT                   /gap_type="unknown"
FT   gene            complement(29715944..29719348)
FT                   /locus_tag="mCG_12570"
FT                   /note="gene_id=mCG12570.2"
FT   mRNA            complement(join(29715944..29717216,29718657..29719348))
FT                   /locus_tag="mCG_12570"
FT                   /product="mCG12570"
FT                   /note="gene_id=mCG12570.2 transcript_id=mCT13264.2 created
FT                   on 08-JAN-2003"
FT   CDS             complement(join(29716773..29717216,29718657..29719106))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12570"
FT                   /product="mCG12570"
FT                   /note="gene_id=mCG12570.2 transcript_id=mCT13264.2
FT                   protein_id=mCP20465.1"
FT                   /db_xref="GOA:Q3TWH3"
FT                   /db_xref="InterPro:IPR026780"
FT                   /db_xref="MGI:MGI:1917838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TWH3"
FT                   /protein_id="EDL05486.1"
FT                   /translation="MTVVSVPQRDLALSGRLAPLGFLGALPMVNPAPPPLPRLPDPRAL
FT                   PPTLFLPHFLGGDGPCLAPAPRTTAPSGCTLAPAAAPRAAPKKRRKKKVRASPAGQLPS
FT                   RFHQFQQHRPSLEGGRSPAPGPIVAQEERGLAATALLHRQPPLAKEVLKSKMGKSEKIA
FT                   LPHSQLVHGIHLCEQPKINRQKSKYNLPLTKITSAKRNESDFWQDSASSDRMQKQEKKS
FT                   FKNTENIKSNHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHWMGSTAENPSQS
FT                   RELMAVHLKTLLKVQT"
FT   assembly_gap    29731090..29731594
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    29739785..29739958
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    29746059..29746078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(29774658..29781218)
FT                   /locus_tag="mCG_147150"
FT                   /note="gene_id=mCG147150.0"
FT   mRNA            complement(join(29774658..29776067,29781092..29781218))
FT                   /locus_tag="mCG_147150"
FT                   /product="mCG147150"
FT                   /note="gene_id=mCG147150.0 transcript_id=mCT187413.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(29774691..29774888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147150"
FT                   /product="mCG147150"
FT                   /note="gene_id=mCG147150.0 transcript_id=mCT187413.0
FT                   protein_id=mCP108345.0"
FT                   /protein_id="EDL05485.1"
FT                   /translation="MLGLENGTIRRCALVGGSVSLWRWAMRPPPNHVGVRRRCRTLSSS
FT                   CTMPAWMLPCSHFDDNGLNL"
FT   gene            29781406..29974596
FT                   /gene="Rngtt"
FT                   /locus_tag="mCG_123462"
FT                   /note="gene_id=mCG123462.1"
FT   mRNA            join(29781406..29781604,29791838..29791947,
FT                   29796432..29796535,29796617..29796705,29801112..29801187,
FT                   29802434..29802674,29809435..29809544,29810563..29810664,
FT                   29827638..29827773,29834365..29834436,29840050..29840214,
FT                   29850939..29851007,29875708..29875808,29915446..29915512,
FT                   29970939..29971062,29972226..29973236,29973267..29974596)
FT                   /gene="Rngtt"
FT                   /locus_tag="mCG_123462"
FT                   /product="RNA guanylyltransferase and 5'-phosphatase,
FT                   transcript variant mCT124695"
FT                   /note="gene_id=mCG123462.1 transcript_id=mCT124695.1
FT                   created on 03-JAN-2003"
FT   mRNA            join(29781406..29781604,29791838..29791947,
FT                   29796432..29796535,29796617..29796705,29801112..29801187,
FT                   29802434..29802674,29809435..29809544,29810563..29810664,
FT                   29827638..29827773,29834365..29834436,29840050..29840214,
FT                   29850939..29851007,29875708..29875808,29915446..29915512,
FT                   29970939..29971062,29972287..29972902)
FT                   /gene="Rngtt"
FT                   /locus_tag="mCG_123462"
FT                   /product="RNA guanylyltransferase and 5'-phosphatase,
FT                   transcript variant mCT178122"
FT                   /note="gene_id=mCG123462.1 transcript_id=mCT178122.0
FT                   created on 03-JAN-2003"
FT   CDS             join(29781541..29781604,29791838..29791947,
FT                   29796432..29796535,29796617..29796705,29801112..29801187,
FT                   29802434..29802674,29809435..29809544,29810563..29810664,
FT                   29827638..29827773,29834365..29834436,29840050..29840214,
FT                   29850939..29851007,29875708..29875808,29915446..29915512,
FT                   29970939..29971062,29972287..29972402)
FT                   /codon_start=1
FT                   /gene="Rngtt"
FT                   /locus_tag="mCG_123462"
FT                   /product="RNA guanylyltransferase and 5'-phosphatase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123462.1 transcript_id=mCT178122.0
FT                   protein_id=mCP101044.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DCC1"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017074"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1329041"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DCC1"
FT                   /protein_id="EDL05483.1"
FT                   /translation="MAYNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRF
FT                   HPSMLSNYLKSLKVKMSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTE
FT                   TFIRLCERFNERSPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPG
FT                   IYKGDYLKELFRRYGDIEEAPPPPVLPDWCFEDEDEEDEDEDGKKDSEPGSSASFSKRR
FT                   KERLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNI
FT                   RLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNT
FT                   LLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTG
FT                   LIDKTQEPFSVRPKQFFDINISRKLLEGNFAKEVSHEMDGLIFQPIGKYKPGRCDDILK
FT                   WKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIEC
FT                   KFENNSWVFMRQRIDKSFPNAYNTAMDVQQPPRDRSGSIPWTLTRSSCRPHRPKDCIGQ
FT                   PSPCL"
FT   CDS             join(29781541..29781604,29791838..29791947,
FT                   29796432..29796535,29796617..29796705,29801112..29801187,
FT                   29802434..29802674,29809435..29809544,29810563..29810664,
FT                   29827638..29827773,29834365..29834436,29840050..29840214,
FT                   29850939..29851007,29875708..29875808,29915446..29915512,
FT                   29970939..29971062,29972226..29972389)
FT                   /codon_start=1
FT                   /gene="Rngtt"
FT                   /locus_tag="mCG_123462"
FT                   /product="RNA guanylyltransferase and 5'-phosphatase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123462.1 transcript_id=mCT124695.1
FT                   protein_id=mCP67802.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UA94"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017074"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1329041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UA94"
FT                   /protein_id="EDL05484.1"
FT                   /translation="MAYNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRF
FT                   HPSMLSNYLKSLKVKMSLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTE
FT                   TFIRLCERFNERSPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPG
FT                   IYKGDYLKELFRRYGDIEEAPPPPVLPDWCFEDEDEEDEDEDGKKDSEPGSSASFSKRR
FT                   KERLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNI
FT                   RLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNT
FT                   LLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTG
FT                   LIDKTQEPFSVRPKQFFDINISRKLLEGNFAKEVSHEMDGLIFQPIGKYKPGRCDDILK
FT                   WKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIEC
FT                   KFENNSWVFMRQRIDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCAAAAQGQKRKY
FT                   PLDPDTELMPPPPPKRLHRPT"
FT   assembly_gap    29786064..29786250
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    29793819..29793838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29798155..29798174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29841144..29841196
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    29880078..29880097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29890294..29890372
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    29925559..29925592
FT