
ID   CH466537; SV 1; linear; genomic DNA; CON; MUS; 38648868 BP.
AC   CH466537;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
DE   Mus musculus 232000009836019 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-38648868
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-38648868
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; c835dbb7ce67de85876f3e3ba5c83175.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000225.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000002379; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002658; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019489; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024151; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024164; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024256; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034116; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049672; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061062; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091636; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023933; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023935; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023936; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023938; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023947; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023948; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023956; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023957; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023959; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023962; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023970; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023983; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023989; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023997; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023998; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024000; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024003; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024018; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024041; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024052; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024053; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024057; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024069; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024079; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024081; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024085; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024087; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024092; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024099; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024100; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024105; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024114; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023891; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023893; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023894; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023905; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023906; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023914; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023915; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023917; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023920; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023928; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023947; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023955; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023956; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023958; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023961; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023976; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023998; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024009; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024027; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024040; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024046; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024058; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024059; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024064; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024077; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023860; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023862; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023863; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023865; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023874; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023875; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023883; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023886; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023889; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023897; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023916; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023924; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023925; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023927; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023930; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023945; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023967; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023978; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023979; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023983; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023996; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024007; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024009; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024013; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024015; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024043; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024046; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023892; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023894; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023895; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023897; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023906; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023907; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023915; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023916; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023918; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023921; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023929; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023942; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023948; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023956; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023957; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023959; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023962; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023977; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024000; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024011; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024012; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024016; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024029; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024039; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024041; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024045; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024047; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024052; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024060; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024065; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024075; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024078; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023656; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023658; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023661; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023670; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023671; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023679; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023680; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023682; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023685; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023693; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023706; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023712; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023720; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023721; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023723; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023726; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023764; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023775; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023776; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023780; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023793; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023804; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023806; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023824; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023825; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023830; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023840; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023843; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024338; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024340; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024341; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024343; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024352; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024353; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024361; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024362; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024364; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024367; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024375; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024394; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024402; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024403; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024405; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024408; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024423; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024445; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024460; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024484; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024486; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024490; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024492; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024497; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024504; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024505; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024510; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024520; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024523; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023138; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023140; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023143; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023152; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023153; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023161; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023162; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023164; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023167; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023175; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023188; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023194; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023202; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023204; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023207; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023255; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023256; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023260; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023272; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023283; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023285; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023289; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023296; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023303; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023304; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023310; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023319; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023322; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027955; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023632; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023634; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023646; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023655; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023656; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023658; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023661; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023669; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023682; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023688; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023696; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023698; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023701; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023716; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023738; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023750; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023754; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023767; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023784; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023791; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023798; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023804; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023813; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023817; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023762; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023763; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023765; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023774; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023783; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023784; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023786; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023789; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023797; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023810; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023816; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023824; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023825; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023827; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023830; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023845; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023867; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023878; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023879; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023883; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023896; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023906; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023908; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023912; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023914; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023919; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023926; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023927; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023932; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023945; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023726; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023728; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023729; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023731; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023741; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023749; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023750; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023752; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023755; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023763; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023776; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023782; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023790; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023791; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023793; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023796; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023811; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023833; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023844; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023845; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023849; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023862; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023872; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023874; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023878; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023880; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023892; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023893; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023898; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023908; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023911; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023842; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023844; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023847; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023856; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023857; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023865; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023866; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023868; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023871; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023892; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023898; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023906; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023907; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023909; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023912; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023927; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023950; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023962; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023966; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023979; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023990; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023992; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023996; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023998; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024003; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024010; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024011; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024016; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024026; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024029; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023754; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023756; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023757; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023759; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023768; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023769; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023778; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023780; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023783; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023791; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023804; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023810; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023818; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023819; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023821; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023824; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023839; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023861; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023872; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023873; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023900; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023902; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023906; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023913; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023921; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023926; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023936; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023939; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024382; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024384; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024385; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024387; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024396; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024397; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024405; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024406; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024408; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024411; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024432; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024438; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024446; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024449; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024452; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024467; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024489; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024500; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024505; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024518; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024535; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024537; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024542; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024549; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024550; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024565; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024568; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022884; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022886; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022887; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022889; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022898; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022907; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022908; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022913; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022921; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022934; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022940; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022948; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022950; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022953; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022968; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022990; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023001; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023006; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023018; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023028; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023030; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023034; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023036; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023041; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023048; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023049; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023054; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023064; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023067; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023204; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023206; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023207; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023209; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023218; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023219; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023227; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023228; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023230; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023233; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023241; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023254; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023260; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023269; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023271; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023274; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023289; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023311; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023322; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023323; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023327; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023340; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023349; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023351; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023355; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023357; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023362; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023369; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023370; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023375; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023385; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023386; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023388; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000002452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002733; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024761; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170759; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177425; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048309; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048312; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048314; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048316; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048330; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048331; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048349; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048350; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048352; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048359; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048378; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048415; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048445; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048462; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048463; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048480; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048496; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048550; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048618; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048645; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048646; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048658; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048675; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048703; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048735; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048746; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048747; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048773; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048806; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048835; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048293; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048295; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048313; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048314; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048334; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048335; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048343; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048362; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048428; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048446; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048463; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048479; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048533; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048596; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048623; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048624; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048636; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048654; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048682; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048684; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048701; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048704; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048715; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048751; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048783; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048812; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048252; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048254; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048256; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048258; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048273; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048274; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048292; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048293; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048295; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048302; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048321; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048355; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048385; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048402; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048403; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048420; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048436; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048491; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048556; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048584; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048585; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048597; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048616; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048644; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048646; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048661; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048664; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048675; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048686; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048687; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048711; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048743; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0048772; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048255; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048257; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048259; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048261; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048275; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048276; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048294; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048295; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048297; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048303; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048322; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048358; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048388; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048406; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048423; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048439; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048493; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048557; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048585; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048597; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048615; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048643; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048645; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048661; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048664; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048675; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048686; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048687; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048712; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048745; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048774; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047997; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048000; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048002; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048004; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048019; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048020; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048038; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048039; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048041; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048048; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048067; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048151; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048185; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048302; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048330; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048331; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048343; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048362; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048390; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048392; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048406; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048420; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048431; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048456; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048488; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048744; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048746; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048748; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048750; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048764; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048765; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048783; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048784; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048786; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048792; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048879; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048897; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048900; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048917; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048933; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048988; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049052; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049078; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049079; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049091; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049108; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049136; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049138; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049152; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049155; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049167; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049179; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049204; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049237; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049238; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049266; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048058; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048061; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048063; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048065; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048079; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048080; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048098; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048099; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048101; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048127; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048168; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048200; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048220; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048255; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048310; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048401; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048414; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048434; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048467; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048484; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048487; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048499; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048510; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048511; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048538; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048569; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048598; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068085; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047925; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047927; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047929; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047931; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047945; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047946; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047964; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047965; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047967; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047974; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0047993; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048029; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048059; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048093; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048109; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048225; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048253; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048254; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048266; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048287; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048316; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048318; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048332; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048335; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048346; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048359; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048383; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048415; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0048445; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048026; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048028; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048030; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048045; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048064; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048065; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048074; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048093; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048158; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048176; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048177; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048195; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048211; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048266; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048329; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048358; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048370; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048418; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048420; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048434; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048437; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048448; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048459; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048460; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048484; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0048546; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047991; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0047993; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0047995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0047997; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048012; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048013; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048032; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048034; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048041; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048060; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048096; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048126; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048145; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048162; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048178; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048232; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048296; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048323; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048324; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048336; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048354; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048382; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048384; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048401; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048404; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048416; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048427; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048428; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048453; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048486; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0048515; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048136; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048140; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048142; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048156; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048157; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048175; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048176; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048178; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048185; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048240; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048270; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048287; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048306; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048376; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048442; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048483; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048531; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048533; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048549; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048552; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048564; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048575; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048576; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048601; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048634; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0048663; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048000; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048002; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048004; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048018; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048019; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048037; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048038; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048040; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048047; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048066; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048101; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048131; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048149; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048167; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048183; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048237; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048301; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048329; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048341; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048359; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048386; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048388; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048404; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048407; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048430; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048431; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048456; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048490; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048519; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048840; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048842; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048844; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048846; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048860; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048861; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048879; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048882; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048888; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048944; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048974; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048993; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048994; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049011; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049147; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049174; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049186; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049204; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049233; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049235; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049255; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049267; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049278; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049279; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049304; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049337; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049366; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047645; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047648; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047650; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047652; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047666; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047667; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047685; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047686; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047688; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047715; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047756; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047787; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047808; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047827; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047843; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047992; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047993; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048007; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048029; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048062; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048064; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048082; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048086; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048098; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048109; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048110; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048136; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048197; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047302; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047305; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047307; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047309; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047323; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047324; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047342; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047343; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047345; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047352; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047371; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047407; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047437; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047456; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047473; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047542; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047605; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047632; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047633; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047645; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047690; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047692; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047708; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047711; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047723; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047734; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047735; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047759; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047791; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047792; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047820; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..38648868
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<1247..>7910)
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /note="gene_id=mCG22968.1"
FT   mRNA            complement(join(<1247..1332,1485..1683,2831..2913,
FT                   7770..>7910))
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   transcript variant mCT22627"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT22627.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<1247..1332,1485..1683,2831..2913,
FT                   7770..>7908))
FT                   /codon_start=1
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT22627.1
FT                   protein_id=mCP9055.1 isoform=CRA_a"
FT                   /protein_id="EDL38158.1"
FT                   QPTEKV"
FT   mRNA            complement(join(<1248..1332,1485..1683,2831..2913,
FT                   5491..>5549))
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   transcript variant mCT170638"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT170638.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<1248..1332,1485..1683,2831..2913,
FT                   5491..>5548))
FT                   /codon_start=1
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT170638.0
FT                   protein_id=mCP93556.0 isoform=CRA_b"
FT                   /protein_id="EDL38159.1"
FT   gene            complement(9147..>15280)
FT                   /locus_tag="mCG_22963"
FT                   /note="gene_id=mCG22963.1"
FT   mRNA            complement(join(9147..9701,12864..13069,15028..>15280))
FT                   /locus_tag="mCG_22963"
FT                   /product="mCG22963"
FT                   /note="gene_id=mCG22963.1 transcript_id=mCT22623.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(9183..9701,12864..13069,15028..15280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22963"
FT                   /product="mCG22963"
FT                   /note="gene_id=mCG22963.1 transcript_id=mCT22623.1
FT                   protein_id=mCP9071.0"
FT                   /protein_id="EDL38160.1"
FT   gene            <18463..>33421
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /note="gene_id=mCG22967.1"
FT   mRNA            join(<18463..18598,20123..20287,24374..24616,25713..25873,
FT                   27091..27306,27901..28004,28078..28288,30229..30352,
FT                   30436..30543,30814..30918,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT15422"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT15422.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(<18479..18598,20123..20287,24374..24616,25713..25873,
FT                   27091..27306,27901..28004,28078..28288,30229..30352,
FT                   30436..30543,30814..30918,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_a"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT15422.1
FT                   protein_id=mCP9087.1 isoform=CRA_a"
FT                   /protein_id="EDL38161.1"
FT   mRNA            join(<19375..19430,20123..20287,24374..>24611)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT170637"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170637.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<19377..19430,20123..20287,24374..>24611)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_c"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170637.0
FT                   protein_id=mCP93554.0 isoform=CRA_c"
FT                   /protein_id="EDL38163.1"
FT   mRNA            join(<19405..19430,20123..20136,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT170636"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170636.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<19406..19430,20123..20136,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_b"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170636.0
FT                   protein_id=mCP93555.0 isoform=CRA_b"
FT                   /protein_id="EDL38162.1"
FT   assembly_gap    34954..53442
FT                   /estimated_length=18489
FT                   /gap_type="unknown"
FT   gene            58608..109808
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /note="gene_id=mCG22918.1"
FT   mRNA            join(58608..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101708..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106793,106888..107007,108162..108254,
FT                   108485..109808)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT22620"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT22620.2 created
FT                   on 09-AUG-2002"
FT   mRNA            join(<58609..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101729..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106739,108162..108254,108485..109798)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT193699"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT193699.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<58618..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101729..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106739,108162..108254,108485..108667)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_b"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT193699.0
FT                   protein_id=mCP114656.0 isoform=CRA_b"
FT                   /protein_id="EDL38165.1"
FT   CDS             join(58636..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101708..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106793,106888..107007,108162..108254,
FT                   108485..108667)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_c"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT22620.2
FT                   protein_id=mCP9075.2 isoform=CRA_c"
FT                   /protein_id="EDL38166.1"
FT   mRNA            join(58698..58776,59955..60005,82950..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..>100727)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT171417"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT171417.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(58699..58776,59955..60005,82950..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..>100727)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_a"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT171417.0
FT                   protein_id=mCP94336.0 isoform=CRA_a"
FT                   /protein_id="EDL38164.1"
FT                   KTPSPSSP"
FT   gene            complement(119361..183398)
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /note="gene_id=mCG22917.2"
FT   mRNA            complement(join(119361..120332,120668..120803,
FT                   120890..121044,121622..121747,121824..121950,
FT                   123820..123998,124165..124450,124530..124684,
FT                   125650..125769,125849..126024,126343..126466,
FT                   126562..126659,128179..128291,128772..128783,
FT                   129068..129225,130122..130337,130433..130526,
FT                   130964..131217,131819..131916,132266..132865,
FT                   133326..133443,134878..135071,135791..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165399,
FT                   183369..183398))
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   transcript variant mCT22619"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT22619.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(120264..120332,120668..120803,
FT                   120890..121044,121622..121747,121824..121950,
FT                   123820..123998,124165..124450,124530..124684,
FT                   125650..125769,125849..126024,126343..126466,
FT                   126562..126659,128179..128291,128772..128783,
FT                   129068..129225,130122..130337,130433..130526,
FT                   130964..131217,131819..131916,132266..132865,
FT                   133326..133443,134878..135071,135791..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165304))
FT                   /codon_start=1
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT22619.2
FT                   protein_id=mCP9091.2 isoform=CRA_b"
FT                   /protein_id="EDL38168.1"
FT   mRNA            complement(join(129176..129225,130122..130337,
FT                   130433..130526,130964..131217,131819..131916,
FT                   136038..136096,141472..141616,141900..142033,
FT                   142629..143210,144806..145075,154382..154492,
FT                   158674..158862,161209..161350,161896..162041,
FT                   165214..165399,183369..183398))
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   transcript variant mCT171416"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT171416.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(131893..131916,136038..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165304))
FT                   /codon_start=1
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT171416.0
FT                   protein_id=mCP94335.0 isoform=CRA_a"
FT                   /protein_id="EDL38167.1"
FT   assembly_gap    136161..136180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <215319..215828
FT                   /locus_tag="mCG_1039422"
FT                   /note="gene_id=mCG1039422.1"
FT   mRNA            join(<215319..215442,215799..215828)
FT                   /locus_tag="mCG_1039422"
FT                   /product="mCG1039422"
FT                   /note="gene_id=mCG1039422.1 transcript_id=mCT157126.1
FT                   created on 09-AUG-2002"
FT   CDS             <215320..215397
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039422"
FT                   /product="mCG1039422"
FT                   /note="gene_id=mCG1039422.1 transcript_id=mCT157126.1
FT                   protein_id=mCP71357.1"
FT                   /protein_id="EDL38169.1"
FT                   /translation="FPIVKNTGANRSGGQARLSERLSLL"
FT   gene            complement(218019..>219260)
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /note="gene_id=mCG22916.1"
FT   mRNA            complement(218019..>219260)
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /product="zinc and ring finger 4"
FT                   /note="gene_id=mCG22916.1 transcript_id=mCT22618.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(218093..>219259)
FT                   /codon_start=1
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /product="zinc and ring finger 4"
FT                   /note="gene_id=mCG22916.1 transcript_id=mCT22618.1
FT                   protein_id=mCP9090.1"
FT                   /protein_id="EDL38170.1"
FT   assembly_gap    222778..223219
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    228842..229087
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    230271..231305
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    238642..240191
FT                   /estimated_length=1550
FT                   /gap_type="unknown"
FT   gene            complement(256431..>259854)
FT                   /locus_tag="mCG_56863"
FT                   /note="gene_id=mCG56863.1"
FT   mRNA            complement(join(256431..258404,258857..258970,
FT                   259526..>259854))
FT                   /locus_tag="mCG_56863"
FT                   /product="mCG56863"
FT                   /note="gene_id=mCG56863.1 transcript_id=mCT57046.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(258967..258970,259526..>259854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56863"
FT                   /product="mCG56863"
FT                   /note="gene_id=mCG56863.1 transcript_id=mCT57046.2
FT                   protein_id=mCP38800.2"
FT                   /protein_id="EDL38171.1"
FT                   LLSDTR"
FT   gene            complement(268349..>289931)
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /note="gene_id=mCG5574.3"
FT   mRNA            complement(join(268349..268839,268920..269032,
FT                   269912..270042,270627..270669,271353..271490,
FT                   271734..272024,272287..272426,272941..273032,
FT                   274303..274430,276665..276727,276808..276957,
FT                   280311..280360,282286..282313,283251..283313,
FT                   284045..284252,284329..284393,288392..288479,
FT                   289682..>289920))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT193677"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT193677.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(268356..268651,268770..268839,
FT                   268920..269032,269912..270042,270627..270669,
FT                   271353..271490,271734..272024,272287..272423,
FT                   272941..273032,274303..274430,276618..276727,
FT                   276808..276957,279610..279710,280311..280360,
FT                   280763..281420,282286..282313,283251..283313,
FT                   284049..284252,284329..284393,288392..288479,
FT                   289682..>289931))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT3944"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT3944.2 created on
FT                   09-AUG-2002"
FT   mRNA            complement(join(268356..268651,268770..268839,
FT                   268920..268983,277784..>277906))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT171418"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT171418.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(268507..268651,268770..268839,
FT                   268920..269032,269912..270042,270627..270669,
FT                   271353..271490,271734..272024,272287..272423,
FT                   272941..273032,274303..274430,276618..276727,
FT                   276808..276957,279610..279710,280311..280360,
FT                   280763..281420,282286..282313,283251..283313,
FT                   284049..284252,284329..284393,288392..288479,
FT                   289682..>289930))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_b"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT3944.2
FT                   protein_id=mCP18173.2 isoform=CRA_b"
FT                   /protein_id="EDL38173.1"
FT   CDS             complement(join(268507..268651,268770..268839,
FT                   268920..268983,277784..>277906))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_c"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT171418.0
FT                   protein_id=mCP94337.0 isoform=CRA_c"
FT                   /protein_id="EDL38174.1"
FT   CDS             complement(join(268766..268839,268920..269032,
FT                   269912..270042,270627..270669,271353..271490,
FT                   271734..272024,272287..272426,272941..273032,
FT                   274303..274430,276665..276727,276808..>276821))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_a"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT193677.0
FT                   protein_id=mCP114665.0 isoform=CRA_a"
FT                   /protein_id="EDL38172.1"
FT                   AAGRGGMAG"
FT   gene            290235..311681
FT                   /locus_tag="mCG_127409"
FT                   /note="gene_id=mCG127409.1"
FT   mRNA            join(290235..290762,294194..294278,299101..299165,
FT                   299246..299452,301063..301125,303199..303226,
FT                   304055..304631,305034..305083,305749..305843,
FT                   306233..306382,306459..306541,306638..306777,
FT                   306854..306942,308288..308394,308943..309233,
FT                   309557..309694,309777..309819,310695..310810,
FT                   310956..311056,311196..311262,311375..311681)
FT                   /locus_tag="mCG_127409"
FT                   /product="mCG127409"
FT                   /note="gene_id=mCG127409.1 transcript_id=mCT128732.1
FT                   created on 09-AUG-2002"
FT   CDS             join(290574..290762,294194..294278,299101..299165,
FT                   299246..299452,301063..301125,303199..303226,
FT                   304055..304631,305034..305083,305749..305843,
FT                   306233..306382,306459..306541,306638..306777,
FT                   306854..306942,308288..308394,308943..309233,
FT                   309557..309694,309777..309819,310695..310810,
FT                   310956..311056,311196..311262,311375..311504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127409"
FT                   /product="mCG127409"
FT                   /note="gene_id=mCG127409.1 transcript_id=mCT128732.1
FT                   protein_id=mCP71130.1"
FT                   /db_xref="GOA:D3YXK2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034781"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="MGI:MGI:2146974"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YXK2"
FT                   /protein_id="EDL38175.1"
FT                   ARFTRRY"
FT   gene            complement(312357..315226)
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /note="gene_id=mCG5602.1"
FT   mRNA            complement(join(312357..313240,314037..314091,
FT                   314245..314422,315039..315226))
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, transcript variant
FT                   mCT3915"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT3915.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(<313087..313196,314060..314091,
FT                   314245..314422,315039..315070))
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, transcript variant
FT                   mCT171804"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT171804.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(<313087..313196,314060..314091,
FT                   314245..314422,315039..315067))
FT                   /codon_start=1
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, isoform CRA_b"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT171804.0
FT                   protein_id=mCP94723.0 isoform=CRA_b"
FT                   /protein_id="EDL38177.1"
FT                   HYGGQDQDGRDI"
FT   CDS             complement(join(313143..313240,314037..314091,
FT                   314245..314422,315039..315067))
FT                   /codon_start=1
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, isoform CRA_a"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT3915.2
FT                   protein_id=mCP18142.1 isoform=CRA_a"
FT                   /protein_id="EDL38176.1"
FT                   EYSKEGWEYLKEHSK"
FT   gene            <318815..319646
FT                   /locus_tag="mCG_5564"
FT                   /note="gene_id=mCG5564.2"
FT   mRNA            join(<318815..318847,318980..319079,319306..319440,
FT                   319523..319646)
FT                   /locus_tag="mCG_5564"
FT                   /product="mCG5564"
FT                   /note="gene_id=mCG5564.2 transcript_id=mCT3955.2 created on
FT                   17-JUL-2002"
FT   CDS             join(<318816..318847,318980..319079,319306..319440,
FT                   319523..319612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5564"
FT                   /product="mCG5564"
FT                   /note="gene_id=mCG5564.2 transcript_id=mCT3955.2
FT                   protein_id=mCP18145.2"
FT                   /protein_id="EDL38178.1"
FT                   NVLAAMRKAAAKKD"
FT   gene            complement(319695..>332359)
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /note="gene_id=mCG5590.2"
FT   mRNA            complement(join(319695..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..323855,324571..324791,
FT                   325385..325468,325622..325751,325913..325974,
FT                   327323..327557,327833..327952,328536..328624,
FT                   331880..>332359))
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, transcript variant mCT3927"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT3927.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(319700..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..325468,325622..325751,
FT                   325913..325974,327323..327557,327833..327952,
FT                   328536..328624,331765..>332274))
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, transcript variant
FT                   mCT193678"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT193678.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(319783..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..323855,324571..324791,
FT                   325385..325468,325622..325751,325913..325974,
FT                   327323..327557,327833..327952,328536..328624,
FT                   331880..>332359))
FT                   /codon_start=1
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, isoform CRA_b"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT3927.2
FT                   protein_id=mCP18156.2 isoform=CRA_b"
FT                   /protein_id="EDL38180.1"
FT   CDS             complement(join(319783..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..>323887))
FT                   /codon_start=1
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, isoform CRA_a"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT193678.0
FT                   protein_id=mCP114666.0 isoform=CRA_a"
FT                   /protein_id="EDL38179.1"
FT   gene            <333541..>353212
FT                   /locus_tag="mCG_127445"
FT                   /note="gene_id=mCG127445.1"
FT   mRNA            join(<333541..333649,336935..336989,337689..337765,
FT                   338909..339993)
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, transcript variant mCT172064"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT172064.0
FT                   created on 22-AUG-2002"
FT   CDS             join(<333543..333649,336935..336989,337689..337765,
FT                   338909..339107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, isoform CRA_b"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT172064.0
FT                   protein_id=mCP94983.0 isoform=CRA_b"
FT                   /protein_id="EDL38182.1"
FT   mRNA            join(<335801..335876,336935..336989,337689..337765,
FT                   338909..339036,341674..341738,346880..346993,
FT                   353131..>353212)
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, transcript variant mCT128728"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT128728.1
FT                   created on 22-AUG-2002"
FT   CDS             join(<335803..335876,336935..336989,337689..337765,
FT                   338909..339036,341674..341738,346880..346993,
FT                   353131..>353212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, isoform CRA_a"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT128728.1
FT                   protein_id=mCP70809.1 isoform=CRA_a"
FT                   /protein_id="EDL38181.1"
FT   assembly_gap    353282..354114
FT                   /estimated_length=833
FT                   /gap_type="unknown"
FT   gene            356209..369785
FT                   /locus_tag="mCG_145771"
FT                   /note="gene_id=mCG145771.0"
FT   mRNA            join(356209..356228,357130..357225,357792..357874,
FT                   358915..359091,360432..360521,361324..361382,
FT                   363403..363481,364859..364911,365501..365575,
FT                   366572..366700,367992..368175,368598..368755,
FT                   369364..369785)
FT                   /locus_tag="mCG_145771"
FT                   /product="mCG145771"
FT                   /note="gene_id=mCG145771.0 transcript_id=mCT185851.0
FT                   created on 17-JUN-2003"
FT   CDS             join(357854..357874,358915..359091,360432..360521,
FT                   361324..361382,363403..363481,364859..364911,
FT                   365501..365575,366572..366700,367992..368175,
FT                   368598..368755,369364..369685)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145771"
FT                   /product="mCG145771"
FT                   /note="gene_id=mCG145771.0 transcript_id=mCT185851.0
FT                   protein_id=mCP107109.0"
FT                   /db_xref="GOA:E9Q9F6"
FT                   /db_xref="InterPro:IPR028751"
FT                   /db_xref="MGI:MGI:2147030"
FT                   /db_xref="UniProtKB/Swiss-Prot:E9Q9F6"
FT                   /protein_id="EDL38183.1"
FT   gene            378562..417104
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /note="gene_id=mCG5598.3"
FT   mRNA            join(378562..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406876,408098..408225,
FT                   410792..410905,412197..412300,412498..412573,
FT                   413186..413288,413506..413615,414549..414669,
FT                   415423..415565,415926..416112,416191..416942)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186667"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186667.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378562..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416877)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186666"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186666.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,397856..398056,
FT                   401937..401973,402053..402124,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..417104)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT3919"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT3919.3 created on
FT                   14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416877)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172085"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172085.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,404443..404552,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416748)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172089"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172089.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410917,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416677)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186668"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186668.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416012,
FT                   416235..416561)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172086"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172086.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,397856..398056,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416354)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172087"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172087.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,397080..397217,
FT                   397856..398056,401937..401973,402053..402124,
FT                   406358..406423,406784..406876,408098..408225,
FT                   410792..410905,412197..412300,412498..412573,
FT                   413186..413288,413506..413615,414549..415127)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172088"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172088.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..407255)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186665"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186665.0 created
FT                   on 14-AUG-2003"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416012,
FT                   416235..416486)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172086.1
FT                   protein_id=mCP95008.1 isoform=CRA_c"
FT                   /protein_id="EDL38186.1"
FT                   GTLTLVTASW"
FT   CDS             join(378725..378746,391341..391396,397856..398056,
FT                   401937..401973,402053..402124,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_i"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT3919.3
FT                   protein_id=mCP18149.2 isoform=CRA_i"
FT                   /protein_id="EDL38192.1"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410917,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_h"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186668.0
FT                   protein_id=mCP107907.0 isoform=CRA_h"
FT                   /protein_id="EDL38191.1"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_j"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186666.0
FT                   protein_id=mCP107904.0 isoform=CRA_j"
FT                   /protein_id="EDL38194.1"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172085.0
FT                   protein_id=mCP95005.0 isoform=CRA_b"
FT                   /protein_id="EDL38185.1"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..407070)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_f"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186665.0
FT                   protein_id=mCP107906.0 isoform=CRA_f"
FT                   /protein_id="EDL38189.1"
FT                   GFQLCWVLVLLLKTQK"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406431)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_g"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186667.0
FT                   protein_id=mCP107905.0 isoform=CRA_g"
FT                   /protein_id="EDL38190.1"
FT   CDS             join(404510..404552,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_e"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172089.1
FT                   protein_id=mCP95006.1 isoform=CRA_e"
FT                   /protein_id="EDL38188.1"
FT   mRNA            join(407048..407209,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416748)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172084"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172084.1 created
FT                   on 14-AUG-2003"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172084.1
FT                   protein_id=mCP95003.1 isoform=CRA_a"
FT                   /protein_id="EDL38184.1"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172087.1
FT                   protein_id=mCP95007.1 isoform=CRA_a"
FT                   /protein_id="EDL38193.1"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414719)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_d"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172088.1
FT                   protein_id=mCP95004.1 isoform=CRA_d"
FT                   /protein_id="EDL38187.1"
FT   gene            complement(419272..423036)
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /note="gene_id=mCG5578.2"
FT   mRNA            complement(join(419272..421152,421969..422255))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT3939"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT3939.2 created on
FT                   23-AUG-2002"
FT   mRNA            complement(join(420502..421152,422933..423036))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT172068"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172068.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(420819..421152,421969..422159))
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_b"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT3939.2
FT                   protein_id=mCP18158.1 isoform=CRA_b"
FT                   /protein_id="EDL38196.1"
FT                   DQQPAVFGTTV"
FT   CDS             complement(420819..421067)
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_a"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172068.0
FT                   protein_id=mCP94986.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:2146912"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA49"
FT                   /protein_id="EDL38195.1"
FT   mRNA            complement(join(<421037..421152,421969..422135,
FT                   422933..>423020))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT172067"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172067.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(<421037..421152,421969..422135,
FT                   422933..>422965))
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_c"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172067.0
FT                   protein_id=mCP94987.0 isoform=CRA_c"
FT                   /protein_id="EDL38197.1"
FT                   D"
FT   gene            423097..428026
FT                   /locus_tag="mCG_5603"
FT                   /note="gene_id=mCG5603.2"
FT   mRNA            join(423097..423277,426370..426462,426654..426776,
FT                   427320..428026)
FT                   /locus_tag="mCG_5603"
FT                   /product="mCG5603"
FT                   /note="gene_id=mCG5603.2 transcript_id=mCT3916.2 created on
FT                   23-AUG-2002"
FT   CDS             join(423175..423277,426370..426462,426654..426776,
FT                   427320..427432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5603"
FT                   /product="mCG5603"
FT                   /note="gene_id=mCG5603.2 transcript_id=mCT3916.2
FT                   protein_id=mCP18148.1"
FT                   /db_xref="GOA:G5E814"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="MGI:MGI:1917125"
FT                   /db_xref="UniProtKB/TrEMBL:G5E814"
FT                   /protein_id="EDL38198.1"
FT   gene            439561..444627
FT                   /locus_tag="mCG_54169"
FT                   /note="gene_id=mCG54169.2"
FT   mRNA            join(439561..440243,442814..444627)
FT                   /locus_tag="mCG_54169"
FT                   /product="mCG54169"
FT                   /note="gene_id=mCG54169.2 transcript_id=mCT54352.2 created
FT                   on 31-OCT-2002"
FT   CDS             442942..443370
FT                   /codon_start=1
FT                   /locus_tag="mCG_54169"
FT                   /product="mCG54169"
FT                   /note="gene_id=mCG54169.2 transcript_id=mCT54352.2
FT                   protein_id=mCP38801.2"
FT                   /protein_id="EDL38199.1"
FT   gene            complement(456666..462871)
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /note="gene_id=mCG5566.1"
FT   mRNA            complement(join(456666..457171,457650..457831,
FT                   462537..462871))
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /product="neurturin"
FT                   /note="gene_id=mCG5566.1 transcript_id=mCT3952.0 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(456753..457171,457650..457818))
FT                   /codon_start=1
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /product="neurturin"
FT                   /note="gene_id=mCG5566.1 transcript_id=mCT3952.0
FT                   protein_id=mCP18147.1"
FT                   /protein_id="EDL38200.1"
FT   gene            470071..475435
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /note="gene_id=mCG5567.2"
FT   mRNA            join(470071..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475434)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT3953"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT3953.2 created on
FT                   05-MAR-2003"
FT   mRNA            join(470071..470282,472123..472389)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT172065"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172065.1 created
FT                   on 05-MAR-2003"
FT   mRNA            join(<470125..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475433)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT193696"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT193696.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<470188..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473599)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT193696.0
FT                   protein_id=mCP114662.0 isoform=CRA_c"
FT                   /protein_id="EDL38203.1"
FT   CDS             join(470197..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475149)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT3953.2
FT                   protein_id=mCP18167.3 isoform=CRA_d"
FT                   /db_xref="GOA:A0A0R4IZY9"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="MGI:MGI:2147092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4IZY9"
FT                   /protein_id="EDL38204.1"
FT                   YK"
FT   CDS             join(470197..470282,472123..472261)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172065.1
FT                   protein_id=mCP94984.1 isoform=CRA_a"
FT                   /protein_id="EDL38201.1"
FT   mRNA            join(<470872..471013,473220..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475435)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT172066"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172066.1 created
FT                   on 05-MAR-2003"
FT   CDS             join(<470873..471013,473220..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475149)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172066.1
FT                   protein_id=mCP94985.1 isoform=CRA_b"
FT                   /protein_id="EDL38202.1"
FT                   FLPKHKANAYK"
FT   gene            complement(481386..536914)
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /note="gene_id=mCG5568.2"
FT   mRNA            complement(join(481386..482415,482773..482815,
FT                   483180..483333,485221..485429,486096..486245,
FT                   487592..487689,488948..489102,489641..489753,
FT                   489989..490107,490638..490753,491950..492069,
FT                   492920..493101,508816..509077,509664..509734,
FT                   510696..510785,514129..514220,536777..536914))
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), transcript variant mCT3950"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT3950.2 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(482303..482415,482773..482815,
FT                   483180..483333,485221..485429,486096..486245,
FT                   487592..487689,488948..489102,489641..489753,
FT                   489989..490107,490638..490753,491950..492069,
FT                   492920..493101,508816..509077,509664..509734,
FT                   510696..510785,514129..514212))
FT                   /codon_start=1
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), isoform CRA_b"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT3950.2
FT                   protein_id=mCP18159.2 isoform=CRA_b"
FT                   /protein_id="EDL38206.1"
FT   mRNA            complement(join(<491946..492069,492920..493101,
FT                   504588..504662,508816..>508853))
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), transcript variant mCT170641"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT170641.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<491946..492069,492920..493101,
FT                   504588..504662,508816..>508851))
FT                   /codon_start=1
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), isoform CRA_a"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT170641.0
FT                   protein_id=mCP93559.0 isoform=CRA_a"
FT                   /protein_id="EDL38205.1"
FT   assembly_gap    513342..513361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(548997..580332)
FT                   /locus_tag="mCG_5594"
FT                   /note="gene_id=mCG5594.2"
FT   mRNA            complement(join(548997..549271,551298..551407,
FT                   551987..552233,552416..552555,553505..553722,
FT                   555609..555842,555929..556110,559631..559807,
FT                   562761..562910,567421..567504,568753..568873,
FT                   570346..570434,574112..574341,578683..578783,
FT                   580083..580332))
FT                   /locus_tag="mCG_5594"
FT                   /product="mCG5594"
FT                   /note="gene_id=mCG5594.2 transcript_id=mCT3920.2 created on
FT                   23-AUG-2002"
FT   CDS             complement(join(551331..551407,551987..552233,
FT                   552416..552555,553505..553722,555609..555842,
FT                   555929..556110,559631..559807,562761..562910,
FT                   567421..567504,568753..568873,570346..570434,
FT                   574112..574341,578683..578737))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5594"
FT                   /product="mCG5594"
FT                   /note="gene_id=mCG5594.2 transcript_id=mCT3920.2
FT                   protein_id=mCP18163.2"
FT                   /protein_id="EDL38207.1"
FT   gene            581358..594785
FT                   /locus_tag="mCG_127436"
FT                   /note="gene_id=mCG127436.1"
FT   mRNA            join(581358..581564,581972..582280,583247..583473,
FT                   586337..586425,586832..586952,588048..588128,
FT                   588422..588571,588769..588867,589197..589378,
FT                   589508..589741,590632..590849,590965..591104,
FT                   592322..592568,594518..594779)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT128719"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT128719.0
FT                   created on 28-OCT-2002"
FT   mRNA            join(<581367..581564,581972..582280,583247..583473,
FT                   586337..586425,586832..586952,588048..588128,
FT                   588422..588571,588661..588867,589197..589378,
FT                   589508..589741,590632..590849,590965..591104,
FT                   592322..592568,594518..594785)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT193656"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT193656.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(581386..581564,581972..582280,583247..583702)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT175250"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT175250.0
FT                   created on 28-OCT-2002"
FT   CDS             join(<582115..582280,583247..583473,586337..586425,
FT                   586832..586952,588048..588128,588422..588571,
FT                   588661..588867,589197..589378,589508..589741,
FT                   590632..590849,590965..591104,592322..592568,
FT                   594518..594603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_d"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT193656.0
FT                   protein_id=mCP114637.0 isoform=CRA_d"
FT                   /protein_id="EDL38211.1"
FT   CDS             join(582145..582280,583247..583473,586337..586425,
FT                   586832..586952,588048..588128,588422..588571,
FT                   588769..588867,589197..589378,589508..589741,
FT                   590632..590849,590965..591104,592322..592568,
FT                   594518..594603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_a"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT128719.0
FT                   protein_id=mCP70752.1 isoform=CRA_a"
FT                   /protein_id="EDL38208.1"
FT   CDS             join(582145..582280,583247..583506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_c"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT175250.0
FT                   protein_id=mCP98169.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D2T1"
FT                   /db_xref="MGI:MGI:1925875"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2T1"
FT                   /protein_id="EDL38210.1"
FT   mRNA            join(<585848..585915,586337..586425,586832..586952,
FT                   588048..588128,588422..>588517)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT172060"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT172060.0
FT                   created on 28-OCT-2002"
FT   CDS             join(<585850..585915,586337..586425,586832..586952,
FT                   588048..588128,588422..>588517)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_b"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT172060.0
FT                   protein_id=mCP94979.0 isoform=CRA_b"
FT                   /protein_id="EDL38209.1"
FT   gene            complement(<600343..>641371)
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /note="gene_id=mCG5570.2"
FT   mRNA            complement(join(<600343..600471,600548..600619,
FT                   600712..600783,600880..600979,602090..602198,
FT                   603261..603348,605650..606177,608444..608569,
FT                   611593..611736,625781..625863,632873..633053,
FT                   641145..>641371))
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), transcript variant
FT                   mCT3946"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT3946.2 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(600343..600471,600548..600619,
FT                   600712..600783,600880..600979,602090..602198,
FT                   603261..603348,605650..606177,608444..608569,
FT                   611593..611736,625781..625863,632873..633053,
FT                   641145..>641369))
FT                   /codon_start=1
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT3946.2
FT                   protein_id=mCP18162.1 isoform=CRA_a"
FT                   /protein_id="EDL38212.1"
FT   mRNA            complement(join(<606113..606177,611593..611736,
FT                   625781..625863,632873..633053,641145..>641371))
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), transcript variant
FT                   mCT170642"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT170642.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<606113..606177,611593..611736,
FT                   625781..625863,632873..633053,641145..>641369))
FT                   /codon_start=1
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT170642.0
FT                   protein_id=mCP93560.0 isoform=CRA_b"
FT                   /protein_id="EDL38213.1"
FT                   PHKVAREHRER"
FT   assembly_gap    658153..658776
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    661126..661145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    662408..662427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(663469..>691235)
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /note="gene_id=mCG5600.1"
FT   mRNA            complement(join(663469..664372,664621..664758,
FT                   667438..667575,668020..668161,668248..668362,
FT                   691113..>691235))
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /product="N-acylsphingosine amidohydrolase (alkaline
FT                   ceramidase) 3"
FT                   /note="gene_id=mCG5600.1 transcript_id=mCT3926.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(664204..664372,664621..664758,
FT                   667438..667575,668020..668161,668248..668362,
FT                   691113..>691235))
FT                   /codon_start=1
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /product="N-acylsphingosine amidohydrolase (alkaline
FT                   ceramidase) 3"
FT                   /note="gene_id=mCG5600.1 transcript_id=mCT3926.1
FT                   protein_id=mCP18171.1"
FT                   /protein_id="EDL38214.1"
FT   gene            699158..705483
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /note="gene_id=mCG5584.2"
FT   mRNA            join(699158..699639,699732..699803,700420..700516,
FT                   701952..702139,702574..702679,705004..705483)
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /product="caseinolytic peptidase, ATP-dependent,
FT                   proteolytic subunit homolog (E. coli)"
FT                   /note="gene_id=mCG5584.2 transcript_id=mCT3932.1 created on
FT                   17-JUL-2002"
FT   CDS             join(699454..699639,699732..699803,700420..700516,
FT                   701952..702139,702574..702679,705004..705173)
FT                   /codon_start=1
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /product="caseinolytic peptidase, ATP-dependent,
FT                   proteolytic subunit homolog (E. coli)"
FT                   /note="gene_id=mCG5584.2 transcript_id=mCT3932.1
FT                   protein_id=mCP18130.1"
FT                   /protein_id="EDL38215.1"
FT   gene            <706463..708517
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /note="gene_id=mCG5589.0"
FT   mRNA            join(<706463..706693,707515..707688,707797..707921,
FT                   708056..708517)
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   transcript variant mCT3930"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT3930.1 created on
FT                   23-AUG-2002"
FT   CDS             join(<706463..706693,707515..707688,707797..707921,
FT                   708056..708218)
FT                   /codon_start=1
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT3930.1
FT                   protein_id=mCP18154.0 isoform=CRA_b"
FT                   /protein_id="EDL38217.1"
FT                   PEEPPPAC"
FT   mRNA            join(<706464..706693,707797..707921,708056..708420)
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   transcript variant mCT172071"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT172071.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(<706466..706693,707797..707921,708056..708218)
FT                   /codon_start=1
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT172071.0
FT                   protein_id=mCP94990.0 isoform=CRA_a"
FT                   /protein_id="EDL38216.1"
FT                   PEEPPPAC"
FT   gene            complement(<708583..>709141)
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /note="gene_id=mCG5585.0"
FT   mRNA            complement(join(<708583..708899,708988..>709141))
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /product="persephin"
FT                   /note="gene_id=mCG5585.0 transcript_id=mCT3933.1 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(708583..708899,708988..709141))
FT                   /codon_start=1
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /product="persephin"
FT                   /note="gene_id=mCG5585.0 transcript_id=mCT3933.1
FT                   protein_id=mCP18135.1"
FT                   /db_xref="GOA:A1L3Q1"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1201684"
FT                   /db_xref="UniProtKB/TrEMBL:A1L3Q1"
FT                   /protein_id="EDL38218.1"
FT   gene            complement(712527..720543)
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /note="gene_id=mCG5591.1"
FT   mRNA            complement(join(712527..712757,712847..712937,
FT                   713041..713179,713248..713321,713435..713554,
FT                   713637..713698,713792..713945,714486..714670,
FT                   716112..716282,716839..717032,718814..718886,
FT                   720102..720148,720235..720543))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT3928"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT3928.2 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(712553..712757,712847..712937,
FT                   713041..713179,713248..713321,713435..713554,
FT                   713637..713698,713792..713945,714486..714670,
FT                   716112..716282,716839..717032,718814..718886,
FT                   720102..720148,720235..720246))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT3928.2
FT                   protein_id=mCP18165.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3THK3"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="MGI:MGI:1923848"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3THK3"
FT                   /protein_id="EDL38221.1"
FT   mRNA            complement(join(712856..712937,713041..713058,
FT                   720092..720148,720235..720482))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170911"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170911.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(<712902..712937,713041..713156,
FT                   713637..713698,713792..713945,714486..>714528))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170912"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170912.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(<712902..712937,713041..713156,
FT                   713637..713698,713792..713945,714486..>714528))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170912.0
FT                   protein_id=mCP93829.0 isoform=CRA_d"
FT                   /protein_id="EDL38222.1"
FT   mRNA            complement(join(<716149..716282,716839..717032,
FT                   718814..718886,720102..720437))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170910"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170910.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(<716149..716282,716839..717032,
FT                   718814..718861))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170910.0
FT                   protein_id=mCP93828.0 isoform=CRA_a"
FT                   /protein_id="EDL38219.1"
FT   CDS             complement(join(720098..720148,720235..720246))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170911.0
FT                   protein_id=mCP93830.0 isoform=CRA_b"
FT                   /protein_id="EDL38220.1"
FT                   /translation="MAALGSSSQNVTEYVVRVPK"
FT   gene            <721722..>728727
FT                   /locus_tag="mCG_5576"
FT                   /note="gene_id=mCG5576.2"
FT   mRNA            join(<721722..721921,723778..723891,728530..>728727)
FT                   /locus_tag="mCG_5576"
FT                   /product="mCG5576"
FT                   /note="gene_id=mCG5576.2 transcript_id=mCT3949.2 created on
FT                   23-AUG-2002"
FT   CDS             join(<721724..721921,723778..723891,728530..>728727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5576"
FT                   /product="mCG5576"
FT                   /note="gene_id=mCG5576.2 transcript_id=mCT3949.2
FT                   protein_id=mCP18151.2"
FT                   /protein_id="EDL38223.1"
FT                   KNLLRHV"
FT   gene            complement(730177..>740634)
FT                   /locus_tag="mCG_140911"
FT                   /note="gene_id=mCG140911.0"
FT   mRNA            complement(join(730177..730974,731936..732096,
FT                   732185..732262,732339..732539,732631..732719,
FT                   732953..733062,733113..733297,733373..733618,
FT                   733915..734017,734106..734204,734434..734532,
FT                   734622..734796,735006..735063,735969..736040,
FT                   736175..736224,736943..736982,737082..737120,
FT                   738168..738264,740274..>740634))
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, transcript variant mCT172091"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT172091.0
FT                   created on 23-AUG-2002"
FT   mRNA            complement(join(730177..732096,732185..732262,
FT                   732339..732539,732631..732719,732953..733062,
FT                   733137..733297,733373..733618,733915..734017,
FT                   734106..734204,734434..734532,734622..734796,
FT                   735006..735063,735969..736040,736175..736224,
FT                   736943..736982,737082..737120,738168..738264,
FT                   740274..>740601))
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, transcript variant mCT193681"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT193681.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(730939..730974,731936..732096,
FT                   732185..732262,732339..732539,732631..732719,
FT                   732953..733062,733113..733297,733373..733618,
FT                   733915..734017,734106..734204,734434..734532,
FT                   734622..734796,735006..735063,735969..736040,
FT                   736175..736224,736943..736982,737082..737120,
FT                   738168..738264,740274..>740633))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, isoform CRA_a"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT172091.0
FT                   protein_id=mCP95010.0 isoform=CRA_a"
FT                   /protein_id="EDL38224.1"
FT                   QANEANGYELHL"
FT   CDS             complement(join(731819..732096,732185..732262,
FT                   732339..732539,732631..732719,732953..733062,
FT                   733137..733297,733373..733618,733915..734017,
FT                   734106..734204,734434..734532,734622..734796,
FT                   735006..735063,735969..736040,736175..736224,
FT                   736943..736982,737082..737120,738168..738264,
FT                   740274..>740600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, isoform CRA_b"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT193681.0
FT                   protein_id=mCP114641.0 isoform=CRA_b"
FT                   /protein_id="EDL38225.1"
FT   gene            complement(741909..>749103)
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /note="gene_id=mCG140912.0"
FT   mRNA            complement(join(741909..742309,742846..742993,
FT                   743913..744080,747455..747562,747660..747812,
FT                   748948..>749103))
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /product="RIKEN cDNA 4933406J04"
FT                   /note="gene_id=mCG140912.0 transcript_id=mCT172090.0
FT                   created on 23-AUG-2002"
FT   CDS             complement(join(742122..742309,742846..742993,
FT                   743913..744080,747455..747562,747660..747812,
FT                   748948..>749103))
FT                   /codon_start=1
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /product="RIKEN cDNA 4933406J04"
FT                   /note="gene_id=mCG140912.0 transcript_id=mCT172090.0
FT                   protein_id=mCP95009.0"
FT                   /protein_id="EDL38226.1"
FT   assembly_gap    752412..752517
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(752844..>768958)
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /note="gene_id=mCG5562.2"
FT   mRNA            complement(join(752844..753060,763026..763066,
FT                   764398..764509,765702..765789,767228..>767258))
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, transcript variant
FT                   mCT170640"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT170640.0 created
FT                   on 19-JUL-2002"
FT   mRNA            complement(join(752849..754792,756311..756461,
FT                   761806..761973,762365..762472,762671..762823,
FT                   762908..763066,764398..764509,765702..765789,
FT                   767228..767354,768641..>768958))
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, transcript variant mCT3957"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT3957.2 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(752985..753060,763026..763066,
FT                   764398..764509,765702..765789,767228..767258))
FT                   /codon_start=1
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, isoform CRA_a"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT170640.0
FT                   protein_id=mCP93558.0 isoform=CRA_a"
FT                   /protein_id="EDL38227.1"
FT                   DLGYPAPPLSL"
FT   CDS             complement(join(754608..754792,756311..756461,
FT                   761806..761973,762365..762472,762671..762823,
FT                   762908..763066,764398..764509,765702..765789,
FT                   767228..767354,768641..>768916))
FT                   /codon_start=1
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, isoform CRA_b"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT3957.2
FT                   protein_id=mCP18160.2 isoform=CRA_b"
FT                   /protein_id="EDL38228.1"
FT   gene            768222..775037
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /note="gene_id=mCG5582.2"
FT   mRNA            join(768222..768273,771261..771348,771715..771886,
FT                   772757..772818,774210..775030)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT172070"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172070.0 created
FT                   on 23-AUG-2002"
FT   mRNA            join(771390..771493,771715..771886,772757..772818,
FT                   774210..774353,774729..775037)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT3937"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT3937.1 created on
FT                   23-AUG-2002"
FT   mRNA            join(771397..771493,771715..771886,772757..772818,
FT                   774210..775032)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT172069"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172069.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(771814..771886,772757..772818,774210..774353,
FT                   774729..774803)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT3937.1
FT                   protein_id=mCP18128.1 isoform=CRA_b"
FT                   /protein_id="EDL38231.1"
FT                   QDSKEPVRGCLPI"
FT   CDS             join(771814..771886,772757..772818,774210..774416)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172069.0
FT                   protein_id=mCP94989.0 isoform=CRA_a"
FT                   /protein_id="EDL38229.1"
FT                   KLPPEERLI"
FT   CDS             join(771814..771886,772757..772818,774210..774416)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172070.0
FT                   protein_id=mCP94988.0 isoform=CRA_a"
FT                   /protein_id="EDL38230.1"
FT                   KLPPEERLI"
FT   gene            complement(774440..787635)
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /note="gene_id=mCG127437.0"
FT   mRNA            complement(join(774440..775353,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   779233..779304,779528..779568,779650..779743,
FT                   780039..780143,780692..780817,780908..781009,
FT                   781129..781174,781456..781556,782893..783003,
FT                   783070..783147,783234..783299,783394..783474,
FT                   783613..783682,784489..784608,785767..785816,
FT                   785938..785981,786061..786125,787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT128720"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT128720.1
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(775025..775761,775852..776236,
FT                   776713..776820,776909..776953,779233..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783316,
FT                   783394..783474,783613..783682,784489..784679,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT172062"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172062.1
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(775176..775761,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   777037..777069,779233..779304,779528..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783299,
FT                   783394..783474,783613..783682,784489..784608,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT180823"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT180823.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(775231..775761,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   777037..777069,779233..779304,779528..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783299,
FT                   783394..783474,783613..783682,784489..784608,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_c"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT180823.0
FT                   protein_id=mCP103745.0 isoform=CRA_c"
FT                   /protein_id="EDL38234.1"
FT   CDS             complement(join(775231..775353,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   779233..779304,779528..779568,779650..779743,
FT                   780039..780143,780692..780817,780908..781009,
FT                   781129..781174,781456..781556,782893..783003,
FT                   783070..783147,783234..783299,783394..783474,
FT                   783613..783682,784489..784608,785767..785816,
FT                   785938..785981,786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_a"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT128720.1
FT                   protein_id=mCP70759.1 isoform=CRA_a"
FT                   /protein_id="EDL38232.1"
FT                   PRVADLKKCFEN"
FT   mRNA            complement(join(781289..783003,783094..783147,
FT                   783234..783299,783394..783474,783613..783682,
FT                   784489..784608,785767..785816,785938..785981,
FT                   786061..786125,787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT172061"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172061.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(782767..783003,783094..783147,
FT                   783234..783299,783394..783474,783613..783682,
FT                   784489..784608,785767..785816,785938..785981,
FT                   786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_d"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172061.0
FT                   protein_id=mCP94981.0 isoform=CRA_d"
FT                   /protein_id="EDL38235.1"
FT   CDS             complement(join(784670..784679,785767..785816,
FT                   785938..785981,786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_b"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172062.1
FT                   protein_id=mCP94980.1 isoform=CRA_b"
FT                   /protein_id="EDL38233.1"
FT                   QMVPRFCFPFDIERPP"
FT   gene            complement(789186..796722)
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /note="gene_id=mCG5587.2"
FT   mRNA            complement(join(789186..790867,795112..795222,
FT                   795352..795460,796578..796722))
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /product="tubulin, beta 4"
FT                   /note="gene_id=mCG5587.2 transcript_id=mCT3935.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(789810..790867,795112..795222,
FT                   795352..795460,796578..796634))
FT                   /codon_start=1
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /product="tubulin, beta 4"
FT                   /note="gene_id=mCG5587.2 transcript_id=mCT3935.1
FT                   protein_id=mCP18144.0"
FT                   /protein_id="EDL38236.1"
FT   gene            complement(801126..>815653)
FT                   /locus_tag="mCG_145591"
FT                   /note="gene_id=mCG145591.0"
FT   mRNA            complement(join(801126..802527,813085..813219,
FT                   815628..>815653))
FT                   /locus_tag="mCG_145591"
FT                   /product="mCG145591"
FT                   /note="gene_id=mCG145591.0 transcript_id=mCT185015.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(802104..>802418)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145591"
FT                   /product="mCG145591"
FT                   /note="gene_id=mCG145591.0 transcript_id=mCT185015.0
FT                   protein_id=mCP106313.0"
FT                   /protein_id="EDL38237.1"
FT                   "
FT   gene            815046..817492
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /note="gene_id=mCG5588.2"
FT   mRNA            join(815046..815590,815980..816016,816771..817492)
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 9"
FT                   /note="gene_id=mCG5588.2 transcript_id=mCT3936.2 created on
FT                   19-JUL-2002"
FT   CDS             join(815162..815590,815980..816016,816771..817234)
FT                   /codon_start=1
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 9"
FT                   /note="gene_id=mCG5588.2 transcript_id=mCT3936.2
FT                   protein_id=mCP18146.1"
FT                   /db_xref="GOA:Q3U1Z9"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="MGI:MGI:1101058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1Z9"
FT                   /protein_id="EDL38238.1"
FT   assembly_gap    837921..838385
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   gene            complement(856660..860439)
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /note="gene_id=mCG5599.1"
FT   mRNA            complement(join(856660..857122,859429..859462,
FT                   860096..860439))
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 7"
FT                   /note="gene_id=mCG5599.1 transcript_id=mCT3924.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(856737..857122,859429..859462,
FT                   860096..860263))
FT                   /codon_start=1
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 7"
FT                   /note="gene_id=mCG5599.1 transcript_id=mCT3924.1
FT                   protein_id=mCP18169.2"
FT                   /db_xref="GOA:Q05A52"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1195273"
FT                   /db_xref="UniProtKB/TrEMBL:Q05A52"
FT                   /protein_id="EDL38239.1"
FT   assembly_gap    874957..874991
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    876631..876650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(899238..>903930)
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /note="gene_id=mCG5572.0"
FT   mRNA            complement(join(899238..900684,902305..902346,
FT                   902649..902685,903603..>903930))
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 14"
FT                   /note="gene_id=mCG5572.0 transcript_id=mCT3948.0 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(900257..900684,902305..902346,
FT                   902649..902685,903603..>903929))
FT                   /codon_start=1
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 14"
FT                   /note="gene_id=mCG5572.0 transcript_id=mCT3948.0
FT                   protein_id=mCP18127.0"
FT                   /protein_id="EDL38240.1"
FT   gene            complement(913189..>937295)
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /note="gene_id=mCG140909.1"
FT   mRNA            complement(join(913189..913339,931408..931563,
FT                   932001..932207,932333..>932513))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172072"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172072.0
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(913190..913327,931210..931230,
FT                   931408..931563,932001..>932039))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172073"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172073.0
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(913196..913376,913473..913608,
FT                   913689..913772,914519..914602,914878..914967,
FT                   915412..915517,916556..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   919377..919535,920784..920947,921817..921973,
FT                   922978..923076,923888..924047,924326..924401,
FT                   924941..925144,926297..926383,926478..926544,
FT                   927671..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930385,930535..930606,
FT                   931101..931230,931408..931563,932001..932207,
FT                   932333..932542,933043..933189,933275..933390,
FT                   933499..933625,933856..933958,934065..934155,
FT                   934247..934329,934428..934522,935209..935279,
FT                   935378..935543,935905..936094,937156..>937291))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172077"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172077.1
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(913235..913376,913473..913608,
FT                   913689..913772,914519..914602,914878..914967,
FT                   915412..915517,916556..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   919377..919535,920784..920947,921817..921973,
FT                   922978..923076,923888..924047,924326..924401,
FT                   924941..925144,926297..926383,926478..926544,
FT                   927671..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930385,930535..930606,
FT                   931101..931230,931408..931563,932001..932207,
FT                   932333..932542,933043..933189,933275..933390,
FT                   933499..933625,933856..933958,934065..934155,
FT                   934247..934329,934428..934522,935209..935279,
FT                   935378..935543,935905..936094,937156..>937289))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_c"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172077.1
FT                   protein_id=mCP94996.1 isoform=CRA_c"
FT                   /protein_id="EDL38243.1"
FT   CDS             complement(join(913235..913339,931408..931563,
FT                   932001..932207,932333..>932512))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_a"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172072.0
FT                   protein_id=mCP94999.0 isoform=CRA_a"
FT                   /protein_id="EDL38241.1"
FT   CDS             complement(join(913235..913327,931210..931230,
FT                   931408..931563,932001..>932039))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_f"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172073.0
FT                   protein_id=mCP94992.0 isoform=CRA_f"
FT                   /db_xref="GOA:H3BL60"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR035711"
FT                   /db_xref="MGI:MGI:88227"
FT                   /db_xref="UniProtKB/TrEMBL:H3BL60"
FT                   /protein_id="EDL38246.1"
FT   mRNA            complement(join(913281..913376,913473..913497,
FT                   919390..919535,920784..920947,921817..>921865))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172076"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172076.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(913494..913497,919390..919535,
FT                   920784..920947,921817..>921865))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_g"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172076.0
FT                   protein_id=mCP94994.0 isoform=CRA_g"
FT                   /protein_id="EDL38247.1"
FT                   SSATTFRLLWENGNLL"
FT   mRNA            complement(join(<913709..913772,914519..914602,
FT                   914878..914967,915412..915517,916556..916645,
FT                   916754..916841,918461..918489,923897..924047,
FT                   924326..>924407))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172079"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172079.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(<913709..913772,914519..914602,
FT                   914878..914967,915412..915517,916556..916645,
FT                   916754..916841,918461..918489,923897..924047,
FT                   924326..>924405))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_d"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172079.0
FT                   protein_id=mCP95001.0 isoform=CRA_d"
FT                   /protein_id="EDL38244.1"
FT   mRNA            complement(join(<916555..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   927857..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930235,936050..936094,
FT                   937156..937203))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172075"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172075.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(<916555..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   927857..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930235,936050..936074))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_b"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172075.0
FT                   protein_id=mCP95000.0 isoform=CRA_b"
FT                   /protein_id="EDL38242.1"
FT   mRNA            complement(join(918645..918723,918811..918855,
FT                   935441..935543,935905..936094,937156..>937295))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172081"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172081.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(918668..918723,918811..918855,
FT                   935441..935543,935905..936094,937156..>937295))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_e"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172081.0
FT                   protein_id=mCP95002.0 isoform=CRA_e"
FT                   /protein_id="EDL38245.1"
FT                   VSCQTQKQSHLQEV"
FT   gene            complement(943833..>957644)
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /note="gene_id=mCG140910.0"
FT   mRNA            complement(join(943833..944251,944499..944564,
FT                   945121..945245,945354..945437,945572..945621,
FT                   945895..945938,946069..946199,946404..946521,
FT                   946622..946695,947049..947124,947228..947361,
FT                   951932..952036,952139..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956709..956889))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172082"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172082.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(943833..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952311,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..956889))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172078"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172078.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(943833..944462,945172..945245,
FT                   945354..945437,945572..945621,945895..945923))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172080"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172080.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(944115..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952332,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..>956839))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT193679"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT193679.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(944137..944251,944499..944564,
FT                   945121..945245,945354..945437,945572..945621,
FT                   945895..945938,946069..946199,946404..946521,
FT                   946622..946695,947049..947124,947228..947361,
FT                   951932..952036,952139..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956709..956834))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_e"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172082.1
FT                   protein_id=mCP94991.1 isoform=CRA_e"
FT                   /protein_id="EDL38252.1"
FT   CDS             complement(join(944246..944462,945172..945245,
FT                   945354..945437,945572..945574))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_b"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172080.1
FT                   protein_id=mCP94995.1 isoform=CRA_b"
FT                   /protein_id="EDL38249.1"
FT   CDS             complement(join(944492..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952332,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..>956837))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_c"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT193679.0
FT                   protein_id=mCP114640.0 isoform=CRA_c"
FT                   /protein_id="EDL38250.1"
FT   CDS             complement(join(944492..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952311,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..956834))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_d"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172078.1
FT                   protein_id=mCP94997.1 isoform=CRA_d"
FT                   /protein_id="EDL38251.1"
FT   mRNA            complement(join(<952281..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956503..>956667))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172083"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172083.0
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(<952281..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956503..>956520))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_f"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172083.0
FT                   protein_id=mCP94993.0 isoform=CRA_f"
FT                   /protein_id="EDL38253.1"
FT   mRNA            complement(join(<952307..952332,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   957305..>957644))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172074"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172074.0
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(<952307..952332,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   957305..>957310))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_a"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172074.0
FT                   protein_id=mCP94998.0 isoform=CRA_a"
FT                   /protein_id="EDL38248.1"
FT   gene            <958647..972889
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /note="gene_id=mCG5573.2"
FT   mRNA            join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971546..971664,972192..972889)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT3945"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT3945.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971546..971664,972192..972614)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT170909"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT170909.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971546..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT3945.2
FT                   protein_id=mCP18166.2 isoform=CRA_d"
FT                   /protein_id="EDL38257.1"
FT                   N"
FT   CDS             join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971546..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT170909.0
FT                   protein_id=mCP93827.0 isoform=CRA_a"
FT                   /protein_id="EDL38254.1"
FT                   VTLN"
FT   mRNA            join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971549..971664,972192..972619)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT193675"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193675.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971549..971664,972192..972611)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT193676"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193676.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971549..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193675.0
FT                   protein_id=mCP114663.0 isoform=CRA_b"
FT                   /protein_id="EDL38255.1"
FT   CDS             join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971549..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193676.0
FT                   protein_id=mCP114664.0 isoform=CRA_c"
FT                   /protein_id="EDL38256.1"
FT   assembly_gap    980907..980956
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    987614..987633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            989376..1038888
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /note="gene_id=mCG140673.0"
FT   mRNA            join(989376..989686,1006280..1006396,1006850..1006908,
FT                   1006998..1007066,1007347..1007455,1007544..1007639,
FT                   1009070..1009138,1009399..1009502,1010140..1010239,
FT                   1011479..1011574,1012159..1012227,1012372..1012458,
FT                   1012563..1012648,1013313..1013445,1014132..1014241,
FT                   1015122..1015223,1015578..1015675,1015757..1015779,
FT                   1015961..1016006,1016405..1016541,1017332..1017397,
FT                   1019750..1019781,1022073..1022189,1025533..1025620,
FT                   1028917..1029031,1035578..1035729,1038584..1038888)
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /product="vav 1 oncogene"
FT                   /note="gene_id=mCG140673.0 transcript_id=mCT170643.0
FT                   created on 19-JUL-2002"
FT   CDS             join(989483..989686,1006280..1006396,1006850..1006908,
FT                   1006998..1007066,1007347..1007455,1007544..1007639,
FT                   1009070..1009138,1009399..1009502,1010140..1010239,
FT                   1011479..1011574,1012159..1012227,1012372..1012458,
FT                   1012563..1012648,1013313..1013445,1014132..1014241,
FT                   1015122..1015223,1015578..1015675,1015757..1015779,
FT                   1015961..1016006,1016405..1016541,1017332..1017397,
FT                   1019750..1019781,1022073..1022189,1025533..1025620,
FT                   1028917..1029031,1035578..1035729,1038584..1038637)
FT                   /codon_start=1
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /product="vav 1 oncogene"
FT                   /note="gene_id=mCG140673.0 transcript_id=mCT170643.0
FT                   protein_id=mCP93561.0"
FT                   /db_xref="GOA:Q3U9E2"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR022613"
FT                   /db_xref="InterPro:IPR028530"
FT                   /db_xref="InterPro:IPR035729"
FT                   /db_xref="InterPro:IPR035730"
FT                   /db_xref="InterPro:IPR035879"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036860"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR037832"
FT                   /db_xref="MGI:MGI:98923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9E2"
FT                   /protein_id="EDL38258.1"
FT   assembly_gap    997897..998042
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    1030063..1030082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1057614..1057633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1069706..1195235
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /note="gene_id=mCG5569.2"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT3954"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT3954.2 created on
FT                   13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172973"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172973.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1116788..1116934,1118300..1118449,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172974"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172974.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172975"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172975.0 created
FT                   on 13-SEP-2002"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_c"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT3954.2
FT                   protein_id=mCP18131.2 isoform=CRA_c"
FT                   /protein_id="EDL38261.1"
FT                   SMPSTSKMG"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_d"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172973.0
FT                   protein_id=mCP95892.0 isoform=CRA_d"
FT                   /protein_id="EDL38262.1"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1116788..1116934,1118300..1118449,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_a"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172974.0
FT                   protein_id=mCP95893.0 isoform=CRA_a"
FT                   /protein_id="EDL38259.1"
FT   CDS             join(<1069708..1069762,1072678..1072740,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_b"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172975.0
FT                   protein_id=mCP95894.0 isoform=CRA_b"
FT                   /protein_id="EDL38260.1"
FT   assembly_gap    1079287..1081978
FT                   /estimated_length=2692
FT                   /gap_type="unknown"
FT   assembly_gap    1091051..1091093
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    1092280..1092299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1103362..1103381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108759..1108778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1136604..1143676
FT                   /estimated_length=7073
FT                   /gap_type="unknown"
FT   assembly_gap    1173371..1173390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1180516..1180535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1189326..1189345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1206267..1206389
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            complement(<1220569..>1237741)
FT                   /locus_tag="mCG_5579"
FT                   /note="gene_id=mCG5579.1"
FT   mRNA            complement(join(<1220569..1221470,1233707..1233830,
FT                   1234133..1234360,1236253..1237059,1237450..>1237741))
FT                   /locus_tag="mCG_5579"
FT                   /product="mCG5579"
FT                   /note="gene_id=mCG5579.1 transcript_id=mCT3940.1 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(1220569..1221470,1233707..1233830,
FT                   1234133..1234360,1236253..1237059,1237450..>1237740))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5579"
FT                   /product="mCG5579"
FT                   /note="gene_id=mCG5579.1 transcript_id=mCT3940.1
FT                   protein_id=mCP18168.1"
FT                   /protein_id="EDL38263.1"
FT   assembly_gap    1246145..1246164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1328089..1328108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1362828..1362918
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1392608..1394591
FT                   /estimated_length=1984
FT                   /gap_type="unknown"
FT   assembly_gap    1408748..1410899
FT                   /estimated_length=2152
FT                   /gap_type="unknown"
FT   assembly_gap    1423814..1423833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1429132..1432842
FT                   /estimated_length=3711
FT                   /gap_type="unknown"
FT   gene            1437663..1438938
FT                   /pseudo
FT                   /locus_tag="mCG_50925"
FT                   /note="gene_id=mCG50925.2"
FT   mRNA            1437663..1438938
FT                   /pseudo
FT                   /locus_tag="mCG_50925"
FT                   /note="gene_id=mCG50925.2 transcript_id=mCT51108.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    1458683..1458702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1497842..1497998
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1500526..1500545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1504258..1504406
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1510150..1511195
FT                   /estimated_length=1046
FT                   /gap_type="unknown"
FT   assembly_gap    1520099..1520120
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1529827..1529869
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    1531089..1531194
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(<1535072..>1535866)
FT                   /locus_tag="mCG_13804"
FT                   /note="gene_id=mCG13804.0"
FT   mRNA            complement(<1535072..>1535866)
FT                   /locus_tag="mCG_13804"
FT                   /product="mCG13804"
FT                   /note="gene_id=mCG13804.0 transcript_id=mCT17710.0 created
FT                   on 19-JUL-2002"
FT   CDS             complement(1535072..1535866)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13804"
FT                   /product="mCG13804"
FT                   /note="gene_id=mCG13804.0 transcript_id=mCT17710.0
FT                   protein_id=mCP18150.0"
FT                   /protein_id="EDL38264.1"
FT   assembly_gap    1552607..1552626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1576801..1576842
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1606115..1606483
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    1626413..1626432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1648746..1648765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1664240..1664285
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1668125..1668747
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   gene            <1709045..>2101945
FT                   /locus_tag="mCG_13805"
FT                   /note="gene_id=mCG13805.2"
FT   mRNA            join(<1709045..1709192,1730011..1730214,1737550..1737734,
FT                   1751011..1751154,1787095..1787359,1797020..1797169,
FT                   1799489..1799660,1833515..1833621,1857086..1857205,
FT                   1893929..1894129,1980949..1981105,1988102..1988229,
FT                   1988425..1988595,1999710..1999928,2007891..2008130,
FT                   2024365..2024589,2053441..2053551,2089302..2089520,
FT                   2101853..>2101945)
FT                   /locus_tag="mCG_13805"
FT                   /product="mCG13805"
FT                   /note="gene_id=mCG13805.2 transcript_id=mCT17711.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(<1709045..1709192,1730011..1730214,1737550..1737734,
FT                   1751011..1751154,1787095..1787359,1797020..1797169,
FT                   1799489..1799660,1833515..1833621,1857086..1857205,
FT                   1893929..1894129,1980949..1981105,1988102..1988229,
FT                   1988425..1988595,1999710..1999928,2007891..2008130,
FT                   2024365..2024589,2053441..2053551,2089302..2089520,
FT                   2101853..>2101945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13805"
FT                   /product="mCG13805"
FT                   /note="gene_id=mCG13805.2 transcript_id=mCT17711.2
FT                   protein_id=mCP18152.2"
FT                   /protein_id="EDL38265.1"
FT   assembly_gap    1713823..1713842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1735015..1735157
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    1738646..1738665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1764195..1764214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1777604..1777639
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    1792557..1792576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798990..1799289
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    1857996..1859821
FT                   /estimated_length=1826
FT                   /gap_type="unknown"
FT   assembly_gap    1860158..1860557
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    1868017..1869587
FT                   /estimated_length=1571
FT                   /gap_type="unknown"
FT   assembly_gap    1888902..1888921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1896603..1898412
FT                   /estimated_length=1810
FT                   /gap_type="unknown"
FT   assembly_gap    1910497..1910516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1916379..1916450
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1920567..1921405
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    1923847..1926171
FT                   /estimated_length=2325
FT                   /gap_type="unknown"
FT   assembly_gap    1928262..1928715
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    1930835..1930854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1933243..1933866
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    1938435..1938589
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1972769..1972788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975422..1975825
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    2012967..2012986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2013995..2014129
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    2108351..2108472
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    2119300..2119631
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    2120026..2120142
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    2173218..2173237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2179241..2179651
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    2199031..2199050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2214940..2214959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2217106..2217125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2218364..2218383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2229764..2231186
FT                   /estimated_length=1423
FT                   /gap_type="unknown"
FT   assembly_gap    2240525..2240772
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    2248527..2253440
FT                   /estimated_length=4914
FT                   /gap_type="unknown"
FT   assembly_gap    2274111..2274130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2275101..2276040)
FT                   /pseudo
FT                   /locus_tag="mCG_1039311"
FT                   /note="gene_id=mCG1039311.0"
FT   mRNA            complement(2275101..2276040)
FT                   /pseudo
FT                   /locus_tag="mCG_1039311"
FT                   /note="gene_id=mCG1039311.0 transcript_id=mCT157015.1
FT                   created on 28-OCT-2002"
FT   gene            <2289733..2291730
FT                   /locus_tag="mCG_1039286"
FT                   /note="gene_id=mCG1039286.1"
FT   mRNA            <2289733..2291730
FT                   /locus_tag="mCG_1039286"
FT                   /product="mCG1039286"
FT                   /note="gene_id=mCG1039286.1 transcript_id=mCT156990.1
FT                   created on 28-OCT-2002"
FT   CDS             <2289734..2290918
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039286"
FT                   /product="mCG1039286"
FT                   /note="gene_id=mCG1039286.1 transcript_id=mCT156990.1
FT                   protein_id=mCP71250.1"
FT                   /protein_id="EDL38266.1"
FT   assembly_gap    2296850..2296895
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    2309381..2309400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2312285..2312304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319743..2319762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2320903..2322004
FT                   /estimated_length=1102
FT                   /gap_type="unknown"
FT   assembly_gap    2324050..2324069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2339011..2339030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360581..2360600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2376876..>2536332)
FT                   /locus_tag="mCG_145585"
FT                   /note="gene_id=mCG145585.0"
FT   mRNA            complement(join(2376876..2377714,2478643..2478717,
FT                   2522368..2522485,2536032..>2536332))
FT                   /locus_tag="mCG_145585"
FT                   /product="mCG145585"
FT                   /note="gene_id=mCG145585.0 transcript_id=mCT185009.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2377361..>2377588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145585"
FT                   /product="mCG145585"
FT                   /note="gene_id=mCG145585.0 transcript_id=mCT185009.0
FT                   protein_id=mCP106307.0"
FT                   /protein_id="EDL38267.1"
FT   assembly_gap    2382825..2383452
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    2392116..2392135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2410672..2410720
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2411880..2411899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2418074..2418729
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    2421522..2421851
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    2427307..2428909
FT                   /estimated_length=1603
FT                   /gap_type="unknown"
FT   assembly_gap    2431010..2431960
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    2433214..2435460
FT                   /estimated_length=2247
FT                   /gap_type="unknown"
FT   assembly_gap    2443514..2443533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2458346..2459623
FT                   /estimated_length=1278
FT                   /gap_type="unknown"
FT   assembly_gap    2461109..2461429
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    2474155..2476474
FT                   /estimated_length=2320
FT                   /gap_type="unknown"
FT   assembly_gap    2493196..2493215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2508406..2508425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2509892..2509911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2513134..2513153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2532387..2532406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2536500..2536727
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    2544818..2545966
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    2546662..2548499
FT                   /estimated_length=1838
FT                   /gap_type="unknown"
FT   assembly_gap    2567911..2567930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2568985..2569004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2576891..2576910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2579292..2691867)
FT                   /locus_tag="mCG_20355"
FT                   /note="gene_id=mCG20355.2"
FT   mRNA            complement(join(2579292..2579660,2581090..2581225,
FT                   2584388..2584574,2586343..2586385,2588491..2588648,
FT                   2623139..2623317,2632981..2633091,2650782..2650883,
FT                   2654878..2655045,2667854..2668045,2673484..2675805,
FT                   2687993..2688118,2691835..2691867))
FT                   /locus_tag="mCG_20355"
FT                   /product="mCG20355"
FT                   /note="gene_id=mCG20355.2 transcript_id=mCT20425.2 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(2579561..2579660,2581090..2581225,
FT                   2584388..2584574,2586343..2586385,2588491..2588648,
FT                   2623139..2623317,2632981..2633091,2650782..2650883,
FT                   2654878..2655045,2667854..2668045,2673484..2675805,
FT                   2687993..2688011))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20355"
FT                   /product="mCG20355"
FT                   /note="gene_id=mCG20355.2 transcript_id=mCT20425.2
FT                   protein_id=mCP15302.2"
FT                   /db_xref="GOA:Q8BGR1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="MGI:MGI:1916489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGR1"
FT                   /protein_id="EDL38268.1"
FT                   QEFMSRPLEETRM"
FT   assembly_gap    2599659..2599678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2611145..2611740
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    2632478..2632576
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            2696786..2725454
FT                   /locus_tag="mCG_140970"
FT                   /note="gene_id=mCG140970.0"
FT   mRNA            join(2696786..2697047,2710481..2710605,2711596..2712032,
FT                   2712559..2712677)
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, transcript variant mCT172482"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172482.0
FT                   created on 27-AUG-2002"
FT   mRNA            join(2696816..2697047,2717856..2718037,2725025..2725454)
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, transcript variant mCT172483"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172483.0
FT                   created on 27-AUG-2002"
FT   CDS             join(2697018..2697047,2717856..2718037,2725025..2725205)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, isoform CRA_b"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172483.0
FT                   protein_id=mCP95401.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1922289"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0W3"
FT                   /protein_id="EDL38270.1"
FT   CDS             join(2697018..2697047,2710481..2710605,2711596..2711815)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, isoform CRA_a"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172482.0
FT                   protein_id=mCP95402.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1922289"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D578"
FT                   /protein_id="EDL38269.1"
FT   gene            complement(2700157..2713862)
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /note="gene_id=mCG20356.2"
FT   mRNA            complement(join(2700157..2702830,2703868..2704067,
FT                   2707043..2707156,2708163..2708330,2710394..2710983,
FT                   2711582..2711793,2713757..2713862))
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 12"
FT                   /note="gene_id=mCG20356.2 transcript_id=mCT20426.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(2702720..2702830,2703868..2704067,
FT                   2707043..2707156,2708163..2708330,2710394..2710983,
FT                   2711582..2711787))
FT                   /codon_start=1
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 12"
FT                   /note="gene_id=mCG20356.2 transcript_id=mCT20426.2
FT                   protein_id=mCP15297.1"
FT                   /protein_id="EDL38271.1"
FT                   NPNL"
FT   assembly_gap    2724351..2724463
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2747521..2750425
FT                   /estimated_length=2905
FT                   /gap_type="unknown"
FT   assembly_gap    2757604..2757623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2765508..2765538
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2772335..2772364
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2795554..2795573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2796882..2796934
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    2829746..2829765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2876274..2876293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2893071..2893090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2902004..2902023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2915720..2918549
FT                   /estimated_length=2830
FT                   /gap_type="unknown"
FT   assembly_gap    2919329..2919916
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    2929198..2929217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2993381..2993400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2995810..2995829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3016114..3016163
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    3017785..3018040
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    3019380..3019399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056127..3056497
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    3073644..3073757
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3095690..3096128
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    3134622..3134645
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3150120..3150272
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    3150851..3151251
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    3167358..3167522
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    3200694..3200713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3229414..3229433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3261821..3267352
FT                   /estimated_length=5532
FT                   /gap_type="unknown"
FT   assembly_gap    3276422..3280490
FT                   /estimated_length=4069
FT                   /gap_type="unknown"
FT   gene            3297854..3298349
FT                   /pseudo
FT                   /locus_tag="mCG_51517"
FT                   /note="gene_id=mCG51517.2"
FT   mRNA            3297854..3298349
FT                   /pseudo
FT                   /locus_tag="mCG_51517"
FT                   /note="gene_id=mCG51517.2 transcript_id=mCT51700.2 created
FT                   on 28-OCT-2002"
FT   assembly_gap    3311481..3311934
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    3317188..3317207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3357401..3357444
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    3376723..3376861
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    3393527..3393604
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3413846..3413872
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    3420951..3421064
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3427194..3427213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3431676..3431695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3486395..3486414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3490488..3490507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3561065..3562918
FT                   /estimated_length=1854
FT                   /gap_type="unknown"
FT   assembly_gap    3571712..3571731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3574564..3574583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3614051..3614070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3616643..3616662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3638649..3638668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3655108..3655170
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3657176..3657195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3681187..3681206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3728727..3728760
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3755706..3755773
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3757671..3757690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3775874..3776456
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    3823805..3823824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3859322..3859341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3869257..3869276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3892132..3892151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3913408..3913427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3947501..3947520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3969511..3969530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3997550..3998112
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    4006627..4007421
FT                   /estimated_length=795
FT                   /gap_type="unknown"
FT   assembly_gap    4012213..4012232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4023419..4023811
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    4042824..4042843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4049334..4049353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4066395..4067697
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    4071984..4072003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4079609..4079628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4081918..4082259
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    4087229..4087248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4101808..4102338
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    4136518..4139324
FT                   /estimated_length=2807
FT                   /gap_type="unknown"
FT   assembly_gap    4177491..4177510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4223372..4223391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4262317..4264531
FT                   /estimated_length=2215
FT                   /gap_type="unknown"
FT   assembly_gap    4265321..4265538
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    4268253..4268272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4326475..4326494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4336835..4336854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4367080..4367120
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    4404220..4404239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4432617..4432636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4484355..4489906
FT                   /estimated_length=5552
FT                   /gap_type="unknown"
FT   assembly_gap    4531214..4531233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4534164..4538058
FT                   /estimated_length=3895
FT                   /gap_type="unknown"
FT   assembly_gap    4545505..4545524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4573264..4573283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4723053..4723072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4780213..4780311
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4814208..4814227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4820812..4820831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4838727..4838897
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    4869762..4869803
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    4887763..4887855
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4888759..4888778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4916735..4916838
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4923192..4923286
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4930894..4930913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4961655..4962088
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    4999348..4999444
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5000643..5000705
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    5027891..5030732
FT                   /estimated_length=2842
FT                   /gap_type="unknown"
FT   assembly_gap    5031921..5031940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5052942..5053453
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    5093136..5093155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5096970..5097905
FT                   /pseudo
FT                   /locus_tag="mCG_48960"
FT                   /note="gene_id=mCG48960.2"
FT   mRNA            5096970..5097905
FT                   /pseudo
FT                   /locus_tag="mCG_48960"
FT                   /note="gene_id=mCG48960.2 transcript_id=mCT49143.1 created
FT                   on 28-OCT-2002"
FT   assembly_gap    5117901..5117920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5133970..5134354
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    5173603..5173657
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5184582..5184601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5237871..5238055
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    5240883..5241093
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    5246590..5246609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5310110..5310129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5319683..5319702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5322620..5323029
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    5353504..5353523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5382938..5383101
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    5414583..5414602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5423167..5423678
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    5441156..5441258
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    5464467..5464486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5479860..5480739)
FT                   /pseudo
FT                   /locus_tag="mCG_120651"
FT                   /note="gene_id=mCG120651.0"
FT   mRNA            complement(5479860..5480739)
FT                   /pseudo
FT                   /locus_tag="mCG_120651"
FT                   /note="gene_id=mCG120651.0 transcript_id=mCT121842.0
FT                   created on 19-JUL-2002"
FT   gene            5480763..5481092
FT                   /pseudo
FT                   /locus_tag="mCG_140671"
FT                   /note="gene_id=mCG140671.0"
FT   mRNA            5480763..5481092
FT                   /pseudo
FT                   /locus_tag="mCG_140671"
FT                   /note="gene_id=mCG140671.0 transcript_id=mCT170635.0
FT                   created on 19-JUL-2002"
FT   assembly_gap    5484240..5484336
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5554048..5554067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5569778..5570241
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    5570477..5570540
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5641809..5641828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5642698..5642848
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    5648918..5653706
FT                   /estimated_length=4789
FT                   /gap_type="unknown"
FT   assembly_gap    5697692..5697886
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    5718173..5718192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5772509..5772528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5779106..5779229
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5793683..5793702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5841806..5841871
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    5849957..5849976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5854968..5855058
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    5878526..5878545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5906515..5906684
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    5924010..5924097
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    6013399..6013418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6020109..6020128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6034599..6034736
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    6042358..6043005
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    6074401..6074668
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    6076086..6076233
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    6085497..6091246
FT                   /estimated_length=5750
FT                   /gap_type="unknown"
FT   assembly_gap    6095835..6098276
FT                   /estimated_length=2442
FT                   /gap_type="unknown"
FT   assembly_gap    6100097..6100642
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    6116776..6116795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6127276..6127318
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6148837..6149189
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    6173942..6173961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6179868..6180093
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    6212931..6212957
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6219162..6219181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6222490..6222641
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6234786..6235107
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    6241658..6241677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6246393..6246627
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    6251296..6251360
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    6263831..6264718
FT                   /estimated_length=888
FT                   /gap_type="unknown"
FT   assembly_gap    6269937..6269956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6281840..6282002
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    6287114..6287133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6296085..6297798
FT                   /estimated_length=1714
FT                   /gap_type="unknown"
FT   gene            complement(6306490..6579897)
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /note="gene_id=mCG50503.2"
FT   mRNA            complement(join(6306490..6306888,6312746..6312826,
FT                   6313267..6313332,6350271..>6350301))
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, transcript variant mCT170639"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT170639.0 created
FT                   on 12-SEP-2002"
FT   mRNA            complement(join(6306742..6306888,6313267..6313332,
FT                   6350271..6350563,6579759..6579897))
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, transcript variant mCT50686"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT50686.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(6306767..6306888,6313267..6313332,
FT                   6350271..6350563,6579759..6579883))
FT                   /codon_start=1
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, isoform CRA_b"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT50686.2
FT                   protein_id=mCP36250.2 isoform=CRA_b"
FT                   /protein_id="EDL38273.1"
FT   CDS             complement(join(6306767..6306888,6312746..6312826,
FT                   6313267..6313332,6350271..>6350301))
FT                   /codon_start=1
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, isoform CRA_a"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT170639.0
FT                   protein_id=mCP93557.0 isoform=CRA_a"
FT                   /protein_id="EDL38272.1"
FT   assembly_gap    6330271..6330299
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6389609..6389796
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    6411491..6411510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6414565..6414588
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    6415953..6415972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6432516..6586662
FT                   /locus_tag="mCG_145592"
FT                   /note="gene_id=mCG145592.0"
FT   mRNA            join(<6432516..6432530,6432875..6432882,6584106..6586662)
FT                   /locus_tag="mCG_145592"
FT                   /product="mCG145592"
FT                   /note="gene_id=mCG145592.0 transcript_id=mCT185016.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    6439480..6439499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6446141..6446181
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    6477492..6477807
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    6510528..6510562
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    6542847..6542886
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6572178..6572197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6579281..6579300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6580366..6580723
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    6581980..6582187
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   CDS             <6585767..6586033
FT                   /codon_start=1
FT                   /locus_tag="mCG_145592"
FT                   /product="mCG145592"
FT                   /note="gene_id=mCG145592.0 transcript_id=mCT185016.0
FT                   protein_id=mCP106314.0"
FT                   /protein_id="EDL38274.1"
FT   assembly_gap    6635019..6635753
FT                   /estimated_length=735
FT                   /gap_type="unknown"
FT   assembly_gap    6645382..6645401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6665872..6666894
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    6686678..6687431
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    6701896..6701915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6712129..6712148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6756740..7192074)
FT                   /locus_tag="mCG_1995"
FT                   /note="gene_id=mCG1995.3"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170837,7187033..7187290,7190086..7190208,
FT                   7192010..7192074))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT1123"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT1123.3 created on
FT                   16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170837,7180418..7180678))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT186586"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186586.0 created
FT                   on 16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924504..6924529,7056105..7056235,7084301..7084408,
FT                   7089746..7089872,7155357..7155464))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT172481"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT172481.1 created
FT                   on 16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7150880..7151010))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT186585"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186585.0 created
FT                   on 16-JUL-2003"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_a"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT1123.3
FT                   protein_id=mCP6310.3 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9V9"
FT                   /protein_id="EDL38275.1"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_a"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186586.0
FT                   protein_id=mCP107820.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9V9"
FT                   /protein_id="EDL38278.1"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7150880..7150963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_c"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186585.0
FT                   protein_id=mCP107821.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9QZN1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN1"
FT                   /protein_id="EDL38277.1"
FT                   SAATS"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924504..6924529,7056105..7056235,7084301..7084345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_b"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT172481.1
FT                   protein_id=mCP95400.1 isoform=CRA_b"
FT                   /protein_id="EDL38276.1"
FT   assembly_gap    6770399..6770418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6809008..6809027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6829527..6829546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6849134..6849153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6850659..6851017
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    6948678..6950203
FT                   /estimated_length=1526
FT                   /gap_type="unknown"
FT   gene            complement(7005067..>7012325)
FT                   /locus_tag="mCG_146122"
FT                   /note="gene_id=mCG146122.0"
FT   mRNA            complement(join(7005067..7005526,7007875..7008141,
FT                   7012218..>7012325))
FT                   /locus_tag="mCG_146122"
FT                   /product="mCG146122"
FT                   /note="gene_id=mCG146122.0 transcript_id=mCT186225.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(7005106..>7005267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146122"
FT                   /product="mCG146122"
FT                   /note="gene_id=mCG146122.0 transcript_id=mCT186225.0
FT                   protein_id=mCP107778.0"
FT                   /protein_id="EDL38279.1"
FT                   YCKGVSLY"
FT   assembly_gap    7010808..7010856
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    7036232..7036332
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            7046295..7047390
FT                   /pseudo
FT                   /locus_tag="mCG_48775"
FT                   /note="gene_id=mCG48775.2"
FT   mRNA            7046295..7047390
FT                   /pseudo
FT                   /locus_tag="mCG_48775"
FT                   /note="gene_id=mCG48775.2 transcript_id=mCT48958.2 created
FT                   on 28-OCT-2002"
FT   gene            <7051514..7052241
FT                   /locus_tag="mCG_141373"
FT                   /note="gene_id=mCG141373.0"
FT   mRNA            <7051514..7052241
FT                   /locus_tag="mCG_141373"
FT                   /product="mCG141373"
FT                   /note="gene_id=mCG141373.0 transcript_id=mCT174991.0
FT                   created on 28-OCT-2002"
FT   CDS             <7051515..7051664
FT                   /codon_start=1
FT                   /locus_tag="mCG_141373"
FT                   /product="mCG141373"
FT                   /note="gene_id=mCG141373.0 transcript_id=mCT174991.0
FT                   protein_id=mCP97910.0"
FT                   /protein_id="EDL38280.1"
FT                   CAML"
FT   assembly_gap    7126702..7126869
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    7183468..7183545
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    7198300..7199927
FT                   /estimated_length=1628
FT                   /gap_type="unknown"
FT   assembly_gap    7212535..7212590
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    7228505..7228803
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    7246553..7246572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7254635..7259097
FT                   /estimated_length=4463
FT                   /gap_type="unknown"
FT   assembly_gap    7262419..7262438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7264831..7265113
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   gene            7272237..7272815
FT                   /pseudo
FT                   /locus_tag="mCG_1997"
FT                   /note="gene_id=mCG1997.1"
FT   mRNA            7272237..7272815
FT                   /pseudo
FT                   /locus_tag="mCG_1997"
FT                   /note="gene_id=mCG1997.1 transcript_id=mCT1125.1 created on
FT                   14-OCT-2002"
FT   assembly_gap    7283828..7283847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7289066..7289085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7303676..7303832
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    7309792..7309811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7312991..7314713
FT                   /estimated_length=1723
FT                   /gap_type="unknown"
FT   assembly_gap    7317797..7319252
FT                   /estimated_length=1456
FT                   /gap_type="unknown"
FT   gene            complement(7328778..7329365)
FT                   /locus_tag="mCG_121622"
FT                   /note="gene_id=mCG121622.1"
FT   mRNA            complement(7328778..7329365)
FT                   /locus_tag="mCG_121622"
FT                   /product="mCG121622"
FT                   /note="gene_id=mCG121622.1 transcript_id=mCT122821.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(7329115..7329291)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121622"
FT                   /product="mCG121622"
FT                   /note="gene_id=mCG121622.1 transcript_id=mCT122821.1
FT                   protein_id=mCP71114.1"
FT                   /protein_id="EDL38281.1"
FT                   LSKGSLMIMIKRN"
FT   assembly_gap    7351869..7351888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7366993..7372433
FT                   /estimated_length=5441
FT                   /gap_type="unknown"
FT   assembly_gap    7381360..7381379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7394886..7395701
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   gene            complement(7402922..7403931)
FT                   /pseudo
FT                   /locus_tag="mCG_4338"
FT                   /note="gene_id=mCG4338.2"
FT   mRNA            complement(7402922..7403931)
FT                   /pseudo
FT                   /locus_tag="mCG_4338"
FT                   /note="gene_id=mCG4338.2 transcript_id=mCT3322.2 created on
FT                   14-OCT-2002"
FT   assembly_gap    7428751..7436189
FT                   /estimated_length=7439
FT                   /gap_type="unknown"
FT   assembly_gap    7439517..7439536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7440563..7440582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7443932..7443951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7447314..7447944
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    7463085..7467059
FT                   /estimated_length=3975
FT                   /gap_type="unknown"
FT   assembly_gap    7473910..7473929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7477283..7478274
FT                   /estimated_length=992
FT                   /gap_type="unknown"
FT   assembly_gap    7485864..7485883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7489821..7489840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7492791..7493382
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    7501618..7501665
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    7517967..7518031
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(7562326..7564038)
FT                   /locus_tag="mCG_148341"
FT                   /note="gene_id=mCG148341.0"
FT   mRNA            complement(7562326..7564038)
FT                   /locus_tag="mCG_148341"
FT                   /product="mCG148341"
FT                   /note="gene_id=mCG148341.0 transcript_id=mCT188604.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7563344..7563529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148341"
FT                   /product="mCG148341"
FT                   /note="gene_id=mCG148341.0 transcript_id=mCT188604.0
FT                   protein_id=mCP108820.0"
FT                   /protein_id="EDL38282.1"
FT                   FANLVQNRSKVDLNRS"
FT   assembly_gap    7565141..7590149
FT                   /estimated_length=25009
FT                   /gap_type="unknown"
FT   gene            7600669..7817775
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /note="gene_id=mCG4337.2"
FT   mRNA            join(7600669..7600750,7601310..7601429,7611013..7611135,
FT                   7618085..7618274,7650107..7650199,7658525..7658728,
FT                   7668637..7668678,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7817775)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT170904"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170904.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(7600692..7600750,7601310..7601429,7611013..7611135,
FT                   7618085..7618274,7650107..7650199,7658525..7658728,
FT                   7668637..7668678,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_a"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170904.0
FT                   protein_id=mCP93822.0 isoform=CRA_a"
FT                   /protein_id="EDL38283.1"
FT   assembly_gap    7613467..7613486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(7614766..7614862,7618085..7618274,7618377..7618551,
FT                   7634171..7634363,7650107..7650199,7658525..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816427)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT3321"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT3321.0 created on
FT                   23-JUL-2002"
FT   mRNA            join(<7614996..7615036,7618085..7618274,7618377..7618551,
FT                   7650107..7650199,7658522..7658663,7668637..>7668662)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT170903"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170903.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(<7618161..7618274,7650107..7650199,7658522..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816426)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT193657"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT193657.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7618161..7618274,7650107..7650199,7658522..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_b"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT193657.0
FT                   protein_id=mCP114660.0 isoform=CRA_b"
FT                   /protein_id="EDL38284.1"
FT   CDS             join(<7618507..7618551,7650107..7650199,7658522..7658663,
FT                   7668637..>7668662)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_d"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170903.0
FT                   protein_id=mCP93821.0 isoform=CRA_d"
FT                   /protein_id="EDL38286.1"
FT   assembly_gap    7630964..7631189
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   CDS             join(7634235..7634363,7650107..7650199,7658525..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_c"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT3321.0
FT                   protein_id=mCP6271.1 isoform=CRA_c"
FT                   /protein_id="EDL38285.1"
FT   assembly_gap    7639618..7639637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7648110..7648242
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    7725533..7725625
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(7726864..7727675)
FT                   /locus_tag="mCG_148332"
FT                   /note="gene_id=mCG148332.0"
FT   mRNA            complement(join(7726864..7727427,7727572..7727675))
FT                   /locus_tag="mCG_148332"
FT                   /product="mCG148332"
FT                   /note="gene_id=mCG148332.0 transcript_id=mCT188595.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7727163..7727303)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148332"
FT                   /product="mCG148332"
FT                   /note="gene_id=mCG148332.0 transcript_id=mCT188595.0
FT                   protein_id=mCP108810.0"
FT                   /protein_id="EDL38287.1"
FT                   A"
FT   assembly_gap    7746612..7746631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7772489..7774823
FT                   /estimated_length=2335
FT                   /gap_type="unknown"
FT   gene            7869799..7870220
FT                   /pseudo
FT                   /locus_tag="mCG_4340"
FT                   /note="gene_id=mCG4340.2"
FT   mRNA            join(7869799..7870029,7870112..7870220)
FT                   /pseudo
FT                   /locus_tag="mCG_4340"
FT                   /note="gene_id=mCG4340.2 transcript_id=mCT3313.2 created on
FT                   14-OCT-2002"
FT   assembly_gap    7887613..7887632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7896233..7896566
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    7898518..7899799
FT                   /estimated_length=1282
FT                   /gap_type="unknown"
FT   assembly_gap    7900871..7901245
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    7907539..7907558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7919637..7946938)
FT                   /locus_tag="mCG_148345"
FT                   /note="gene_id=mCG148345.0"
FT   mRNA            complement(join(7919637..7920602,7946868..7946938))
FT                   /locus_tag="mCG_148345"
FT                   /product="mCG148345"
FT                   /note="gene_id=mCG148345.0 transcript_id=mCT188608.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7920176..7920427)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148345"
FT                   /product="mCG148345"
FT                   /note="gene_id=mCG148345.0 transcript_id=mCT188608.0
FT                   protein_id=mCP108822.0"
FT                   /protein_id="EDL38288.1"
FT   assembly_gap    7939035..7939054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7944682..7944807
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    7946148..7946465
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   gene            complement(7958240..8008972)
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /note="gene_id=mCG4341.2"
FT   mRNA            complement(join(7958240..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7985861..7986905,7988410..7988610,7990243..7990360,
FT                   8008924..8008972))
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, transcript
FT                   variant mCT173271"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT173271.0 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(7958240..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7974961..7975146,7985861..7986905,7988410..7988610,
FT                   7990243..7990360,8008924..8008972))
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, transcript
FT                   variant mCT3314"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT3314.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(7960654..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7985861..7986905,7988410..7988610,7990243..7990273))
FT                   /codon_start=1
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, isoform CRA_a"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT173271.0
FT                   protein_id=mCP96190.0 isoform=CRA_a"
FT                   /protein_id="EDL38289.1"
FT                   PANDNAEEAP"
FT   CDS             complement(join(7960654..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7974961..7975146,7985861..7986905,7988410..7988610,
FT                   7990243..7990273))
FT                   /codon_start=1
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, isoform CRA_b"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT3314.2
FT                   protein_id=mCP6320.1 isoform=CRA_b"
FT                   /protein_id="EDL38290.1"
FT                   DASPANDNAEEAP"
FT   assembly_gap    8008617..8008923
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    8021951..8021970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8045108..8045127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8046705..8046923
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    8069895..8069914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8072250..8072269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8074510..8074694
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    8086143..8086162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8101856..8102247
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    8118521..8118909
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    8136071..8136090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8141642..8141671
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    8145196..8145215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8160758..8160777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8169579..8170337
FT                   /estimated_length=759
FT                   /gap_type="unknown"
FT   assembly_gap    8171922..8172247
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    8173151..8173530
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    8175243..8175496
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    8180661..8180681
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    8182029..8182623
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    8194036..8194920
FT                   /estimated_length=885
FT                   /gap_type="unknown"
FT   assembly_gap    8265753..8266871
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   gene            <8280143..8432951
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /note="gene_id=mCG121684.0"
FT   mRNA            join(<8280143..8280364,8303013..8303264,8303792..8303936,
FT                   8314969..8315140,8329733..8329860,8337302..8337475,
FT                   8345138..8345324,8347813..8347990,8350249..8350451,
FT                   8353466..8353648,8358113..8358227,8359457..8359527,
FT                   8388609..8388774,8390157..8390378,8391467..8391589,
FT                   8392503..8392617,8409102..8409235,8411621..8411762,
FT                   8412831..8412964,8418577..8418780,8428624..8428734,
FT                   8430254..8432951)
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /product="mannosidase 2, alpha 1"
FT                   /note="gene_id=mCG121684.0 transcript_id=mCT122895.0
FT                   created on 23-JUL-2002"
FT   CDS             join(<8280143..8280364,8303013..8303264,8303792..8303936,
FT                   8314969..8315140,8329733..8329860,8337302..8337475,
FT                   8345138..8345324,8347813..8347990,8350249..8350451,
FT                   8353466..8353648,8358113..8358227,8359457..8359527,
FT                   8388609..8388774,8390157..8390378,8391467..8391589,
FT                   8392503..8392617,8409102..8409235,8411621..8411762,
FT                   8412831..8412964,8418577..8418780,8428624..8428734,
FT                   8430254..8430412)
FT                   /codon_start=1
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /product="mannosidase 2, alpha 1"
FT                   /note="gene_id=mCG121684.0 transcript_id=mCT122895.0
FT                   protein_id=mCP70896.0"
FT                   /protein_id="EDL38291.1"
FT                   MEISTFRIRLRWT"
FT   assembly_gap    8282366..8282385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8319454..8319484
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    8331398..8331497
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    8357096..8357417
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    8359156..8359175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8393487..8393506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8423317..8423336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8444954..8445776
FT                   /locus_tag="mCG_148348"
FT                   /note="gene_id=mCG148348.0"
FT   mRNA            join(8444954..8445189,8445284..8445776)
FT                   /locus_tag="mCG_148348"
FT                   /product="mCG148348"
FT                   /note="gene_id=mCG148348.0 transcript_id=mCT188611.0
FT                   created on 13-JAN-2004"
FT   CDS             join(8445011..8445189,8445284)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148348"
FT                   /product="mCG148348"
FT                   /note="gene_id=mCG148348.0 transcript_id=mCT188611.0
FT                   protein_id=mCP108826.0"
FT                   /protein_id="EDL38292.1"
FT                   CMTTTMMTLFSIQL"
FT   assembly_gap    8459975..8459994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8469096..8469248
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            complement(8510248..>8513798)
FT                   /locus_tag="mCG_55846"
FT                   /note="gene_id=mCG55846.2"
FT   mRNA            complement(join(8510248..8510481,8511997..8512069,
FT                   8512151..8512339,8513663..>8513798))
FT                   /locus_tag="mCG_55846"
FT                   /product="mCG55846"
FT                   /note="gene_id=mCG55846.2 transcript_id=mCT56029.1 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(8510427..8510481,8511997..8512069,
FT                   8512151..8512339,8513663..>8513798))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55846"
FT                   /product="mCG55846"
FT                   /note="gene_id=mCG55846.2 transcript_id=mCT56029.1
FT                   protein_id=mCP28827.1"
FT                   /protein_id="EDL38293.1"
FT   assembly_gap    8556476..8556495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8557691..8557797
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8598137..8598156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8603719..8603738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8627922..8628148
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    8629318..8629337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8649556..8649575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8763513..8765429
FT                   /estimated_length=1917
FT                   /gap_type="unknown"
FT   assembly_gap    8789127..8789149
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8795068..8795465
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    8818886..8818905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8832483..8838142
FT                   /estimated_length=5660
FT                   /gap_type="unknown"
FT   assembly_gap    8839752..8839771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8841615..8841681
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            complement(8846945..8847330)
FT                   /pseudo
FT                   /locus_tag="mCG_1039320"
FT                   /note="gene_id=mCG1039320.1"
FT   mRNA            complement(8846945..8847330)
FT                   /pseudo
FT                   /locus_tag="mCG_1039320"
FT                   /note="gene_id=mCG1039320.1 transcript_id=mCT157024.1
FT                   created on 28-OCT-2002"
FT   assembly_gap    8860271..8860305
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    8864597..8867593
FT                   /estimated_length=2997
FT                   /gap_type="unknown"
FT   assembly_gap    8904778..8904799
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    8944996..8945015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8956643..8956850
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    8958755..8959585
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    8965324..8965412
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    8965976..8965995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8971566..8975600
FT                   /estimated_length=4035
FT                   /gap_type="unknown"
FT   assembly_gap    8986472..8986491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9006936..9007414
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    9011354..9017049
FT                   /estimated_length=5696
FT                   /gap_type="unknown"
FT   assembly_gap    9032729..9032903
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    9051291..9051310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9061826..9206343)
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /note="gene_id=mCG15611.2"
FT   mRNA            complement(join(<9061826..9062059,9082132..9082310,
FT                   9109700..9109952,9115184..9115307,9129248..9129402,
FT                   9142000..9142157,9143751..9143850,9149761..9149918,
FT                   9151253..9151358,9151861..9151972,9165493..9165627,
FT                   9182552..9182658,9206270..9206343))
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /product="RIKEN cDNA E130009J12"
FT                   /note="gene_id=mCG15611.2 transcript_id=mCT18789.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(<9061826..9062059,9082132..9082310,
FT                   9109700..9109952,9115184..9115307,9129248..9129402,
FT                   9142000..9142157,9143751..9143850,9149761..9149918,
FT                   9151253..9151358,9151861..9151972,9165493..9165611))
FT                   /codon_start=1
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /product="RIKEN cDNA E130009J12"
FT                   /note="gene_id=mCG15611.2 transcript_id=mCT18789.2
FT                   protein_id=mCP6276.2"
FT                   /protein_id="EDL38294.1"
FT   assembly_gap    9069612..9069825
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    9078856..9078875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9083541..9083560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9106391..9108074
FT                   /pseudo
FT                   /locus_tag="mCG_1039289"
FT                   /note="gene_id=mCG1039289.1"
FT   mRNA            join(9106391..9106546,9107510..9108074)
FT                   /pseudo
FT                   /locus_tag="mCG_1039289"
FT                   /note="gene_id=mCG1039289.1 transcript_id=mCT156993.1
FT                   created on 25-OCT-2002"
FT   assembly_gap    9165446..9165465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9205050..9205119
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    9216173..9216192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9244523..9277845)
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /note="gene_id=mCG15608.1"
FT   mRNA            complement(join(9244523..9245316,9247049..9247222,
FT                   9256760..9256840,9257909..9258012,9259371..9259523,
FT                   9277572..9277845))
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, transcript variant mCT18786"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT18786.2 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(9244871..9245316,9247049..9247222,
FT                   9251513..9251635,9256760..9256840,9257909..9258012,
FT                   9259371..>9259438))
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, transcript variant mCT171235"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT171235.0 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(9245158..9245316,9247049..9247222,
FT                   9256760..9256840,9257909..9258012,9259371..9259523,
FT                   9277572..9277647))
FT                   /codon_start=1
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, isoform CRA_a"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT18786.2
FT                   protein_id=mCP6327.2 isoform=CRA_a"
FT                   /protein_id="EDL38295.1"
FT   CDS             complement(join(9245158..9245316,9247049..9247222,
FT                   9251513..9251635,9256760..9256840,9257909..9258012,
FT                   9259371..>9259437))
FT                   /codon_start=1
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, isoform CRA_b"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT171235.0
FT                   protein_id=mCP94153.0 isoform=CRA_b"
FT                   /protein_id="EDL38296.1"
FT                   AIFIGFFLGKFIL"
FT   assembly_gap    9277297..9277570
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    9291584..9291712
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    9293158..9293249
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    9298810..9299156
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            complement(9302112..9304354)
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /note="gene_id=mCG53767.1"
FT   mRNA            complement(join(9302112..9303627,9304153..9304354))
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /product="thioredoxin domain containing 2 (spermatozoa)"
FT                   /note="gene_id=mCG53767.1 transcript_id=mCT53950.1 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(9302126..9303627,9304153..9304282))
FT                   /codon_start=1
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /product="thioredoxin domain containing 2 (spermatozoa)"
FT                   /note="gene_id=mCG53767.1 transcript_id=mCT53950.1
FT                   protein_id=mCP28769.1"
FT                   /protein_id="EDL38297.1"
FT   gene            complement(9316325..>9437247)
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /note="gene_id=mCG15609.1"
FT   mRNA            complement(join(9316325..9319100,9360816..9360922,
FT                   9362536..9362607,9382272..9382353,9386798..9386877,
FT                   9437073..>9437247))
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, transcript
FT                   variant mCT18788"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT18788.1 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9318276..9319100,9339320..>9339649))
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, transcript
FT                   variant mCT170892"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT170892.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(9318773..9319100,9360816..9360922,
FT                   9362536..9362607,9382272..9382353,9386798..9386877,
FT                   9437073..>9437138))
FT                   /codon_start=1
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT18788.1
FT                   protein_id=mCP6258.1 isoform=CRA_b"
FT                   /protein_id="EDL38299.1"
FT   CDS             complement(join(9319003..9319100,9339320..>9339356))
FT                   /codon_start=1
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT170892.0
FT                   protein_id=mCP93810.0 isoform=CRA_a"
FT                   /protein_id="EDL38298.1"
FT   assembly_gap    9328545..9328751
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    9331232..9331469
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    9332551..9333113
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    9356999..9357018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9374903..9374922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9379310..9379753
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    9389486..9389505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9393905..9394723
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    9410577..9410596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9413823..9413842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9418420..9418439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9419590..9421870
FT                   /estimated_length=2281
FT                   /gap_type="unknown"
FT   assembly_gap    9434765..9434784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9444862..9445059
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            9447242..9506338
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /note="gene_id=mCG9066.3"
FT   mRNA            join(9447242..9447351,9467857..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185518"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185518.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9447394..9447540,9467857..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185517"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185517.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9447449..9447688,9467908..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT9112"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT9112.3 created on
FT                   10-JUN-2003"
FT   mRNA            join(9447449..9447688,9467908..9467992,9505321..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185514"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185514.0 created
FT                   on 10-JUN-2003"
FT   assembly_gap    9447709..9448167
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    9458889..9459133
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    9465977..9466196
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   mRNA            join(9467434..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185515"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185515.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185515.0
FT                   protein_id=mCP106775.0 isoform=CRA_c"
FT                   /protein_id="EDL38302.1"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185517.0
FT                   protein_id=mCP106773.0 isoform=CRA_c"
FT                   /protein_id="EDL38304.1"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185518.0
FT                   protein_id=mCP106772.0 isoform=CRA_c"
FT                   /protein_id="EDL38305.1"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT9112.3
FT                   protein_id=mCP6294.3 isoform=CRA_c"
FT                   /protein_id="EDL38306.1"
FT   CDS             join(9467934..9467992,9505321..9505414)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185514.0
FT                   protein_id=mCP106771.0 isoform=CRA_b"
FT                   /protein_id="EDL38301.1"
FT                   SLKMQ"
FT   assembly_gap    9479234..9479326
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   mRNA            join(9481561..9481588,9488822..9489351,9493936..9494108,
FT                   9495558..9495653,9497507..9497692,9499599..9499760,
FT                   9500600..9500700,9502100..9502220,9502306..9502440,
FT                   9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185513"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185513.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9484706..9484730,9484877..9484958,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506266)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT172489"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT172489.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9488823..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185513.0
FT                   protein_id=mCP106774.0 isoform=CRA_a"
FT                   /protein_id="EDL38300.1"
FT   CDS             join(9488823..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT172489.0
FT                   protein_id=mCP95408.0 isoform=CRA_a"
FT                   /protein_id="EDL38307.1"
FT   mRNA            join(9493509..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185516"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185516.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9497546..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185516.0
FT                   protein_id=mCP106776.0 isoform=CRA_d"
FT                   /protein_id="EDL38303.1"
FT   assembly_gap    9498898..9498963
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    9507206..9507343
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    9512056..9512881
FT                   /estimated_length=826
FT                   /gap_type="unknown"
FT   gene            complement(9513657..9551107)
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /note="gene_id=mCG9065.3"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9551080..9551107))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170917"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170917.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9550880..9550974))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170916"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170916.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9549915..9550095))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170915"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170915.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513675..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9550372..9550519))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT9111"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT9111.1 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170915.1
FT                   protein_id=mCP93833.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38308.1"
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170916.1
FT                   protein_id=mCP93835.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38309.1"
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170917.1
FT                   protein_id=mCP93834.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38310.1"
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT9111.1
FT                   protein_id=mCP6290.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38311.1"
FT                   KASPSKDRKETPI"
FT   assembly_gap    9539658..9542829
FT                   /estimated_length=3172
FT                   /gap_type="unknown"
FT   gene            9552113..9554716
FT                   /locus_tag="mCG_148340"
FT                   /note="gene_id=mCG148340.0"
FT   mRNA            join(9552113..9552300,9553846..9554716)
FT                   /locus_tag="mCG_148340"
FT                   /product="mCG148340"
FT                   /note="gene_id=mCG148340.0 transcript_id=mCT188603.0
FT                   created on 13-JAN-2004"
FT   CDS             9554112..9554267
FT                   /codon_start=1
FT                   /locus_tag="mCG_148340"
FT                   /product="mCG148340"
FT                   /note="gene_id=mCG148340.0 transcript_id=mCT188603.0
FT                   protein_id=mCP108819.0"
FT                   /protein_id="EDL38312.1"
FT                   DTETGQ"
FT   assembly_gap    9562076..9562095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9563751..9563770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9569263..9569441
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    9576456..9576736
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    9579275..9579828
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    9586617..9587159
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   gene            complement(9591855..9621024)
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /note="gene_id=mCG9067.2"
FT   mRNA            complement(join(9591855..9592920,9596139..9596348,
FT                   9599431..9599697,9607691..9607790,9618543..9618699,
FT                   9620954..9621005))
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   transcript variant mCT170918"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT170918.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9592948..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618699,9620954..9621024))
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   transcript variant mCT9114"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT9114.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(9596167..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618662))
FT                   /codon_start=1
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT170918.0
FT                   protein_id=mCP93836.0 isoform=CRA_a"
FT                   /protein_id="EDL38313.1"
FT                   "
FT   CDS             complement(join(9596167..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618662))
FT                   /codon_start=1
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT9114.1
FT                   protein_id=mCP6298.2 isoform=CRA_a"
FT                   /protein_id="EDL38314.1"
FT                   "
FT   assembly_gap    9627201..9627468
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    9630263..9630308
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            complement(9636482..9746720)
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /note="gene_id=mCG9056.2"
FT   mRNA            complement(join(9636482..9640301,9642261..9642356,
FT                   9645986..9646129,9649467..9649565,9652801..9657458,
FT                   9693845..9693992,9697016..9697158,9701135..9701335,
FT                   9707257..9707403,9712162..9712230,9719416..9719563,
FT                   9722584..>9722670))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT170913"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170913.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9637977..9638138,9640114..9640301,
FT                   9641491..9641667,9642261..9642337))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT170914"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170914.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(9640116..9640301,9642261..9642356,
FT                   9645986..9646129,9649467..9649565,9652801..9657458,
FT                   9693845..9693992,9697016..9697158,9701135..9701335,
FT                   9707257..9707403,9712162..9712230,9719416..9719563,
FT                   9722584..9722670))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170913.0
FT                   protein_id=mCP93831.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E893"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="MGI:MGI:1914357"
FT                   /db_xref="UniProtKB/TrEMBL:G5E893"
FT                   /protein_id="EDL38315.1"
FT   CDS             complement(join(9640116..9640301,9641491..9641562))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_b"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170914.0
FT                   protein_id=mCP93832.0 isoform=CRA_b"
FT                   /protein_id="EDL38316.1"
FT   mRNA            complement(join(<9657004..9657458,9693845..9693992,
FT                   9697016..9697158,9701135..9701335,9707257..9707403,
FT                   9712162..9712230,9719416..9719563,9722584..9722721,
FT                   9746514..>9746547))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT193695"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT193695.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<9657004..9657458,9693845..9693992,
FT                   9697016..9697158,9701135..9701335,9707257..9707403,
FT                   9712162..9712230,9719416..9719563,9722584..>9722685))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_c"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT193695.0
FT                   protein_id=mCP114667.0 isoform=CRA_c"
FT                   /protein_id="EDL38317.1"
FT                   AKKEYEYKQKGKV"
FT   assembly_gap    9668251..9668270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9672090..9672717
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    9674044..9674063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9685747..9685766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(9706562..9707403,9719416..9719563,
FT                   9722584..9722721,9746514..9746720))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT9102"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT9102.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(9707249..9707403,9719416..9719563,
FT                   9722584..9722670))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_d"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT9102.1
FT                   protein_id=mCP6303.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9CQQ3"
FT                   /db_xref="MGI:MGI:1914357"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQQ3"
FT                   /protein_id="EDL38318.1"
FT   assembly_gap    9709084..9709175
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    9714223..9714361
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    9736173..9736192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9746139..9746291
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            <9746800..9747598
FT                   /locus_tag="mCG_1039377"
FT                   /note="gene_id=mCG1039377.1"
FT   mRNA            <9746800..9747598
FT                   /locus_tag="mCG_1039377"
FT                   /product="mCG1039377"
FT                   /note="gene_id=mCG1039377.1 transcript_id=mCT157081.1
FT                   created on 31-OCT-2002"
FT   CDS             <9746802..9747131
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039377"
FT                   /product="mCG1039377"
FT                   /note="gene_id=mCG1039377.1 transcript_id=mCT157081.1
FT                   protein_id=mCP70863.1"
FT                   /protein_id="EDL38319.1"
FT                   QVRVA"
FT   gene            complement(9748841..>9771070)
FT                   /locus_tag="mCG_9061"
FT                   /note="gene_id=mCG9061.1"
FT   mRNA            complement(join(9748841..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9761498..9761563,9770959..>9771070))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT9106"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT9106.1 created on
FT                   28-AUG-2002"
FT   mRNA            complement(join(9749071..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9759065..9759127,9761498..9761563,9770959..>9771054))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193671"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193671.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9749124..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_d"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT9106.1
FT                   protein_id=mCP6323.1 isoform=CRA_d"
FT                   /protein_id="EDL38323.1"
FT                   LTEPPKGPGFGVQAGL"
FT   CDS             complement(join(9749124..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9759065..9759127,9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_c"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193671.0
FT                   protein_id=mCP114670.0 isoform=CRA_c"
FT                   /protein_id="EDL38322.1"
FT   mRNA            complement(join(9750441..9750514,9753028..9753141,
FT                   9757037..9757205,9758866..9758982,9759065..9759127,
FT                   9761498..9761563,9770959..>9771043))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193670"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193670.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9750492..9750514,9753028..9753141,
FT                   9757037..9757205,9758866..9758982,9759065..9759127,
FT                   9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_b"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193670.0
FT                   protein_id=mCP114669.0 isoform=CRA_b"
FT                   /protein_id="EDL38321.1"
FT   mRNA            complement(join(<9753096..9753141,9757037..9757205,
FT                   9758866..9758982,9759065..9759127,9761498..9761563,
FT                   9770522..9770618,9770959..>9771041))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193669"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193669.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<9753096..9753141,9757037..9757205,
FT                   9758866..9758982,9759065..9759127,9761498..9761563,
FT                   9770522..>9770527))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_a"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193669.0
FT                   protein_id=mCP114668.0 isoform=CRA_a"
FT                   /protein_id="EDL38320.1"
FT   assembly_gap    9763909..9764054
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    9767834..9768235
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    9773017..9773382
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   gene            <9781027..9789926
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /note="gene_id=mCG9062.2"
FT   mRNA            join(<9781027..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9787539..9787697,9788287..9788355,
FT                   9788473..9789926)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT9108"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT9108.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<9781027..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9787539..9787697,9788287..9788355,
FT                   9788473..9788612)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_c"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT9108.2
FT                   protein_id=mCP6262.2 isoform=CRA_c"
FT                   /protein_id="EDL38326.1"
FT   mRNA            join(<9781107..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786919,9787539..9787697,
FT                   9788287..9788355,9788473..9788931)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT193672"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193672.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9781108..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786854)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_a"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193672.0
FT                   protein_id=mCP114671.0 isoform=CRA_a"
FT                   /protein_id="EDL38324.1"
FT   mRNA            join(<9781124..9781205,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786919,9787539..9787697,
FT                   9788287..9788355,9788473..9788862)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT193673"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193673.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9781124..9781205,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786854)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_b"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193673.0
FT                   protein_id=mCP114672.0 isoform=CRA_b"
FT                   /protein_id="EDL38325.1"
FT   gene            <9793063..9821591
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /note="gene_id=mCG124126.1"
FT   mRNA            join(<9793063..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807512..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813074..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818525,9818639..9818739,9819387..9819471,
FT                   9819750..9819828,9819993..9820147,9820222..9821591)
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), transcript
FT                   variant mCT125364"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT125364.1
FT                   created on 16-SEP-2002"
FT   mRNA            join(<9793064..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807516..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813043..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818739,9819387..9819471,9819750..9819828,
FT                   9819993..9820147,9820222..9820808)
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), transcript
FT                   variant mCT193689"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT193689.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9793065..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807512..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813074..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818525,9818639..9818739,9819387..9819471,
FT                   9819750..9819828,9819993..9820147,9820222..9820257)
FT                   /codon_start=1
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT125364.1
FT                   protein_id=mCP71307.1 isoform=CRA_a"
FT                   /protein_id="EDL38327.1"
FT                   KFHREKSHPSLV"
FT   CDS             join(<9793065..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807516..9807617)
FT                   /codon_start=1
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT193689.0
FT                   protein_id=mCP114635.0 isoform=CRA_b"
FT                   /protein_id="EDL38328.1"
FT   assembly_gap    9795373..9795524
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            9862791..9869261
FT                   /locus_tag="mCG_148327"
FT                   /note="gene_id=mCG148327.0"
FT   mRNA            join(9862791..9865779,9868799..9869261)
FT                   /locus_tag="mCG_148327"
FT                   /product="mCG148327"
FT                   /note="gene_id=mCG148327.0 transcript_id=mCT188590.0
FT                   created on 13-JAN-2004"
FT   CDS             9865006..9865509
FT                   /codon_start=1
FT                   /locus_tag="mCG_148327"
FT                   /product="mCG148327"
FT                   /note="gene_id=mCG148327.0 transcript_id=mCT188590.0
FT                   protein_id=mCP108806.0"
FT                   /protein_id="EDL38329.1"
FT                   FSFC"
FT   assembly_gap    9899970..9900780
FT                   /estimated_length=811
FT                   /gap_type="unknown"
FT   gene            complement(9980069..9980928)
FT                   /locus_tag="mCG_141370"
FT                   /note="gene_id=mCG141370.0"
FT   mRNA            complement(join(9980069..9980509,9980730..9980928))
FT                   /locus_tag="mCG_141370"
FT                   /product="mCG141370"
FT                   /note="gene_id=mCG141370.0 transcript_id=mCT174986.0
FT                   created on 28-OCT-2002"
FT   CDS             complement(join(9980385..9980509,9980730..9980889))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141370"
FT                   /product="mCG141370"
FT                   /note="gene_id=mCG141370.0 transcript_id=mCT174986.0
FT                   protein_id=mCP97905.0"
FT                   /protein_id="EDL38330.1"
FT   assembly_gap    9981454..9981473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9998870..>10110544)
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /note="gene_id=mCG120621.1"
FT   mRNA            complement(join(9998870..10000038,10002368..10002424,
FT                   10004690..10006229,10008219..10008250,10010108..10010386,
FT                   10015984..10016238,10019881..10020048,10028375..10028633,
FT                   10030389..10030555,10039945..10040103,10040543..10040649,
FT                   10041235..10042543,10047958..10048017,10098221..10098379,
FT                   10100309..10100533,10110115..>10110544))
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /product="RIKEN cDNA 1110012J17"
FT                   /note="gene_id=mCG120621.1 transcript_id=mCT121802.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(join(10002386..10002424,10004690..10006229,
FT                   10008219..10008250,10010108..10010386,10015984..10016238,
FT                   10019881..10020048,10028375..10028633,10030389..10030555,
FT                   10039945..10040103,10040543..10040649,10041235..10042543,
FT                   10047958..10048017,10098221..10098379,10100309..10100533,
FT                   10110115..>10110543))
FT                   /codon_start=1
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /product="RIKEN cDNA 1110012J17"
FT                   /note="gene_id=mCG120621.1 transcript_id=mCT121802.1
FT                   protein_id=mCP71124.1"
FT                   /protein_id="EDL38331.1"
FT   assembly_gap    10020385..10020409
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    10024420..10024613
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    10030257..10030329
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    10040993..10041012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10076083..10076463
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    10101418..10102272
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    10107110..10107129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10110949..10111269
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    10115889..10116325
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    10121225..10122143
FT                   /estimated_length=919
FT                   /gap_type="unknown"
FT   assembly_gap    10143870..10144584
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    10154306..10154325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10155897..>10180988)
FT                   /locus_tag="mCG_9059"
FT                   /note="gene_id=mCG9059.1"
FT   mRNA            complement(join(10155897..10157188,10158729..10158833,
FT                   10159404..10159493,10161695..10161833,10167418..10167479,
FT                   10180857..>10180988))
FT                   /locus_tag="mCG_9059"
FT                   /product="mCG9059"
FT                   /note="gene_id=mCG9059.1 transcript_id=mCT9105.1 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(10157075..10157188,10158729..10158833,
FT                   10159404..10159493,10161695..10161833,10167418..10167479,
FT                   10180857..>10180988))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9059"
FT                   /product="mCG9059"
FT                   /note="gene_id=mCG9059.1 transcript_id=mCT9105.1
FT                   protein_id=mCP6311.1"
FT                   /protein_id="EDL38332.1"
FT   assembly_gap    10180686..10180856
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    10183246..10183265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10184943..10186285
FT                   /estimated_length=1343
FT                   /gap_type="unknown"
FT   assembly_gap    10200703..10200722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10210772..10210879
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            complement(<10213138..10252494)
FT                   /locus_tag="mCG_9060"
FT                   /note="gene_id=mCG9060.1"
FT   mRNA            complement(join(<10213138..10214150,10217433..10217906,
FT                   10251021..10251155,10252319..10252494))
FT                   /locus_tag="mCG_9060"
FT                   /product="mCG9060"
FT                   /note="gene_id=mCG9060.1 transcript_id=mCT9107.0 created on
FT                   18-APR-2003"
FT   CDS             complement(join(10213138..10214150,10217433..10217906,
FT                   10251021..10251155,10252319..10252406))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9060"
FT                   /product="mCG9060"
FT                   /note="gene_id=mCG9060.1 transcript_id=mCT9107.0
FT                   protein_id=mCP6312.1"
FT                   /db_xref="GOA:Q9CU24"
FT                   /db_xref="InterPro:IPR025946"
FT                   /db_xref="MGI:MGI:1921806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CU24"
FT                   /protein_id="EDL38333.1"
FT   assembly_gap    10232409..10232809
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    10272749..10272839
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    10284321..10284519
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    10311176..10311309
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(10322347..>10851241)
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /note="gene_id=mCG120620.0"
FT   mRNA            complement(join(10322347..10322485,10332793..10332928,
FT                   10338155..10338318,10340398..10340523,10343035..10343166,
FT                   10344128..10344301,10345210..10345359,10348220..10348355,
FT                   10348529..10348683,10353122..10353238,10380472..10380569,
FT                   10416766..10416853,10464076..10464263,10469078..10469152,
FT                   10472436..10472587,10545661..10545793,10575732..10575768,
FT                   10576731..10577004,10597182..10597284,10600868..10601069,
FT                   10609808..10609917,10613550..10613858,10700291..10700584,
FT                   10704180..10704354,10720999..10721114,10733548..10733626,
FT                   10753307..10753578,10851113..>10851241))
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   transcript variant mCT121801"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT121801.1
FT                   created on 23-JUL-2002"
FT   assembly_gap    10347020..10347039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<10348257..10348355,10348529..10348683,
FT                   10353122..10353238,10380472..10380569,10399376..>10399412))
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   transcript variant mCT170877"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT170877.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(<10348257..10348355,10348529..10348683,
FT                   10353122..10353238,10380472..10380569,10399376..>10399412))
FT                   /codon_start=1
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT170877.0
FT                   protein_id=mCP93795.0 isoform=CRA_b"
FT                   /protein_id="EDL38335.1"
FT                   YNCVR"
FT   CDS             complement(join(10380568..10380569,10416766..10416853,
FT                   10464076..10464263,10469078..10469152,10472436..10472587,
FT                   10545661..10545793,10575732..10575768,10576731..10577004,
FT                   10597182..10597284,10600868..10601069,10609808..10609917,
FT                   10613550..10613858,10700291..10700584,10704180..10704354,
FT                   10720999..10721114,10733548..10733626,10753307..10753578,
FT                   10851113..>10851239))
FT                   /codon_start=1
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT121801.1
FT                   protein_id=mCP71093.1 isoform=CRA_a"
FT                   /protein_id="EDL38334.1"
FT   assembly_gap    10401159..10401859
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    10456944..10456996
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(10502125..10505962)
FT                   /locus_tag="mCG_148329"
FT                   /note="gene_id=mCG148329.0"
FT   mRNA            complement(10502125..10505962)
FT                   /locus_tag="mCG_148329"
FT                   /product="mCG148329"
FT                   /note="gene_id=mCG148329.0 transcript_id=mCT188592.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10502605..10502889)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148329"
FT                   /product="mCG148329"
FT                   /note="gene_id=mCG148329.0 transcript_id=mCT188592.0
FT                   protein_id=mCP108811.0"
FT                   /protein_id="EDL38336.1"
FT   assembly_gap    10519894..10519980
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    10521540..10521559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10528415..10528713
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    10598245..10598264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10639234..10639424
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    10654300..10655114
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    10658893..10659650
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   gene            10668771..10677682
FT                   /locus_tag="mCG_148343"
FT                   /note="gene_id=mCG148343.0"
FT   mRNA            join(10668771..10669087,10674881..10677682)
FT                   /locus_tag="mCG_148343"
FT                   /product="mCG148343"
FT                   /note="gene_id=mCG148343.0 transcript_id=mCT188606.0
FT                   created on 13-JAN-2004"
FT   CDS             10675063..10675401
FT                   /codon_start=1
FT                   /locus_tag="mCG_148343"
FT                   /product="mCG148343"
FT                   /note="gene_id=mCG148343.0 transcript_id=mCT188606.0
FT                   protein_id=mCP108823.0"
FT                   /db_xref="MGI:MGI:3641639"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRN3"
FT                   /protein_id="EDL38337.1"
FT                   NYKLSCAN"
FT   assembly_gap    10695249..10695279
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    10717202..10717353
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    10719153..10719326
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    10720542..10720591
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    10753939..10756332
FT                   /estimated_length=2394
FT                   /gap_type="unknown"
FT   assembly_gap    10766244..10766363
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    10784317..10784336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10830312..10830347
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    10831062..10831169
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    10848737..10848756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10865470..10865912
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    10875635..10875752
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    10908468..10908831
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    10921632..10921651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10949832..10949878
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    10952730..10952749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10963653..10963693
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    10970666..10970746
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    10995872..10995962
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    11008453..11008472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11013868..11013887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11088286..11088473
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    11122934..11122953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11127752..11127771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11142872..11142934
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    11156453..11156472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11164861..11165793
FT                   /estimated_length=933
FT                   /gap_type="unknown"
FT   assembly_gap    11174785..11175131
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    11192095..11198787
FT                   /estimated_length=6693
FT                   /gap_type="unknown"
FT   assembly_gap    11207674..11207758
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    11216705..11216724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11239573..11239592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11241974..11242214
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    11261272..11261448
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    11280058..11280077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11299040..11299108
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    11302827..11303813
FT                   /estimated_length=987
FT                   /gap_type="unknown"
FT   assembly_gap    11309690..11309709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11311786..11312292
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    11316259..11316455
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    11317919..11318074
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    11325732..11325788
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    11344743..11345013
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    11347803..11347886
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    11349819..11349906
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    11351637..11351656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11355045..11481249
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /note="gene_id=mCG120096.0"
FT   mRNA            join(<11355045..11355174,11374686..11374856,
FT                   11375154..11375266,11395705..11395947,11396942..11397121,
FT                   11400233..11400322,11401483..11401600,11403254..11403432,
FT                   11404058..11404163,11404956..11405116,11406252..11406392,
FT                   11408846..11409019,11410627..11410728,11411023..11411234,
FT                   11411996..11412107,11414911..11415021,11419667..11419794,
FT                   11422030..11422116,11422889..11423100,11425212..11425318,
FT                   11425644..11425824,11426559..11426695,11427523..11427699,
FT                   11429039..11429182,11431223..11431402,11432248..11432433,
FT                   11432965..11433092,11434272..11434392,11435409..11435546,
FT                   11437436..11437557,11438916..11439002,11439266..11439459,
FT                   11440407..11440549,11442501..11442590,11443558..11443669,
FT                   11444505..11444667,11449426..11449633,11449817..11449933,
FT                   11450052..11450215,11452786..11452921,11453791..11453884,
FT                   11455288..11455404,11457118..11457300,11457574..11457728,
FT                   11459350..11459493,11461487..11461620,11462997..11463147,
FT                   11463959..11464083,11466375..11466525,11467808..11467952,
FT                   11468437..11468578,11468667..11468781,11468927..11469097,
FT                   11470036..11470187,11470926..11471111,11472453..11472588,
FT                   11473778..11473890,11474455..11474644,11475603..11475761,
FT                   11476127..11476280,11477184..11477317,11480118..11480340,
FT                   11480889..11481249)
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /product="laminin, alpha 1"
FT                   /note="gene_id=mCG120096.0 transcript_id=mCT121277.1
FT                   created on 24-JUL-2002"
FT   CDS             join(<11355045..11355174,11374686..11374856,
FT                   11375154..11375266,11395705..11395947,11396942..11397121,
FT                   11400233..11400322,11401483..11401600,11403254..11403432,
FT                   11404058..11404163,11404956..11405116,11406252..11406392,
FT                   11408846..11409019,11410627..11410728,11411023..11411234,
FT                   11411996..11412107,11414911..11415021,11419667..11419794,
FT                   11422030..11422116,11422889..11423100,11425212..11425318,
FT                   11425644..11425824,11426559..11426695,11427523..11427699,
FT                   11429039..11429182,11431223..11431402,11432248..11432433,
FT                   11432965..11433092,11434272..11434392,11435409..11435546,
FT                   11437436..11437557,11438916..11439002,11439266..11439459,
FT                   11440407..11440549,11442501..11442590,11443558..11443669,
FT                   11444505..11444667,11449426..11449633,11449817..11449933,
FT                   11450052..11450215,11452786..11452921,11453791..11453884,
FT                   11455288..11455404,11457118..11457300,11457574..11457728,
FT                   11459350..11459493,11461487..11461620,11462997..11463147,
FT                   11463959..11464083,11466375..11466525,11467808..11467952,
FT                   11468437..11468578,11468667..11468781,11468927..11469097,
FT                   11470036..11470187,11470926..11471111,11472453..11472588,
FT                   11473778..11473890,11474455..11474644,11475603..11475761,
FT                   11476127..11476280,11477184..11477317,11480118..11480340,
FT                   11480889..11481049)
FT                   /codon_start=1
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /product="laminin, alpha 1"
FT                   /note="gene_id=mCG120096.0 transcript_id=mCT121277.1
FT                   protein_id=mCP70876.1"
FT                   /protein_id="EDL38338.1"
FT   assembly_gap    11367751..11367770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11378650..11379076
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    11380442..11380461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11382723..11383157
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    11384030..11384158
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    11408565..11408693
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    11409655..11409674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11420615..11420960
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    11427467..11427504
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    11430233..11430816
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    11435574..11435659
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    11436921..11436940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11448790..11448879
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    11489663..11491122
FT                   /estimated_length=1460
FT                   /gap_type="unknown"
FT   gene            complement(11503680..>11666612)
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /note="gene_id=mCG120097.1"
FT   mRNA            complement(join(11503680..11504387,11508007..11508071,
FT                   11511865..11511937,11518972..11519101,11519750..11519947,
FT                   11522869..11522951,11526045..11526207,11530563..11530640,
FT                   11533301..11533392,11533495..11533660,11534635..11534777,
FT                   11537186..11537270,11543635..11543724,11546918..11547007,
FT                   11558284..11558501,11563595..11563818,11666449..>11666612))
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /product="Rho GTPase activating protein 28"
FT                   /note="gene_id=mCG120097.1 transcript_id=mCT121278.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(join(11504305..11504387,11508007..11508071,
FT                   11511865..11511937,11518972..11519101,11519750..11519947,
FT                   11522869..11522951,11526045..11526207,11530563..11530640,
FT                   11533301..11533392,11533495..11533660,11534635..11534777,
FT                   11537186..11537270,11543635..11543724,11546918..11547007,
FT                   11558284..11558501,11563595..11563818,11666449..>11666612))
FT                   /codon_start=1
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /product="Rho GTPase activating protein 28"
FT                   /note="gene_id=mCG120097.1 transcript_id=mCT121278.1
FT                   protein_id=mCP71279.1"
FT                   /protein_id="EDL38339.1"
FT   assembly_gap    11504533..11505173
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    11516256..11516275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11518690..11518709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11527964..11527983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11538151..11539014
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    11541167..11541186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11553943..11554011
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    11563197..11563341
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    11575650..11576072
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    11582875..11583026
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    11587843..11587909
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    11588810..11588829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11611886..11612096
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    11656200..11656219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11658223..11658399
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    11678356..11678375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11694216..11695053
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    11698845..11699456
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    11717766..11718080
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    11719822..11719841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11723128..11723199
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    11739341..11739541
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    11759991..11760224
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    11768639..11768819
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    11771211..11771388
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    11780281..11780300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11802194..11802213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11805925..11806250
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    11866907..11866926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11871741..11871882
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    11877467..11877858
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    11897810..11897829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11899619..11899638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11949835..11950071
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    11961310..11961329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11964940..11964959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11965982..11966001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11967033..11967052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11979609..11981175
FT                   /estimated_length=1567
FT                   /gap_type="unknown"
FT   assembly_gap    11989515..11990181
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    12015575..12015744
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    12021161..12021412
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    12023864..12024792
FT                   /estimated_length=929
FT                   /gap_type="unknown"
FT   assembly_gap    12028752..12028883
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            complement(12032472..12033042)
FT                   /pseudo
FT                   /locus_tag="mCG_1039326"
FT                   /note="gene_id=mCG1039326.1"
FT   mRNA            complement(12032472..12033042)
FT                   /pseudo
FT                   /locus_tag="mCG_1039326"
FT                   /note="gene_id=mCG1039326.1 transcript_id=mCT157030.1
FT                   created on 28-OCT-2002"
FT   gene            <12086859..12290195
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /note="gene_id=mCG119974.1"
FT   mRNA            join(<12086859..12086924,12119227..12119331,
FT                   12120733..12120868,12123295..12123386,12124986..12125141,
FT                   12150371..12150493,12219089..12219203,12246372..12246474,
FT                   12289480..12290195)
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /product="RIKEN cDNA D930040M24"
FT                   /note="gene_id=mCG119974.1 transcript_id=mCT121153.1
FT                   created on 16-SEP-2002"
FT   CDS             join(<12086859..12086924,12119227..12119331,
FT                   12120733..12120868,12123295..12123386,12124986..12125141,
FT                   12150371..12150493,12219089..12219203,12246372..12246474,
FT                   12289480..12289657)
FT                   /codon_start=1
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /product="RIKEN cDNA D930040M24"
FT                   /note="gene_id=mCG119974.1 transcript_id=mCT121153.1
FT                   protein_id=mCP71043.1"
FT                   /protein_id="EDL38340.1"
FT                   CNLNVNGKCENANSQCR"
FT   assembly_gap    12090090..12090109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12091520..12091539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12109434..12109453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12116001..12116020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12117469..12117488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12118858..12118877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12167554..12169082
FT                   /estimated_length=1529
FT                   /gap_type="unknown"
FT   assembly_gap    12171893..12172057
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    12183578..12183758
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    12192313..12192921
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    12199169..12199210
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    12220525..12220579
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    12232597..12232636
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    12236592..12236611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12273079..12273364
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    12309904..12309923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12346587..12346767
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    12348194..12350130
FT                   /estimated_length=1937
FT                   /gap_type="unknown"
FT   assembly_gap    12352834..12352853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12353927..12353946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12359831..12360612
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    12374318..12375124
FT                   /estimated_length=807
FT                   /gap_type="unknown"
FT   assembly_gap    12412835..12412854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12422828..12436246
FT                   /locus_tag="mCG_5390"
FT                   /note="gene_id=mCG5390.1"
FT   mRNA            join(<12422828..12422997,12432133..12432195,
FT                   12435676..12436246)
FT                   /locus_tag="mCG_5390"
FT                   /product="mCG5390"
FT                   /note="gene_id=mCG5390.1 transcript_id=mCT4800.1 created on
FT                   16-SEP-2002"
FT   CDS             join(<12422830..12422997,12432133..12432195,
FT                   12435676..12435837)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5390"
FT                   /product="mCG5390"
FT                   /note="gene_id=mCG5390.1 transcript_id=mCT4800.1
FT                   protein_id=mCP6307.0"
FT                   /protein_id="EDL38341.1"
FT   assembly_gap    12452271..12452290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12497993..12498012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12498473..>12502110
FT                   /locus_tag="mCG_18208"
FT                   /note="gene_id=mCG18208.2"
FT   mRNA            join(<12498473..12498502,12501311..>12502110)
FT                   /locus_tag="mCG_18208"
FT                   /product="mCG18208"
FT                   /note="gene_id=mCG18208.2 transcript_id=mCT21396.2 created
FT                   on 16-SEP-2002"
FT   CDS             <12501333..>12502110
FT                   /codon_start=1
FT                   /locus_tag="mCG_18208"
FT                   /product="mCG18208"
FT                   /note="gene_id=mCG18208.2 transcript_id=mCT21396.2
FT                   protein_id=mCP6270.2"
FT                   /protein_id="EDL38342.1"
FT   assembly_gap    12508389..12508408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12528369..12528707
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    12529781..12530119
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    12531340..12532259
FT                   /estimated_length=920
FT                   /gap_type="unknown"
FT   assembly_gap    12544111..12544152
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    12548702..12548964
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    12551719..12551915
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    12564704..12564790
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    12588038..12588057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12669020..12669058
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12679848..12679919
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    12706145..12706164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12713984..12757933
FT                   /locus_tag="mCG_145588"
FT                   /note="gene_id=mCG145588.0"
FT   mRNA            join(<12713984..12714046,12755929..12756692,
FT                   12756743..12757933)
FT                   /locus_tag="mCG_145588"
FT                   /product="mCG145588"
FT                   /note="gene_id=mCG145588.0 transcript_id=mCT185012.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    12735644..12735663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12754692..12755916
FT                   /estimated_length=1225
FT                   /gap_type="unknown"
FT   CDS             join(<12756652..12756692,12756743..12757175)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145588"
FT                   /product="mCG145588"
FT                   /note="gene_id=mCG145588.0 transcript_id=mCT185012.0
FT                   protein_id=mCP106311.0"
FT                   /protein_id="EDL38343.1"
FT   assembly_gap    12756698..12756737
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    12758086..12758105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12762385..12762404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12795810..12796010
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    12797971..12798342
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    12805024..12805043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12811096..12942071
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /note="gene_id=mCG119973.1"
FT   mRNA            join(<12811096..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12924941)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT193697"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT193697.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<12811096..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922889)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT193697.0
FT                   protein_id=mCP114629.0 isoform=CRA_d"
FT                   /protein_id="EDL38347.1"
FT   mRNA            join(<12811098..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922757,12925975..12926010,
FT                   12926797..12926988,12935967..12936089,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12939694..12939810,12940933..12942071)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT121152"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT121152.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12811099..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922757,12925975..12926010,
FT                   12926797..12926988,12935967..12936089,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12939694..12939804)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT121152.0
FT                   protein_id=mCP71014.0 isoform=CRA_e"
FT                   /protein_id="EDL38348.1"
FT   assembly_gap    12830619..12831410
FT                   /estimated_length=792
FT                   /gap_type="unknown"
FT   assembly_gap    12832455..12832953
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    12843729..12843758
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    12846837..12847057
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    12853707..12853726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<12861257..12861451,12863561..12863758,
FT                   12890417..12890521,12891819..12891861,12895660..12895735,
FT                   12899604..12899822,12900698..12900785,12905460..12905612,
FT                   12909435..12909532,12911073..12911248,12914239..12914405,
FT                   12922704..12922757,12926797..12926988,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12940933..12941197)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170866"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170866.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12861257..12861451,12863561..12863758,
FT                   12890417..12890521,12891819..12891861,12895660..12895735,
FT                   12899604..12899822,12900698..12900785,12905460..12905612,
FT                   12909435..12909532,12911073..12911248,12914239..12914405,
FT                   12922704..12922757,12926797..12926988,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12940933..12940938)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170866.0
FT                   protein_id=mCP93785.0 isoform=CRA_a"
FT                   /protein_id="EDL38344.1"
FT                   DIDHDQE"
FT   mRNA            join(<12863561..12863758,12890417..12890521,
FT                   12899604..12899681)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170868"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170868.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12863561..12863758,12890417..12890521,
FT                   12899604..12899633)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170868.0
FT                   protein_id=mCP93784.0 isoform=CRA_c"
FT                   /protein_id="EDL38346.1"
FT                   LLAAAR"
FT   assembly_gap    12878644..12878726
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    12889761..12889780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<12914384..12914405,12922704..12922757,
FT                   12926797..12926988,12933126..12933328)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170867"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170867.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12914385..12914405,12922704..12922757,
FT                   12926797..12926988,12933126..12933233)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170867.0
FT                   protein_id=mCP93786.0 isoform=CRA_b"
FT                   /protein_id="EDL38345.1"
FT   assembly_gap    12921639..12921658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12927455..>12929303)
FT                   /locus_tag="mCG_145583"
FT                   /note="gene_id=mCG145583.0"
FT   mRNA            complement(join(12927455..12927999,12928219..12928288,
FT                   12929153..>12929303))
FT                   /locus_tag="mCG_145583"
FT                   /product="mCG145583"
FT                   /note="gene_id=mCG145583.0 transcript_id=mCT185007.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(12927933..12927999,12928219..12928288,
FT                   12929153..>12929303))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145583"
FT                   /product="mCG145583"
FT                   /note="gene_id=mCG145583.0 transcript_id=mCT185007.0
FT                   protein_id=mCP106305.0"
FT                   /protein_id="EDL38349.1"
FT   gene            <12967858..12994907
FT                   /locus_tag="mCG_145586"
FT                   /note="gene_id=mCG145586.0"
FT   mRNA            join(<12967858..12967893,12970558..12970781,
FT                   12993767..12994907)
FT                   /locus_tag="mCG_145586"
FT                   /product="mCG145586"
FT                   /note="gene_id=mCG145586.0 transcript_id=mCT185010.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    12976900..12980374
FT                   /estimated_length=3475
FT                   /gap_type="unknown"
FT   assembly_gap    12984623..12988576
FT                   /estimated_length=3954
FT                   /gap_type="unknown"
FT   CDS             <12994016..12994321
FT                   /codon_start=1
FT                   /locus_tag="mCG_145586"
FT                   /product="mCG145586"
FT                   /note="gene_id=mCG145586.0 transcript_id=mCT185010.0
FT                   protein_id=mCP106308.0"
FT                   /protein_id="EDL38350.1"
FT   assembly_gap    13007916..13007943
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    13008736..13008958
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   gene            13033444..13041008
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /note="gene_id=mCG18206.1"
FT   mRNA            join(13033444..13033530,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT170894"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170894.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(13033626..13033672,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT170893"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170893.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(13034104..13034487,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT21394"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT21394.1 created
FT                   on 24-JUL-2002"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170893.0
FT                   protein_id=mCP93812.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38351.1"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170894.0
FT                   protein_id=mCP93811.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38352.1"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT21394.1
FT                   protein_id=mCP6331.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38353.1"
FT   assembly_gap    13046951..13046970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13067784..13089717)
FT                   /locus_tag="mCG_59952"
FT                   /note="gene_id=mCG59952.2"
FT   mRNA            complement(join(13067784..13068524,13074809..13074915,
FT                   13089563..13089717))
FT                   /locus_tag="mCG_59952"
FT                   /product="mCG59952"
FT                   /note="gene_id=mCG59952.2 transcript_id=mCT60135.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13068509..13068524,13074809..13074915,
FT                   13089563..13089715))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59952"
FT                   /product="mCG59952"
FT                   /note="gene_id=mCG59952.2 transcript_id=mCT60135.2
FT                   protein_id=mCP28768.2"
FT                   /protein_id="EDL38354.1"
FT   assembly_gap    13087752..13087771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13089770..13139633
FT                   /locus_tag="mCG_66639"
FT                   /note="gene_id=mCG66639.2"
FT   mRNA            join(13089770..13089927,13137556..13139633)
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, transcript variant mCT66822"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT66822.2 created
FT                   on 21-APR-2003"
FT   CDS             join(13089912..13089927,13137556..13137749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, isoform CRA_b"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT66822.2
FT                   protein_id=mCP28805.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWD5"
FT                   /db_xref="MGI:MGI:2444600"
FT                   /db_xref="UniProtKB/Swiss-Prot:G3UWD5"
FT                   /protein_id="EDL38356.1"
FT   mRNA            join(<13090219..13090543,13137556..13139633)
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, transcript variant mCT182040"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT182040.0 created
FT                   on 21-APR-2003"
FT   CDS             join(<13090543..13090543,13137556..13137749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, isoform CRA_a"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT182040.0
FT                   protein_id=mCP104962.0 isoform=CRA_a"
FT                   /protein_id="EDL38355.1"
FT   assembly_gap    13095924..13096086
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    13111470..13111489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13124012..13126285)
FT                   /locus_tag="mCG_148326"
FT                   /note="gene_id=mCG148326.0"
FT   mRNA            complement(join(13124012..13124115,13125565..13126285))
FT                   /locus_tag="mCG_148326"
FT                   /product="mCG148326"
FT                   /note="gene_id=mCG148326.0 transcript_id=mCT188589.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13125671..13126054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148326"
FT                   /product="mCG148326"
FT                   /note="gene_id=mCG148326.0 transcript_id=mCT188589.0
FT                   protein_id=mCP108805.0"
FT                   /protein_id="EDL38357.1"
FT   assembly_gap    13141927..13141946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13145986..13146005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13150195..13150323
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13157448..13157561
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    13171104..13172164
FT                   /estimated_length=1061
FT                   /gap_type="unknown"
FT   assembly_gap    13182527..13182566
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    13189235..13194246
FT                   /estimated_length=5012
FT                   /gap_type="unknown"
FT   assembly_gap    13198390..13198409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13220581..13220600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13243728..13243756
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    13253737..13253756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13256546..13256784
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    13275978..13275997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13278770..13278948
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    13288684..13288732
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    13313891..13313911
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13323328..13323347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13330644..13330968
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    13331924..13332726
FT                   /estimated_length=803
FT                   /gap_type="unknown"
FT   assembly_gap    13334311..13334330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13335527..13335583
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    13348240..13348259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13378848..13378999
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    13392903..13392962
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13396150..13396169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13409620..13418730)
FT                   /locus_tag="mCG_148325"
FT                   /note="gene_id=mCG148325.0"
FT   mRNA            complement(join(13409620..13412113,13418443..13418730))
FT                   /locus_tag="mCG_148325"
FT                   /product="mCG148325"
FT                   /note="gene_id=mCG148325.0 transcript_id=mCT188588.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13409693..13409875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148325"
FT                   /product="mCG148325"
FT                   /note="gene_id=mCG148325.0 transcript_id=mCT188588.0
FT                   protein_id=mCP108804.0"
FT                   /protein_id="EDL38358.1"
FT                   TVCVCVAQFLPPSCL"
FT   assembly_gap    13448394..13449134
FT                   /estimated_length=741
FT                   /gap_type="unknown"
FT   assembly_gap    13457588..13457607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13468454..13468569
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    13482820..13482839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13487963..13488437
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    13501041..13501494
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   gene            complement(13537102..>13567192)
FT                   /locus_tag="mCG_145007"
FT                   /note="gene_id=mCG145007.0"
FT   mRNA            complement(join(13537102..13538264,13540466..13540586,
FT                   13567026..>13567192))
FT                   /locus_tag="mCG_145007"
FT                   /product="mCG145007"
FT                   /note="gene_id=mCG145007.0 transcript_id=mCT184431.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(13538061..13538264,13540466..>13540567))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145007"
FT                   /product="mCG145007"
FT                   /note="gene_id=mCG145007.0 transcript_id=mCT184431.0
FT                   protein_id=mCP106299.0"
FT                   /protein_id="EDL38359.1"
FT   assembly_gap    13551602..13551621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13568547..13569030)
FT                   /pseudo
FT                   /locus_tag="mCG_1039328"
FT                   /note="gene_id=mCG1039328.1"
FT   mRNA            complement(13568547..13569030)
FT                   /pseudo
FT                   /locus_tag="mCG_1039328"
FT                   /note="gene_id=mCG1039328.1 transcript_id=mCT157032.1
FT                   created on 05-NOV-2002"
FT   assembly_gap    13572009..13573240
FT                   /estimated_length=1232
FT                   /gap_type="unknown"
FT   assembly_gap    13573993..13574256
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    13577940..13577989
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            13612936..13724464
FT                   /locus_tag="mCG_148335"
FT                   /note="gene_id=mCG148335.0"
FT   mRNA            join(13612936..13613238,13721707..13724464)
FT                   /locus_tag="mCG_148335"
FT                   /product="mCG148335"
FT                   /note="gene_id=mCG148335.0 transcript_id=mCT188598.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    13694216..13701056
FT                   /estimated_length=6841
FT                   /gap_type="unknown"
FT   assembly_gap    13710430..13710618
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   CDS             13722122..13722322
FT                   /codon_start=1
FT                   /locus_tag="mCG_148335"
FT                   /product="mCG148335"
FT                   /note="gene_id=mCG148335.0 transcript_id=mCT188598.0
FT                   protein_id=mCP108815.0"
FT                   /protein_id="EDL38360.1"
FT   assembly_gap    13732339..13732474
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    13756073..13756092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13781513..13781608
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    13799093..13799112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13821277..13833660
FT                   /estimated_length=12384
FT                   /gap_type="unknown"
FT   assembly_gap    13837431..13838035
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   assembly_gap    13839206..13839225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13840327..13840346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13843464..13843483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13845112..13845386
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    13869112..13869131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13873326..13873345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13881498..13881517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13897757..13897776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13919981..13920000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13928583..13929083
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    13933270..13933458
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    13959975..13960115
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    13976101..13976333
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    13982522..13982637
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(14010421..14011387)
FT                   /pseudo
FT                   /locus_tag="mCG_12490"
FT                   /note="gene_id=mCG12490.2"
FT   mRNA            complement(14010421..14011387)
FT                   /pseudo
FT                   /locus_tag="mCG_12490"
FT                   /note="gene_id=mCG12490.2 transcript_id=mCT13189.2 created
FT                   on 25-OCT-2002"
FT   assembly_gap    14014415..14022566
FT                   /estimated_length=8152
FT                   /gap_type="unknown"
FT   assembly_gap    14023700..14023719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14041954..14041973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14043092..14043111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14044726..14044745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14049039..14049058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14050160..14050179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14054439..14054690
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    14074094..14075956
FT                   /estimated_length=1863
FT                   /gap_type="unknown"
FT   assembly_gap    14080304..14080405
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    14096446..14096465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14106686..14106797
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    14137953..14137972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14146156..14444479
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /note="gene_id=mCG12492.2"
FT   mRNA            join(<14146156..14147130,14223403..14223617,
FT                   14287005..14287182,14292237..14292477,14383879..14384165,
FT                   14388719..14388810,14409540..14409961,14432250..14432341,
FT                   14438247..14438399,14441095..14444479)
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /product="discs, large (Drosophila) homolog-associated
FT                   protein 1"
FT                   /note="gene_id=mCG12492.2 transcript_id=mCT13191.2 created
FT                   on 10-SEP-2002"
FT   CDS             join(14146156..14147130,14223403..14223617,
FT                   14287005..14287182,14292237..14292477,14383879..14384165,
FT                   14388719..14388810,14409540..14409961,14432250..14432341,
FT                   14438247..14438399,14441095..14441304)
FT                   /codon_start=1
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /product="discs, large (Drosophila) homolog-associated
FT                   protein 1"
FT                   /note="gene_id=mCG12492.2 transcript_id=mCT13191.2
FT                   protein_id=mCP6305.2"
FT                   /protein_id="EDL38361.1"
FT   assembly_gap    14154011..14154030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14188031..14188286
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    14189415..14189694
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    14190085..14190211
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    14193608..14193627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14204734..14204809
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    14255562..14255581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14267850..14268109
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    14282364..14282383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14307183..14307554
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    14310841..14311427
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    14326994..14327335
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    14331025..14331044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14335101..14335120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14403437..14403565
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            complement(14421355..>14429127)
FT                   /locus_tag="mCG_145589"
FT                   /note="gene_id=mCG145589.0"
FT   mRNA            complement(join(14421355..14424193,14428083..14428219,
FT                   14428946..>14429127))
FT                   /locus_tag="mCG_145589"
FT                   /product="mCG145589"
FT                   /note="gene_id=mCG145589.0 transcript_id=mCT185013.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(14422650..>14422889)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145589"
FT                   /product="mCG145589"
FT                   /note="gene_id=mCG145589.0 transcript_id=mCT185013.0
FT                   protein_id=mCP106312.0"
FT                   /protein_id="EDL38362.1"
FT   assembly_gap    14426265..14426284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14446161..14446271
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(14467337..14474860)
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /note="gene_id=mCG12491.1"
FT   mRNA            complement(join(14467337..14468397,14469297..14469523,
FT                   14474434..14474860))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170887"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170887.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(14467338..14468397,14469297..14469523,
FT                   14473996..14474335))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT13190"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT13190.1 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(14467338..14468397,14469297..14469523,
FT                   14472772..14472814))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170886"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170886.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14474434..14474548))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_c"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170887.0
FT                   protein_id=mCP93806.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3UWC5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1194497"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC5"
FT                   /protein_id="EDL38365.1"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14473996..14474011))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_b"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT13190.1
FT                   protein_id=mCP6302.1 isoform=CRA_b"
FT                   /protein_id="EDL38364.1"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14472772..14472784))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_a"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170886.0
FT                   protein_id=mCP93804.0 isoform=CRA_a"
FT                   /protein_id="EDL38363.1"
FT   mRNA            complement(join(<14468172..14468397,14469297..14469902))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170888"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170888.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<14468172..14468397,14469297..14469479))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_d"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170888.0
FT                   protein_id=mCP93805.0 isoform=CRA_d"
FT                   /protein_id="EDL38366.1"
FT   gene            14486072..14488415
FT                   /locus_tag="mCG_145012"
FT                   /note="gene_id=mCG145012.0"
FT   mRNA            14486072..14488415
FT                   /locus_tag="mCG_145012"
FT                   /product="mCG145012"
FT                   /note="gene_id=mCG145012.0 transcript_id=mCT184436.0
FT                   created on 24-JUN-2003"
FT   CDS             14487931..14488143
FT                   /codon_start=1
FT                   /locus_tag="mCG_145012"
FT                   /product="mCG145012"
FT                   /note="gene_id=mCG145012.0 transcript_id=mCT184436.0
FT                   protein_id=mCP106304.0"
FT                   /protein_id="EDL38367.1"
FT   assembly_gap    14495424..14495443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14496477..14501226
FT                   /estimated_length=4750
FT                   /gap_type="unknown"
FT   gene            14501616..14502120
FT                   /pseudo
FT                   /locus_tag="mCG_5394"
FT                   /note="gene_id=mCG5394.1"
FT   mRNA            14501616..14502120
FT                   /pseudo
FT                   /locus_tag="mCG_5394"
FT                   /note="gene_id=mCG5394.1 transcript_id=mCT4304.1 created on
FT                   14-OCT-2002"
FT   assembly_gap    14506532..14506619
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(14510486..14513619)
FT                   /locus_tag="mCG_1039528"
FT                   /note="gene_id=mCG1039528.0"
FT   mRNA            complement(join(14510486..14511318,14513121..14513243,
FT                   14513344..14513489,14513601..14513619))
FT                   /locus_tag="mCG_1039528"
FT                   /product="mCG1039528"
FT                   /note="gene_id=mCG1039528.0 transcript_id=mCT157232.0
FT                   created on 28-MAY-2003"
FT   CDS             complement(join(14511036..14511318,14513121..14513203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039528"
FT                   /product="mCG1039528"
FT                   /note="gene_id=mCG1039528.0 transcript_id=mCT157232.0
FT                   protein_id=mCP71296.1"
FT                   /protein_id="EDL38368.1"
FT                   CVVQAHPARSQALGLER"
FT   assembly_gap    14524129..14524606
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    14542239..14543755
FT                   /estimated_length=1517
FT                   /gap_type="unknown"
FT   assembly_gap    14544785..14544804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14547743..14547762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14548776..14548795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14549796..14550338
FT                   /pseudo
FT                   /locus_tag="mCG_48720"
FT                   /note="gene_id=mCG48720.1"
FT   mRNA            14549796..14550338
FT                   /pseudo
FT                   /locus_tag="mCG_48720"
FT                   /note="gene_id=mCG48720.1 transcript_id=mCT48903.1 created
FT                   on 28-OCT-2002"
FT   assembly_gap    14551331..14551350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14552882..14552901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14555287..14555306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14556823..14556842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14559923..14560979
FT                   /estimated_length=1057
FT                   /gap_type="unknown"
FT   assembly_gap    14572216..14572759
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   gene            complement(14587353..14589970)
FT                   /locus_tag="mCG_148328"
FT                   /note="gene_id=mCG148328.0"
FT   mRNA            complement(join(14587353..14588680,14589802..14589970))
FT                   /locus_tag="mCG_148328"
FT                   /product="mCG148328"
FT                   /note="gene_id=mCG148328.0 transcript_id=mCT188591.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14588000..14588371)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148328"
FT                   /product="mCG148328"
FT                   /note="gene_id=mCG148328.0 transcript_id=mCT188591.0
FT                   protein_id=mCP108807.0"
FT                   /protein_id="EDL38369.1"
FT   gene            14588845..14589666
FT                   /pseudo
FT                   /locus_tag="mCG_50754"
FT                   /note="gene_id=mCG50754.1"
FT   mRNA            14588845..14589666
FT                   /pseudo
FT                   /locus_tag="mCG_50754"
FT                   /note="gene_id=mCG50754.1 transcript_id=mCT50937.1 created
FT                   on 28-OCT-2002"
FT   assembly_gap    14598711..14598730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14604885..14622530)
FT                   /locus_tag="mCG_5403"
FT                   /note="gene_id=mCG5403.1"
FT   mRNA            complement(join(14604885..14606228,14607191..14607352,
FT                   14608780..14608978,14622207..14622530))
FT                   /locus_tag="mCG_5403"
FT                   /product="mCG5403"
FT                   /note="gene_id=mCG5403.1 transcript_id=mCT4297.1 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(14606056..14606228,14607191..14607352,
FT                   14608780..14608963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5403"
FT                   /product="mCG5403"
FT                   /note="gene_id=mCG5403.1 transcript_id=mCT4297.1
FT                   protein_id=mCP6274.1"
FT                   /protein_id="EDL38370.1"
FT                   KHGAKDKDD"
FT   gene            complement(14625408..14634191)
FT                   /locus_tag="mCG_5400"
FT                   /note="gene_id=mCG5400.2"
FT   mRNA            complement(join(14625408..14626538,14627862..14628023,
FT                   14628449..14628647,14633774..14634191))
FT                   /locus_tag="mCG_5400"
FT                   /product="mCG5400"
FT                   /note="gene_id=mCG5400.2 transcript_id=mCT4294.1 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(14626366..14626538,14627862..14628023,
FT                   14628449..14628632))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5400"
FT                   /product="mCG5400"
FT                   /note="gene_id=mCG5400.2 transcript_id=mCT4294.1
FT                   protein_id=mCP6321.1"
FT                   /db_xref="GOA:Q6ZWQ9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1914518"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWQ9"
FT                   /protein_id="EDL38371.1"
FT                   KHGAKDKDD"
FT   assembly_gap    14649285..14649304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14650154..14756240
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /note="gene_id=mCG5398.1"
FT   mRNA            join(14650154..14650284,14653510..14653859,
FT                   14665716..14665965,14666658..14666815,14673982..14674074,
FT                   14675040..14675128,14675233..14675292,14677228..14677392,
FT                   14682118..14682279,14690648..14690789,14694003..14694202,
FT                   14696868..14696924,14701669..14701793,14706951..14707134,
FT                   14707458..14707632,14710089..14710210,14711518..14711811,
FT                   14713576..14713772,14717208..14717334,14719587..14719771,
FT                   14721866..14721980,14729285..14729441,14730325..14730431,
FT                   14730555..14730599,14734820..14734956,14735558..14735702,
FT                   14737675..14737734,14738000..14738067,14739088..14739201,
FT                   14740056..14740143,14741160..14741198,14741293..14741398,
FT                   14746643..14746806,14750037..14750073,14750511..14750533,
FT                   14751942..14751997,14755461..14756240)
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /product="myomesin 1"
FT                   /note="gene_id=mCG5398.1 transcript_id=mCT4303.2 created on
FT                   24-JUL-2002"
FT   CDS             join(14653537..14653859,14665716..14665965,
FT                   14666658..14666815,14673982..14674074,14675040..14675128,
FT                   14675233..14675292,14677228..14677392,14682118..14682279,
FT                   14690648..14690789,14694003..14694202,14696868..14696924,
FT                   14701669..14701793,14706951..14707134,14707458..14707632,
FT                   14710089..14710210,14711518..14711811,14713576..14713772,
FT                   14717208..14717334,14719587..14719771,14721866..14721980,
FT                   14729285..14729441,14730325..14730431,14730555..14730599,
FT                   14734820..14734956,14735558..14735702,14737675..14737734,
FT                   14738000..14738067,14739088..14739201,14740056..14740143,
FT                   14741160..14741198,14741293..14741398,14746643..14746806,
FT                   14750037..14750073,14750511..14750533,14751942..14751997,
FT                   14755461..14755754)
FT                   /codon_start=1
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /product="myomesin 1"
FT                   /note="gene_id=mCG5398.1 transcript_id=mCT4303.2
FT                   protein_id=mCP6286.2"
FT                   /protein_id="EDL38372.1"
FT   assembly_gap    14659505..14659524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14660790..14661367
FT                   /estimated_length=578
FT                   /gap_type="unknown"
FT   assembly_gap    14664507..14664526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14672107..14673013
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    14673781..14673926
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    14726182..14726201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14772029..14772120
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            <14773823..14811160
FT                   /locus_tag="mCG_145008"
FT                   /note="gene_id=mCG145008.0"
FT   mRNA            join(<14773823..14773849,14803499..14803572,
FT                   14808211..14808377,14809884..14811160)
FT                   /locus_tag="mCG_145008"
FT                   /product="mCG145008"
FT                   /note="gene_id=mCG145008.0 transcript_id=mCT184432.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    14776072..14776156
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    14786173..14786776
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   CDS             <14810555..14810857
FT                   /codon_start=1
FT                   /locus_tag="mCG_145008"
FT                   /product="mCG145008"
FT                   /note="gene_id=mCG145008.0 transcript_id=mCT184432.0
FT                   protein_id=mCP106300.0"
FT                   /protein_id="EDL38373.1"
FT   assembly_gap    14812736..14813063
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   gene            <14813135..14878934
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /note="gene_id=mCG5402.2"
FT   mRNA            join(<14813135..14813237,14844172..14844372,
FT                   14851247..14851342,14854137..14854438,14858369..14858476,
FT                   14859333..14859456,14860246..14860582,14862902..14863001,
FT                   14866478..14866665,14867702..14867795,14868178..14868247,
FT                   14869906..14869995,14870738..14870820,14871720..14871864,
FT                   14872382..14872530,14873019..14873105,14873866..14874018,
FT                   14874213..14874327,14875511..14875614,14875944..14878934)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT4296"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT4296.2 created on
FT                   24-JUL-2002"
FT   CDS             join(<14813136..14813237,14844172..14844372,
FT                   14851247..14851342,14854137..14854438,14858369..14858476,
FT                   14859333..14859456,14860246..14860582,14862902..14863001,
FT                   14866478..14866665,14867702..14867795,14868178..14868247,
FT                   14869906..14869995,14870738..14870820,14871720..14871864,
FT                   14872382..14872530,14873019..14873105,14873866..14874018,
FT                   14874213..14874327,14875511..14875614,14875944..14876088)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_d"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT4296.2
FT                   protein_id=mCP6330.1 isoform=CRA_d"
FT                   /protein_id="EDL38377.1"
FT                   "
FT   assembly_gap    14825402..14825806
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   mRNA            join(<14833846..14834073,14844172..14844372,
FT                   14851247..14851342,14854137..>14854314)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170907"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170907.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14833933..14834073,14844172..14844372,
FT                   14851247..14851342,14854137..>14854314)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_c"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170907.0
FT                   protein_id=mCP93824.0 isoform=CRA_c"
FT                   /protein_id="EDL38376.1"
FT   mRNA            join(<14854329..14854438,14858369..14858476,
FT                   14858880..14858930,14859333..14859456,14860246..14860568)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170906"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170906.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14854329..14854438,14858369..14858476,
FT                   14858880..14858922)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_b"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170906.0
FT                   protein_id=mCP93825.0 isoform=CRA_b"
FT                   /protein_id="EDL38375.1"
FT   mRNA            join(<14859394..14859456,14860246..14860582,
FT                   14861140..14861366)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170905"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170905.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14859394..14859456,14860246..14860582,
FT                   14861140..14861360)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_a"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170905.0
FT                   protein_id=mCP93823.0 isoform=CRA_a"
FT                   /protein_id="EDL38374.1"
FT   gene            complement(14863132..14864189)
FT                   /locus_tag="mCG_1039530"
FT                   /note="gene_id=mCG1039530.1"
FT   mRNA            complement(join(14863132..14863375,14863702..14863907,
FT                   14864033..14864189))
FT                   /locus_tag="mCG_1039530"
FT                   /product="mCG1039530"
FT                   /note="gene_id=mCG1039530.1 transcript_id=mCT157234.1
FT                   created on 28-MAY-2003"
FT   CDS             complement(14863755..14863871)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039530"
FT                   /product="mCG1039530"
FT                   /note="gene_id=mCG1039530.1 transcript_id=mCT157234.1
FT                   protein_id=mCP70887.1"
FT                   /protein_id="EDL38378.1"
FT   gene            complement(14881290..>14943057)
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /note="gene_id=mCG5401.2"
FT   mRNA            complement(join(14881290..14882209,14884243..14884371,
FT                   14885094..14885126,14885438..14885806,14905299..14907212,
FT                   14912297..14912472,14942220..14942342,14942789..>14943057))
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /product="elastin microfibril interfacer 2"
FT                   /note="gene_id=mCG5401.2 transcript_id=mCT4295.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(14881872..14882209,14884243..14884371,
FT                   14885094..14885126,14885438..14885806,14905299..14907212,
FT                   14912297..14912472,14942220..14942342,14942789..>14943057))
FT                   /codon_start=1
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /product="elastin microfibril interfacer 2"
FT                   /note="gene_id=mCG5401.2 transcript_id=mCT4295.2
FT                   protein_id=mCP6268.2"
FT                   /protein_id="EDL38379.1"
FT                   FLYPFLSHL"
FT   assembly_gap    14902584..14903898
FT                   /estimated_length=1315
FT                   /gap_type="unknown"
FT   assembly_gap    14905087..14905106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14932158..14932177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14936031..14936113
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <14947539..14971863
FT                   /locus_tag="mCG_146120"
FT                   /note="gene_id=mCG146120.0"
FT   mRNA            join(<14947539..14947713,14953608..14953674,
FT                   14971593..14971863)
FT                   /locus_tag="mCG_146120"
FT                   /product="mCG146120"
FT                   /note="gene_id=mCG146120.0 transcript_id=mCT186223.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<14953632..14953674,14971593..14971741)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146120"
FT                   /product="mCG146120"
FT                   /note="gene_id=mCG146120.0 transcript_id=mCT186223.0
FT                   protein_id=mCP107776.0"
FT                   /protein_id="EDL38380.1"
FT                   DVGAPAAASYIQVTQVDL"
FT   assembly_gap    14968110..14968503
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    14972798..14972833
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            complement(14976602..>15023196)
FT                   /locus_tag="mCG_122296"
FT                   /note="gene_id=mCG122296.1"
FT   mRNA            complement(join(14976602..14977479,14980999..14981113,
FT                   14981703..14981861,14985512..14985683,14990268..14990338,
FT                   14990479..14990588,14992201..14992391,14993996..14994118,
FT                   14995176..14995261,14997250..14997369,14997507..14997633,
FT                   15001975..15002127,15002391..15002522,15003076..15003163,
FT                   15009186..15009250,15010368..15010483,15011762..15011919,
FT                   15012349..15012428,15013504..15013629,15018934..15019101,
FT                   15021532..15021650,15022188..15022276,15023113..>15023196))
FT                   /locus_tag="mCG_122296"
FT                   /product="mCG122296"
FT                   /note="gene_id=mCG122296.1 transcript_id=mCT123513.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(14977452..14977479,14980999..14981113,
FT                   14981703..14981861,14985512..14985683,14990268..14990338,
FT                   14990479..14990588,14992201..14992391,14993996..14994118,
FT                   14995176..14995261,14997250..14997369,14997507..14997633,
FT                   15001975..15002127,15002391..15002522,15003076..15003163,
FT                   15009186..15009250,15010368..15010483,15011762..15011919,
FT                   15012349..15012428,15013504..15013629,15018934..15019101,
FT                   15021532..15021650,15022188..15022276,15023113..>15023195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122296"
FT                   /product="mCG122296"
FT                   /note="gene_id=mCG122296.1 transcript_id=mCT123513.1
FT                   protein_id=mCP71320.1"
FT                   /protein_id="EDL38381.1"
FT   assembly_gap    15016464..15018076
FT                   /estimated_length=1613
FT                   /gap_type="unknown"
FT   assembly_gap    15023816..15023889
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    15025293..15025312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15029350..>15059941)
FT                   /locus_tag="mCG_120552"
FT                   /note="gene_id=mCG120552.1"
FT   mRNA            complement(join(15029350..15029487,15030964..15030996,
FT                   15033895..15033967,15037949..15038045,15042552..15042696,
FT                   15046026..15046145,15046592..15046669,15057815..15057928,
FT                   15058100..15058182,15059093..15059199,15059828..>15059941))
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, transcript variant mCT121742"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT121742.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(15029441..15029487,15030964..15030996,
FT                   15033895..15033967,15037949..15038045,15042552..15042696,
FT                   15046026..15046145,15046592..15046669,15057815..15057928,
FT                   15058100..15058182,15059093..15059199,15059828..>15059941))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, isoform CRA_a"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT121742.1
FT                   protein_id=mCP70884.1 isoform=CRA_a"
FT                   /protein_id="EDL38382.1"
FT   mRNA            complement(join(<15030931..15030996,15033895..15033967,
FT                   15037949..15038045,15042552..15042696,15046026..15046145,
FT                   15046592..15046669,15057815..>15057935))
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, transcript variant mCT193665"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT193665.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(<15030931..15030996,15033895..15033967,
FT                   15037949..15038045,15042552..15042696,15046026..15046145,
FT                   15046592..15046669,15057815..>15057935))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, isoform CRA_b"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT193665.0
FT                   protein_id=mCP114632.0 isoform=CRA_b"
FT                   /protein_id="EDL38383.1"
FT                   SEVLVIENGTA"
FT   assembly_gap    15051404..15051423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15061118..>15106807)
FT                   /locus_tag="mCG_120558"
FT                   /note="gene_id=mCG120558.1"
FT   mRNA            complement(join(<15061118..15061312,15062866..15063049,
FT                   15068343..15068463,15072529..15072739,15073501..15073591,
FT                   15075451..15075617,15080082..15080201,15080301..15080415,
FT                   15087171..15087301,15087984..15088066,15095288..15095449,
FT                   15097075..15097150,15106471..>15106807))
FT                   /locus_tag="mCG_120558"
FT                   /product="mCG120558"
FT                   /note="gene_id=mCG120558.1 transcript_id=mCT121748.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(<15061118..15061312,15062866..15063049,
FT                   15068343..15068463,15072529..15072739,15073501..15073591,
FT                   15075451..15075617,15080082..15080201,15080301..15080415,
FT                   15087171..15087301,15087984..15088066,15095288..15095449,
FT                   15097075..15097150,15106471..>15106806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120558"
FT                   /product="mCG120558"
FT                   /note="gene_id=mCG120558.1 transcript_id=mCT121748.1
FT                   protein_id=mCP71261.1"
FT                   /protein_id="EDL38384.1"
FT   assembly_gap    15073833..15074189
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   gene            complement(15089751..15091456)
FT                   /pseudo
FT                   /locus_tag="mCG_5407"
FT                   /note="gene_id=mCG5407.2"
FT   mRNA            complement(join(15089751..15090603,15090840..15091456))
FT                   /pseudo
FT                   /locus_tag="mCG_5407"
FT                   /note="gene_id=mCG5407.2 transcript_id=mCT4291.2 created on
FT                   21-APR-2003"
FT   assembly_gap    15109505..15109524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15110938..15111000
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            complement(15128657..15161363)
FT                   /locus_tag="mCG_120549"
FT                   /note="gene_id=mCG120549.0"
FT   mRNA            complement(join(15128657..15128901,15131825..15131927,
FT                   15132846..15132976,15134081..15134173,15137179..15137268,
FT                   15139674..15139826,15140982..15141187,15143763..15143907,
FT                   15144812..15144918,15146602..15146695,15149923..15150012,
FT                   15151348..15151450,15153369..15153541,15153637..15153760,
FT                   15156191..15156268,15158241..15158350,15161214..15161363))
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, transcript variant mCT121739"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT121739.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(15128764..15128901,15131825..15131927,
FT                   15132846..15132976,15134081..15134173,15137179..15137268,
FT                   15139674..15139826,15140982..15141187,15143763..15143907,
FT                   15144812..15144918,15146602..15146695,15149923..15150012,
FT                   15151348..15151450,15153369..15153541,15153637..15153760,
FT                   15156191..15156268,15158241..15158341))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, isoform CRA_a"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT121739.0
FT                   protein_id=mCP71276.1 isoform=CRA_a"
FT                   /protein_id="EDL38385.1"
FT                   QLKAPDK"
FT   mRNA            complement(join(<15151382..15151450,15153369..15153541,
FT                   15153637..15153760,15156001..15156052,15156191..15156268,
FT                   15158241..15158350,15161214..>15161296))
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, transcript variant mCT170871"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT170871.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(<15151382..15151450,15153369..15153541,
FT                   15153637..15153760,15156001..>15156020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, isoform CRA_b"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT170871.0
FT                   protein_id=mCP93789.0 isoform=CRA_b"
FT                   /protein_id="EDL38386.1"
FT   gene            15161397..15226424
FT                   /locus_tag="mCG_5408"
FT                   /note="gene_id=mCG5408.2"
FT   mRNA            join(15161397..15161966,15170023..15170085,
FT                   15173270..15173480,15174129..15174198,15180346..15180452,
FT                   15193200..15193503)
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, transcript variant mCT172485"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT172485.0 created
FT                   on 28-AUG-2002"
FT   assembly_gap    15169149..15169168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(15170068..15170085,15173270..15173480,
FT                   15174129..15174198,15180346..15180445)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, isoform CRA_b"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT172485.0
FT                   protein_id=mCP95404.0 isoform=CRA_b"
FT                   /protein_id="EDL38388.1"
FT   mRNA            join(<15188983..15189054,15193200..15193449,
FT                   15195581..15195639,15199415..15199500,15205932..15206103,
FT                   15214876..15215167,15225475..15226424)
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, transcript variant mCT4292"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT4292.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<15189004..15189054,15193200..15193449,
FT                   15195581..15195639,15199415..15199500,15205932..15206103,
FT                   15214876..15215167,15225475..15225566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, isoform CRA_a"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT4292.2
FT                   protein_id=mCP6306.2 isoform=CRA_a"
FT                   /protein_id="EDL38387.1"
FT   assembly_gap    15189577..15189675
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    15191076..15191095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15193987..>15236000)
FT                   /locus_tag="mCG_146330"
FT                   /note="gene_id=mCG146330.1"
FT   mRNA            complement(join(15193987..15195303,15205525..15205585,
FT                   15206672..15206807,15225730..15225876,15227609..15227630,
FT                   15235181..>15236000))
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, transcript variant mCT193682"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT193682.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(15194020..15195303,15198249..15198348,
FT                   15205525..15205585,15206672..15206807,15225730..15225876,
FT                   15227609..15227630,15235181..>15235991))
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, transcript variant mCT186433"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT186433.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    15200051..15200070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15217319..15217475
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            complement(15231099..15232857)
FT                   /locus_tag="mCG_148350"
FT                   /note="gene_id=mCG148350.0"
FT   mRNA            complement(join(15231099..15231214,15231229..15232857))
FT                   /locus_tag="mCG_148350"
FT                   /product="mCG148350"
FT                   /note="gene_id=mCG148350.0 transcript_id=mCT188613.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15232018..15232188)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148350"
FT                   /product="mCG148350"
FT                   /note="gene_id=mCG148350.0 transcript_id=mCT188613.0
FT                   protein_id=mCP108829.0"
FT                   /protein_id="EDL38391.1"
FT                   KLHILDSHIKY"
FT   assembly_gap    15233479..15233551
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   CDS             complement(15235538..>15235999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, isoform CRA_b"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT193682.0
FT                   protein_id=mCP114644.0 isoform=CRA_b"
FT                   /protein_id="EDL38390.1"
FT   CDS             complement(15235538..>15235990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, isoform CRA_a"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT186433.0
FT                   protein_id=mCP107780.0 isoform=CRA_a"
FT                   /protein_id="EDL38389.1"
FT   assembly_gap    15238150..15238219
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    15248287..15248838
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   gene            <15253548..15296288
FT                   /locus_tag="mCG_5393"
FT                   /note="gene_id=mCG5393.2"
FT   mRNA            join(<15253548..15253806,15262640..15262777,
FT                   15264060..15264181,15267436..15267556,15269278..15269414,
FT                   15270872..15270974,15273814..15273878,15275558..15275729,
FT                   15277482..15277568,15278535..15278666,15279955..15280083,
FT                   15286030..15286116,15287274..15287305,15287825..15287888,
FT                   15290038..15290151,15290710..15290779,15294600..15294649,
FT                   15294735..15296288)
FT                   /locus_tag="mCG_5393"
FT                   /product="mCG5393"
FT                   /note="gene_id=mCG5393.2 transcript_id=mCT4307.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<15253549..15253806,15262640..15262777,
FT                   15264060..15264181,15267436..15267556,15269278..15269414,
FT                   15270872..15270974,15273814..15273878,15275558..15275729,
FT                   15277482..15277568,15278535..15278666,15279955..15280083,
FT                   15286030..15286116,15287274..15287305,15287825..15287888,
FT                   15290038..15290151,15290710..15290779,15294600..15294649,
FT                   15294735..15294920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5393"
FT                   /product="mCG5393"
FT                   /note="gene_id=mCG5393.2 transcript_id=mCT4307.2
FT                   protein_id=mCP6314.2"
FT                   /protein_id="EDL38392.1"
FT   assembly_gap    15261271..15261291
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    15293422..15293496
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    15301703..15301781
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            15310577..>15329041
FT                   /locus_tag="mCG_5409"
FT                   /note="gene_id=mCG5409.2"
FT   mRNA            join(15310577..15310817,15322466..15322604,
FT                   15324990..15325103,15326553..15326840,15327923..15328134,
FT                   15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT173272"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173272.0 created
FT                   on 18-SEP-2002"
FT   assembly_gap    15312891..15313049
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   mRNA            join(15322216..15322254,15322466..15322604,
FT                   15324990..15325103,15326553..15326840,15327923..15328134,
FT                   15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT4287"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT4287.1 created on
FT                   18-SEP-2002"
FT   CDS             join(15322577..15322604,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_a"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173272.0
FT                   protein_id=mCP96191.0 isoform=CRA_a"
FT                   /protein_id="EDL38393.1"
FT   CDS             join(15322577..15322604,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_a"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT4287.1
FT                   protein_id=mCP6291.1 isoform=CRA_a"
FT                   /protein_id="EDL38395.1"
FT   gene            <15324104..15367157
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /note="gene_id=mCG5405.2"
FT   mRNA            join(<15324104..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329037,
FT                   15333101..15333147,15335237..15335400,15337909..15338059,
FT                   15338284..15338448,15342074..15342227,15343167..15343272,
FT                   15344467..15344702,15346885..15347043,15351594..15351711,
FT                   15352036..15352130,15353680..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367032)
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, transcript variant
FT                   mCT182011"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT182011.0 created
FT                   on 15-APR-2003"
FT   mRNA            join(<15324110..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT173273"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173273.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<15324111..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_b"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173273.0
FT                   protein_id=mCP96192.0 isoform=CRA_b"
FT                   /protein_id="EDL38394.1"
FT   CDS             join(<15324135..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329037,
FT                   15333101..15333147,15335237..15335400,15337909..15338059,
FT                   15338284..15338448,15342074..15342227,15343167..15343272,
FT                   15344467..15344702,15346885..15347043,15351594..15351711,
FT                   15352036..15352130,15353680..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367014)
FT                   /codon_start=1
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, isoform CRA_a"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT182011.0
FT                   protein_id=mCP104933.0 isoform=CRA_a"
FT                   /protein_id="EDL38396.1"
FT   mRNA            join(15350627..15350751,15351594..15353875,
FT                   15354608..15354824,15362494..15362580,15366677..15367157)
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, transcript variant
FT                   mCT4298"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT4298.2 created on
FT                   15-APR-2003"
FT   CDS             join(15353627..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367014)
FT                   /codon_start=1
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, isoform CRA_b"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT4298.2
FT                   protein_id=mCP6275.2 isoform=CRA_b"
FT                   /protein_id="EDL38397.1"
FT                   PDIQMTGTTCPQQLD"
FT   assembly_gap    15361715..15362238
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    15368827..15369666
FT                   /estimated_length=840
FT                   /gap_type="unknown"
FT   gene            complement(15381075..15390425)
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /note="gene_id=mCG148331.0"
FT   mRNA            complement(join(15381075..15382247,15386595..15390425))
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /product="cDNA sequence BC027072"
FT                   /note="gene_id=mCG148331.0 transcript_id=mCT188594.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(15382034..15382247,15386595..15390220))
FT                   /codon_start=1
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /product="cDNA sequence BC027072"
FT                   /note="gene_id=mCG148331.0 transcript_id=mCT188594.0
FT                   protein_id=mCP108809.0"
FT                   /protein_id="EDL38398.1"
FT   assembly_gap    15385916..15386035
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    15402679..15403660
FT                   /estimated_length=982
FT                   /gap_type="unknown"
FT   gene            15407079..15492627
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /note="gene_id=mCG5406.2"
FT   mRNA            join(15407079..15407289,15427269..15427416,
FT                   15436357..15436496,15438199..15438292,15439175..15439336,
FT                   15440956..15441074,15443789..15444025,15448107..15448242,
FT                   15464820..15464909,15465628..15465771,15468575..15468709,
FT                   15471548..15471671,15475060..15475124,15487223..15487494)
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, transcript variant mCT172484"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT172484.0 created
FT                   on 28-AUG-2002"
FT   mRNA            join(15418691..15418826,15427269..15427416,
FT                   15436357..15436496,15438199..15438292,15439175..15439336,
FT                   15440956..15441074,15443789..15444025,15448107..15448242,
FT                   15461817..15461957,15464820..15464909,15465628..15465771,
FT                   15468575..15468709,15471548..15471671,15475060..15475124,
FT                   15487223..15487296,15492174..15492627)
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, transcript variant mCT4290"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT4290.2 created on
FT                   28-AUG-2002"
FT   CDS             join(15427284..15427416,15436357..15436496,
FT                   15438199..15438292,15439175..15439336,15440956..15441074,
FT                   15443789..15444025,15448107..15448242,15461817..15461957,
FT                   15464820..15464909,15465628..15465771,15468575..15468709,
FT                   15471548..15471671,15475060..15475124,15487223..15487296,
FT                   15492174..15492341)
FT                   /codon_start=1
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT4290.2
FT                   protein_id=mCP6285.2 isoform=CRA_b"
FT                   /protein_id="EDL38400.1"
FT                   PLRDGLKSEFGCSLQVSY"
FT   CDS             join(15427284..15427416,15436357..15436496,
FT                   15438199..15438292,15439175..15439336,15440956..15441074,
FT                   15443789..15444025,15448107..15448242,15464820..15464909,
FT                   15465628..15465771,15468575..15468709,15471548..15471671,
FT                   15475060..15475124,15487223..15487299)
FT                   /codon_start=1
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT172484.0
FT                   protein_id=mCP95403.0 isoform=CRA_a"
FT                   /protein_id="EDL38399.1"
FT   assembly_gap    15443707..15443726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15456878..15457857
FT                   /estimated_length=980
FT                   /gap_type="unknown"
FT   assembly_gap    15466066..15466085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15489217..15489236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15494484..15495473
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   gene            complement(15497794..16238439)
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /note="gene_id=mCG120548.1"
FT   mRNA            complement(join(15497794..15498562,15502783..15502873,
FT                   15503607..15503741,15509679..15509780,15513265..15513357,
FT                   15518873..15518970,15521994..15522123,15523617..15523681,
FT                   15523782..15523872,15525710..15525896,15527075..15527179,
FT                   15528479..15528631,15529117..15529215,15530440..15530624,
FT                   15532064..15532208,15532923..15533054,15538992..15539142,
FT                   15548221..15548383,15578715..15578843,15579082..15579176,
FT                   15596409..15596578,15615973..15616073,15616766..15616897,
FT                   15623397..15623528,15681707..15681834,15837671..15837872,
FT                   15993901..15994066,16013534..16013650,16237645..16238439))
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /product="anaplastic lymphoma kinase"
FT                   /note="gene_id=mCG120548.1 transcript_id=mCT121738.1
FT                   created on 24-JUL-2002"
FT   assembly_gap    15498565..15499599
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    15511706..15511752
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    15527664..15527909
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   CDS             complement(join(15530440..15530624,15532064..15532208,
FT                   15532923..15533054,15538992..15539142,15548221..15548383,
FT                   15578715..15578843,15579082..15579176,15596409..15596578,
FT                   15615973..15616073,15616766..15616897,15623397..15623528,
FT                   15681707..15681834,15837671..15837872,15993901..15993940))
FT                   /codon_start=1
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /product="anaplastic lymphoma kinase"
FT                   /note="gene_id=mCG120548.1 transcript_id=mCT121738.1
FT                   protein_id=mCP70907.1"
FT                   /protein_id="EDL38401.1"
FT   assembly_gap    15532481..15532737
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    15533804..15536333
FT                   /estimated_length=2530
FT                   /gap_type="unknown"
FT   assembly_gap    15539677..15540450
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    15544612..15544631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15573151..15573170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15574209..15574228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15576032..15576208
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    15586904..15586923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15603295..15603314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15605004..15605023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15638337..15638356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15652555..15652619
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    15661737..15661756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15671373..15671930
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    15674125..15674631
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    15676245..15676264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15691422..15691533
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    15696267..15696286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15703391..15703410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15707789..15707808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15762570..15762623
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    15767125..15767144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15772198..15772217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15806065..15806191
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    15817081..15817352
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    15824692..15824711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15827647..15827897
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    15840366..15840743
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   gene            15888105..15889282
FT                   /pseudo
FT                   /locus_tag="mCG_13994"
FT                   /note="gene_id=mCG13994.2"
FT   mRNA            15888105..15889282
FT                   /pseudo
FT                   /locus_tag="mCG_13994"
FT                   /note="gene_id=mCG13994.2 transcript_id=mCT18769.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    15903903..15904043
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    15930707..15930807
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    15931190..15931559
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    15945617..15945834
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    15946718..15946807
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    15952492..15952744
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    15954445..15954464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15965406..15965425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15989830..15989867
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    15995986..15996143
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    16023698..16023717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16025246..16025265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16057725..16059849
FT                   /estimated_length=2125
FT                   /gap_type="unknown"
FT   assembly_gap    16066842..16074239
FT                   /estimated_length=7398
FT                   /gap_type="unknown"
FT   assembly_gap    16119036..16119055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16121176..16121195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16177404..16177423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16219430..16219495
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    16227645..16228007
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    16231593..16231612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16239322..16239451
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    16249672..16249691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16250891..16250910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16256797..16256816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16260424..16266176
FT                   /estimated_length=5753
FT                   /gap_type="unknown"
FT   assembly_gap    16316353..16316372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16330523..16331450)
FT                   /pseudo
FT                   /locus_tag="mCG_13995"
FT                   /note="gene_id=mCG13995.1"
FT   mRNA            complement(16330523..16331450)
FT                   /pseudo
FT                   /locus_tag="mCG_13995"
FT                   /note="gene_id=mCG13995.1 transcript_id=mCT18770.1 created
FT                   on 14-OCT-2002"
FT   assembly_gap    16336145..16336164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16336601..16337270
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    16338708..16338727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16347911..16352235
FT                   /estimated_length=4325
FT                   /gap_type="unknown"
FT   assembly_gap    16363784..16365688
FT                   /estimated_length=1905
FT                   /gap_type="unknown"
FT   assembly_gap    16374227..16374411
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    16416440..16416459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16421015..16421034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16423811..16423830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16448044..16448063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16456898..16456917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16458234..16458253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16465513..16465987
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   gene            16480810..16494484
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /note="gene_id=mCG49872.2"
FT   mRNA            join(16480810..16480900,16490320..16490484,
FT                   16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT50055"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT50055.1 created
FT                   on 12-SEP-2002"
FT   assembly_gap    16481214..16481620
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   mRNA            join(16481689..16481845,16490320..16490484,
FT                   16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT172971"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172971.0 created
FT                   on 12-SEP-2002"
FT   mRNA            join(16482120..16482214,16484983..16485182,
FT                   16490320..16490484,16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT172972"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172972.0 created
FT                   on 12-SEP-2002"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172971.0
FT                   protein_id=mCP95890.0 isoform=CRA_a"
FT                   /protein_id="EDL38402.1"
FT                   LVRESEGFEEHVPSDNS"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172972.0
FT                   protein_id=mCP95891.0 isoform=CRA_a"
FT                   /protein_id="EDL38403.1"
FT                   LVRESEGFEEHVPSDNS"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT50055.1
FT                   protein_id=mCP28784.1 isoform=CRA_a"
FT                   /protein_id="EDL38404.1"
FT                   LVRESEGFEEHVPSDNS"
FT   assembly_gap    16510958..16510977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16513155..16513252
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    16530868..16530887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16534508..16534830
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    16543562..16543666
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    16545572..16545591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16562568..16586175
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /note="gene_id=mCG5418.2"
FT   mRNA            join(16562568..16562836,16565445..16565547,
FT                   16583491..16586175)
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, transcript variant mCT4722"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT4722.2 created on
FT                   29-AUG-2002"
FT   CDS             join(16562811..16562836,16565445..16565547,
FT                   16583491..16583679)
FT                   /codon_start=1
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, isoform CRA_b"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT4722.2
FT                   protein_id=mCP6278.1 isoform=CRA_b partial"
FT                   /protein_id="EDL38406.1"
FT                   Q"
FT   mRNA            join(<16565439..16565547,16582107..16582249,
FT                   16583491..16583804)
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, transcript variant mCT172487"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT172487.0 created
FT                   on 29-AUG-2002"
FT   CDS             join(<16565469..16565547,16582107..16582249,
FT                   16583491..16583679)
FT                   /codon_start=1
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, isoform CRA_a"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT172487.0
FT                   protein_id=mCP95406.0 isoform=CRA_a"
FT                   /protein_id="EDL38405.1"
FT   assembly_gap    16585877..16585916
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    16644762..16645561
FT                   /estimated_length=800
FT                   /gap_type="unknown"
FT   assembly_gap    16668336..16668663
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    16673919..16673938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16676508..16676527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16699930..16699981
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    16721277..16721734
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    16726254..16730455
FT                   /estimated_length=4202
FT                   /gap_type="unknown"
FT   assembly_gap    16734471..16734743
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   gene            16755836..16888928
FT                   /locus_tag="mCG_5412"
FT                   /note="gene_id=mCG5412.2"
FT   mRNA            join(16755836..16756009,16809487..16809655,
FT                   16817176..16817374,16835557..16835703,16844362..16844478,
FT                   16885303..16888928)
FT                   /locus_tag="mCG_5412"
FT                   /product="mCG5412"
FT                   /note="gene_id=mCG5412.2 transcript_id=mCT4731.2 created on
FT                   18-SEP-2002"
FT   assembly_gap    16770098..16770117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16809491..16809655,16817176..16817374,
FT                   16835557..16835703,16844362..16844478,16885303..16885805)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5412"
FT                   /product="mCG5412"
FT                   /note="gene_id=mCG5412.2 transcript_id=mCT4731.2
FT                   protein_id=mCP6293.2"
FT                   /db_xref="GOA:B0V2Q7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="MGI:MGI:2684937"
FT                   /db_xref="UniProtKB/TrEMBL:B0V2Q7"
FT                   /protein_id="EDL38407.1"
FT   assembly_gap    16813521..16813540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16837943..16839367)
FT                   /pseudo
FT                   /locus_tag="mCG_51564"
FT                   /note="gene_id=mCG51564.2"
FT   mRNA            complement(join(16837943..16838983,16839151..16839367))
FT                   /pseudo
FT                   /locus_tag="mCG_51564"
FT                   /note="gene_id=mCG51564.2 transcript_id=mCT51747.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    16855785..16855804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16857194..16857213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16862732..16862751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16870890..16870909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16875590..16876353
FT                   /estimated_length=764
FT                   /gap_type="unknown"
FT   assembly_gap    16882032..16882701
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   gene            16898112..16906204
FT                   /locus_tag="mCG_1039541"
FT                   /note="gene_id=mCG1039541.1"
FT   mRNA            join(16898112..16898270,16898437..16898592,
FT                   16899336..16899490,16899663..16899803,16900719..16900897,
FT                   16903889..16906204)
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, transcript variant mCT157245"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT157245.1
FT                   created on 21-APR-2003"
FT   mRNA            join(16898112..16898270,16899663..16899803,
FT                   16900719..16900897,16903889..16906204)
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, transcript variant mCT182035"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT182035.0
FT                   created on 21-APR-2003"
FT   CDS             16904113..16904469
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, isoform CRA_a"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT157245.1
FT                   protein_id=mCP70980.1 isoform=CRA_a"
FT                   /protein_id="EDL38408.1"
FT                   LLWQSPFPYRCFQP"
FT   CDS             16904113..16904469
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, isoform CRA_a"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT182035.0
FT                   protein_id=mCP104957.0 isoform=CRA_a"
FT                   /protein_id="EDL38409.1"
FT                   LLWQSPFPYRCFQP"
FT   assembly_gap    16915270..16915721
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    16943833..16943852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16952380..>16967988)
FT                   /locus_tag="mCG_5414"
FT                   /note="gene_id=mCG5414.2"
FT   mRNA            complement(join(16952380..16952803,16961259..16961317,
FT                   16962239..16962294,16964034..16964162,16967974..>16967988))
FT                   /locus_tag="mCG_5414"
FT                   /product="mCG5414"
FT                   /note="gene_id=mCG5414.2 transcript_id=mCT4728.2 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(16952729..16952803,16961259..16961317,
FT                   16962239..16962294,16964034..>16964095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5414"
FT                   /product="mCG5414"
FT                   /note="gene_id=mCG5414.2 transcript_id=mCT4728.2
FT                   protein_id=mCP6304.2"
FT                   /protein_id="EDL38410.1"
FT   assembly_gap    16958309..16958379
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    16964655..16966132
FT                   /estimated_length=1478
FT                   /gap_type="unknown"
FT   assembly_gap    16991558..16991806
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    16995676..16995858
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            complement(17006342..17045251)
FT                   /locus_tag="mCG_5413"
FT                   /note="gene_id=mCG5413.2"
FT   mRNA            complement(join(17006342..17006488,17011873..17011988,
FT                   17013138..17013210,17028772..17028999,17045126..17045251))
FT                   /locus_tag="mCG_5413"
FT                   /product="mCG5413"
FT                   /note="gene_id=mCG5413.2 transcript_id=mCT4727.2 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(17006348..17006488,17011873..17011988,
FT                   17013138..17013210,17028772..17028963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5413"
FT                   /product="mCG5413"
FT                   /note="gene_id=mCG5413.2 transcript_id=mCT4727.2
FT                   protein_id=mCP6300.2"
FT                   /protein_id="EDL38411.1"
FT                   PCLMEKAYAK"
FT   assembly_gap    17048042..17048218
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    17058914..17059153
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    17064087..17064931
FT                   /estimated_length=845
FT                   /gap_type="unknown"
FT   assembly_gap    17121390..17121549
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            complement(17138741..17362708)
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /note="gene_id=mCG5417.3"
FT   mRNA            complement(join(17138741..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..>17362349))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT193685"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT193685.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(17139262..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171861,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..>17225044))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT172486"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT172486.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(17139684..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..>17362347))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_b"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT193685.0
FT                   protein_id=mCP114661.0 isoform=CRA_b"
FT                   /protein_id="EDL38413.1"
FT   CDS             complement(join(17139684..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171861,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..>17225044))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_a"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT172486.0
FT                   protein_id=mCP95405.0 isoform=CRA_a"
FT                   /protein_id="EDL38412.1"
FT   mRNA            complement(join(17153079..17153414,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..17362708))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT4732"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT4732.2 created on
FT                   29-AUG-2002"
FT   CDS             complement(join(17153276..17153414,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..17362344))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_c"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT4732.2
FT                   protein_id=mCP6266.2 isoform=CRA_c"
FT                   /protein_id="EDL38414.1"
FT   assembly_gap    17154165..17154184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17184688..17184707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17186577..17186596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17187671..17187690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17190010..17190029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17207817..17207836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17212107..17212126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17230717..17230828
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    17236644..17236663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17257520..17257539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17262248..17262267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17263682..17263765
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    17282941..17283053
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            complement(17286216..17290853)
FT                   /locus_tag="mCG_148338"
FT                   /note="gene_id=mCG148338.0"
FT   mRNA            complement(join(17286216..17289124,17290736..17290853))
FT                   /locus_tag="mCG_148338"
FT                   /product="mCG148338"
FT                   /note="gene_id=mCG148338.0 transcript_id=mCT188601.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(17288869..17289124,17290736..17290770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148338"
FT                   /product="mCG148338"
FT                   /note="gene_id=mCG148338.0 transcript_id=mCT188601.0
FT                   protein_id=mCP108818.0 partial"
FT                   /protein_id="EDL38415.1"
FT   assembly_gap    17290812..17290831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17295540..17295559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17314560..17314579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17348789..17348808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17369871..17369890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17389330..17390666
FT                   /estimated_length=1337
FT                   /gap_type="unknown"
FT   assembly_gap    17432521..17432591
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            17457555..17484711
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /note="gene_id=mCG5416.1"
FT   mRNA            join(17457555..17458153,17468843..17469019,
FT                   17473091..17473188,17479773..17480185,17480669..17480833,
FT                   17482541..17484711)
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /product="EH-domain containing 3"
FT                   /note="gene_id=mCG5416.1 transcript_id=mCT4730.1 created on
FT                   24-JUL-2002"
FT   CDS             join(17457927..17458153,17468843..17469019,
FT                   17473091..17473188,17479773..17480185,17480669..17480833,
FT                   17482541..17483068)
FT                   /codon_start=1
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /product="EH-domain containing 3"
FT                   /note="gene_id=mCG5416.1 transcript_id=mCT4730.1
FT                   protein_id=mCP6259.1"
FT                   /protein_id="EDL38416.1"
FT                   PSELPAHLLPPSKRKVSE"
FT   assembly_gap    17468460..17468479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17487468..17487702
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    17491147..17491862
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    17499173..17499509
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    17511502..17511731
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            complement(17522759..17523675)
FT                   /pseudo
FT                   /locus_tag="mCG_5415"
FT                   /note="gene_id=mCG5415.2"
FT   mRNA            complement(17522759..17523675)
FT                   /pseudo
FT                   /locus_tag="mCG_5415"
FT                   /note="gene_id=mCG5415.2 transcript_id=mCT4729.2 created on
FT                   14-OCT-2002"
FT   gene            complement(17536232..>17600881)
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /note="gene_id=mCG120176.0"
FT   mRNA            complement(join(17536232..17536809,17538670..17538846,
FT                   17541221..17541409,17542833..17542898,17543714..17543828,
FT                   17545860..17545912,17547121..17547195,17547796..17547924,
FT                   17548430..17548525,17549077..17549158,17550381..17550526,
FT                   17550651..17550842,17556119..17556205,17556313..17556400,
FT                   17556804..17556937,17557730..17557854,17559356..17559452,
FT                   17560275..17560394,17562538..17562661,17564788..17564957,
FT                   17566594..17566677,17567553..17567727,17569138..17569322,
FT                   17571158..17571267,17572031..17572124,17573177..17573328,
FT                   17573807..17573899,17575679..17575820,17576938..17577024,
FT                   17577312..17577380,17585548..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17600806..>17600881))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT121359"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT121359.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(17536759..17536809,17538670..17538846,
FT                   17541221..17541409,17542833..17542898,17543714..17543828,
FT                   17545860..17545912,17547121..17547195,17547796..17547924,
FT                   17548430..17548525,17549077..17549158,17550381..17550526,
FT                   17550651..17550842,17556119..17556205,17556313..17556400,
FT                   17556804..17556937,17557730..17557854,17559356..17559452,
FT                   17560275..17560394,17562538..17562661,17564788..17564957,
FT                   17566594..17566677,17567553..17567727,17569138..17569322,
FT                   17571158..17571267,17572031..17572124,17573177..17573328,
FT                   17573807..17573899,17575679..17575820,17576938..17577024,
FT                   17577312..17577380,17585548..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17600806..>17600880))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_a"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT121359.0
FT                   protein_id=mCP71192.0 isoform=CRA_a"
FT                   /protein_id="EDL38417.1"
FT                   "
FT   assembly_gap    17539245..17539264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(17539265..17539521,17541221..17541409,
FT                   17542833..17542898,17543714..17543828,17545860..17545912,
FT                   17547121..17547195,17547796..17547924,17548430..17548525,
FT                   17549077..17549158,17550381..17550526,17550651..17550842,
FT                   17556119..17556205,17556313..17556400,17556804..17556937,
FT                   17557730..17557854,17559356..17559452,17560275..17560394,
FT                   17562538..17562661,17564788..17564957,17566594..17566677,
FT                   17567555..17567727,17569138..17569322,17571158..17571267,
FT                   17572031..17572124,17573177..17573328,17573807..17573899,
FT                   17575679..17575820,17576938..17577024,17577312..17577380,
FT                   17585548..17585609,17586618..17586744,17590502..17590607,
FT                   17591788..17591884,17594593..17594650,17600806..>17600874))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT193659"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT193659.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17539483..17539521,17541221..17541409,
FT                   17542833..17542898,17543714..17543828,17545860..17545912,
FT                   17547121..17547195,17547796..17547924,17548430..17548525,
FT                   17549077..17549158,17550381..17550526,17550651..17550842,
FT                   17556119..17556205,17556313..17556400,17556804..17556937,
FT                   17557730..17557854,17559356..17559452,17560275..17560394,
FT                   17562538..17562661,17564788..17564957,17566594..17566677,
FT                   17567555..>17567590))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_c"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT193659.0
FT                   protein_id=mCP114630.0 isoform=CRA_c"
FT                   /protein_id="EDL38419.1"
FT   assembly_gap    17563783..17564280
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<17585541..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17598911..>17598987))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT170869"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT170869.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(<17585541..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17598911..>17598985))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_b"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT170869.0
FT                   protein_id=mCP93787.0 isoform=CRA_b"
FT                   /protein_id="EDL38418.1"
FT                   RPILQGFRTFAKVS"
FT   assembly_gap    17635608..17635691
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    17661794..17662361
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    17663099..17664757
FT                   /estimated_length=1659
FT                   /gap_type="unknown"
FT   assembly_gap    17666172..17666406
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   gene            complement(17670563..>17731744)
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /note="gene_id=mCG5420.2"
FT   mRNA            complement(join(17670563..17670704,17674316..17674466,
FT                   17677386..17677487,17679914..17680077,17700273..17700642))
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, transcript variant
FT                   mCT4935"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT4935.2 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(17670638..17670704,17674316..17674466,
FT                   17677386..17677487,17679914..17680077,17700273..17700553))
FT                   /codon_start=1
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, isoform CRA_b"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT4935.2
FT                   protein_id=mCP6326.0 isoform=CRA_b"
FT                   /protein_id="EDL38421.1"
FT   mRNA            complement(join(<17679934..17680077,17721213..17721316,
FT                   17726441..17726640,17731445..>17731744))
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, transcript variant
FT                   mCT170908"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT170908.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<17679934..17680077,17721213..>17721283))
FT                   /codon_start=1
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, isoform CRA_a"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT170908.0
FT                   protein_id=mCP93826.0 isoform=CRA_a"
FT                   /protein_id="EDL38420.1"
FT   assembly_gap    17686850..17686869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17688116..17688135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17719936..17720052
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    17735576..17735595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17738417..17741946
FT                   /estimated_length=3530
FT                   /gap_type="unknown"
FT   assembly_gap    17743400..17743556
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    17748542..17750989
FT                   /estimated_length=2448
FT                   /gap_type="unknown"
FT   assembly_gap    17753188..17753714
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    17754928..17755141
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    17766304..17767665
FT                   /estimated_length=1362
FT                   /gap_type="unknown"
FT   assembly_gap    17768648..17770498
FT                   /estimated_length=1851
FT                   /gap_type="unknown"
FT   assembly_gap    17773719..17773738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17792462..17792546
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    17801174..17801193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17814873..17814900
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    17818286..17818678
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    17821317..17821567
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    17824233..17824252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17825613..17825632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17838745..17839252
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    17847696..17848156
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   gene            complement(17855142..>17914615)
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /note="gene_id=mCG1112.1"
FT   mRNA            complement(join(17855142..17857413,17858230..17858334,
FT                   17872904..17872980,17881541..17881683,17898005..17898116,
FT                   17901075..17901187,17911361..17911429,17914533..>17914615))
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, transcript variant
FT                   mCT8806"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT8806.2 created on
FT                   24-JUL-2002"
FT   mRNA            complement(join(17857159..17857413,17858230..17858334,
FT                   17881541..17881686))
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, transcript variant
FT                   mCT170864"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT170864.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(17857282..17857413,17858230..17858334,
FT                   17872904..17872980,17881541..17881683,17898005..17898116,
FT                   17901075..17901187,17911361..17911429,17914533..>17914615))
FT                   /codon_start=1
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, isoform CRA_b"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT8806.2
FT                   protein_id=mCP20448.1 isoform=CRA_b"
FT                   /protein_id="EDL38423.1"
FT   CDS             complement(join(17857282..17857413,17858230..17858331))
FT                   /codon_start=1
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, isoform CRA_a"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT170864.0
FT                   protein_id=mCP93782.0 isoform=CRA_a"
FT                   /protein_id="EDL38422.1"
FT   assembly_gap    17857836..17857905
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    17866054..17866131
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            17867697..17870632
FT                   /pseudo
FT                   /locus_tag="mCG_61978"
FT                   /note="gene_id=mCG61978.2"
FT   mRNA            join(17867697..17868347,17868409..17870632)
FT                   /pseudo
FT                   /locus_tag="mCG_61978"
FT                   /note="gene_id=mCG61978.2 transcript_id=mCT62161.2 created
FT                   on 21-APR-2003"
FT   assembly_gap    17879858..17879877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17923192..18174713
FT                   /locus_tag="mCG_148344"
FT                   /note="gene_id=mCG148344.0"
FT   mRNA            join(17923192..17923217,18172139..18174713)
FT                   /locus_tag="mCG_148344"
FT                   /product="mCG148344"
FT                   /note="gene_id=mCG148344.0 transcript_id=mCT188607.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    17936096..17936337
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    17940104..17940225
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    17950914..17952115
FT                   /estimated_length=1202
FT                   /gap_type="unknown"
FT   gene            complement(17955799..17979843)
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /note="gene_id=mCG1110.2"
FT   mRNA            complement(join(17955799..17956150,17972258..17972305,
FT                   17972400..17972472,17972701..17972805))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT8802"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT8802.2 created on
FT                   29-AUG-2002"
FT   mRNA            complement(join(17955958..17956124,17972258..17972305,
FT                   17972400..17972472,17972576..17972764))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT172463"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172463.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(17956078..17956150,17972258..17972305,
FT                   17972400..17972472,17979742..17979843))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT172464"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172464.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(17956091..17956150,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_b"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172464.0
FT                   protein_id=mCP95382.0 isoform=CRA_b"
FT                   /protein_id="EDL38426.1"
FT                   AV"
FT   CDS             complement(join(17956091..17956150,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_b"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT8802.2
FT                   protein_id=mCP20447.2 isoform=CRA_b"
FT                   /protein_id="EDL38427.1"
FT                   AV"
FT   CDS             complement(join(17956110..17956124,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_a"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172463.0
FT                   protein_id=mCP95383.0 isoform=CRA_a"
FT                   /protein_id="EDL38425.1"
FT                   /translation="MESEQMLEGQTQVAENPHSEYGLTDSVEHLIF"
FT   assembly_gap    17962884..17964656
FT                   /estimated_length=1773
FT                   /gap_type="unknown"
FT   assembly_gap    17974019..17975851
FT                   /estimated_length=1833
FT                   /gap_type="unknown"
FT   assembly_gap    17976435..17976688
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    17980220..17980311
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    17981094..17981614
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   gene            complement(17985284..17985915)
FT                   /pseudo
FT                   /locus_tag="mCG_1039331"
FT                   /note="gene_id=mCG1039331.1"
FT   mRNA            complement(17985284..17985915)
FT                   /pseudo
FT                   /locus_tag="mCG_1039331"
FT                   /note="gene_id=mCG1039331.1 transcript_id=mCT157035.1
FT                   created on 23-APR-2003"
FT   gene            complement(17988216..17988783)
FT                   /pseudo
FT                   /locus_tag="mCG_1039294"
FT                   /note="gene_id=mCG1039294.0"
FT   mRNA            complement(join(17988216..17988439,17988515..17988783))
FT                   /pseudo
FT                   /locus_tag="mCG_1039294"
FT                   /note="gene_id=mCG1039294.0 transcript_id=mCT156998.1
FT                   created on 28-OCT-2002"
FT   assembly_gap    17991340..17994910
FT                   /estimated_length=3571
FT                   /gap_type="unknown"
FT   gene            17994995..18047443
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /note="gene_id=mCG1114.3"
FT   mRNA            join(17994995..17995453,18008262..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044727)
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, transcript variant mCT193688"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT193688.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(17995045..17995453,18008262..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044555)
FT                   /codon_start=1
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, isoform CRA_a"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT193688.0
FT                   protein_id=mCP114626.0 isoform=CRA_a"
FT                   /protein_id="EDL38428.1"
FT   mRNA            join(<17995217..17995453,18008259..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18047443)
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, transcript variant mCT8804"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT8804.2 created on
FT                   30-AUG-2002"
FT   CDS             join(<17995219..17995453,18008259..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044555)
FT                   /codon_start=1
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, isoform CRA_b"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT8804.2
FT                   protein_id=mCP20441.2 isoform=CRA_b"
FT                   /protein_id="EDL38429.1"
FT   assembly_gap    17996525..17996622
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    18001562..18004679
FT                   /estimated_length=3118
FT                   /gap_type="unknown"
FT   assembly_gap    18036053..18036072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18037381..18037525
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    18041564..18041583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18051584..18051603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18054123..18054142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18055227..18055246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18057970..18057989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <18058927..18089174
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /note="gene_id=mCG120952.1"
FT   mRNA            join(<18058927..18058964,18066005..18066091,
FT                   18068112..18068196,18069793..18069835,18071329..18071394,
FT                   18072832..18072913,18073338..18073373,18074319..18074413,
FT                   18076259..18076307,18076592..18076711,18079606..18079708,
FT                   18083658..18083705,18084570..18084638,18087962..18089173)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT122141"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT122141.1
FT                   created on 30-AUG-2002"
FT   mRNA            join(<18058941..18058964,18064906..18064992,
FT                   18068112..18068196,18069793..18069835,18071329..18071394,
FT                   18072832..18072913,18073338..18073373,18074319..18074413,
FT                   18076259..18076307,18076589..>18076710)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT172467"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172467.0
FT                   created on 30-AUG-2002"
FT   assembly_gap    18060289..18060308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18061372..18064340
FT                   /estimated_length=2969
FT                   /gap_type="unknown"
FT   assembly_gap    18065529..18065548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<18071367..18071394,18072832..18072913,
FT                   18073338..18073373,18074319..18074413,18076259..18076307,
FT                   18076592..18076711,18079606..18079708,18083658..18083705,
FT                   18084570..18084638,18087962..18088459)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_b"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT122141.1
FT                   protein_id=mCP70801.1 isoform=CRA_b"
FT                   /protein_id="EDL38431.1"
FT   CDS             join(<18071367..18071394,18072832..18072913,
FT                   18073338..18073373,18074319..18074413,18076259..18076307,
FT                   18076589..>18076710)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_a"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172467.0
FT                   protein_id=mCP95387.0 isoform=CRA_a"
FT                   /protein_id="EDL38430.1"
FT   assembly_gap    18072765..18072784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<18076263..18076307,18076592..18076711,
FT                   18079606..18079688,18080749..18080767,18083658..18083705,
FT                   18084570..18084638,18087962..18089174)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT172468"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172468.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<18079609..18079688,18080749..18080767,
FT                   18083658..18083705,18084570..18084638,18087962..18088459)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_c"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172468.0
FT                   protein_id=mCP95386.0 isoform=CRA_c"
FT                   /protein_id="EDL38432.1"
FT                   IPSRYGINRMGQPRP"
FT   assembly_gap    18079988..18080007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18085675..18085694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18091258..>18113428)
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /note="gene_id=mCG1113.2"
FT   mRNA            complement(join(18091258..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18110339..18112333,18113167..>18113427))
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   transcript variant mCT8807"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT8807.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(18091259..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18113167..>18113428))
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   transcript variant mCT173270"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT173270.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(18091787..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18113167..>18113428))
FT                   /codon_start=1
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT173270.0
FT                   protein_id=mCP96189.0 isoform=CRA_a"
FT                   /protein_id="EDL38433.1"
FT   CDS             complement(join(18091787..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18110339..18112333,18113167..>18113425))
FT                   /codon_start=1
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT8807.2
FT                   protein_id=mCP20458.2 isoform=CRA_b"
FT                   /protein_id="EDL38434.1"
FT   assembly_gap    18093235..18093254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18096780..18096799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18103435..18103873)
FT                   /pseudo
FT                   /locus_tag="mCG_1121"
FT                   /note="gene_id=mCG1121.1"
FT   mRNA            complement(18103435..18103873)
FT                   /pseudo
FT                   /locus_tag="mCG_1121"
FT                   /note="gene_id=mCG1121.1 transcript_id=mCT8813.1 created on
FT                   30-AUG-2002"
FT   assembly_gap    18113934..18113953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18130974..18131389
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    18136638..18142998
FT                   /estimated_length=6361
FT                   /gap_type="unknown"
FT   assembly_gap    18156733..18156752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18158284..18159136
FT                   /pseudo
FT                   /locus_tag="mCG_1118"
FT                   /note="gene_id=mCG1118.1"
FT   mRNA            18158284..18159136
FT                   /pseudo
FT                   /locus_tag="mCG_1118"
FT                   /note="gene_id=mCG1118.1 transcript_id=mCT8810.1 created on
FT                   14-OCT-2002"
FT   gene            <18160568..18171949
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /note="gene_id=mCG1117.3"
FT   mRNA            join(<18160568..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167731,18169369..18169482,
FT                   18170031..18171033)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT193692"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT193692.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18160576..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18171949)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT8809"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT8809.1 created on
FT                   25-JUL-2002"
FT   mRNA            join(18160611..18160855,18161542..18161773,
FT                   18163407..18163566,18164989..18165160,18167650..18167727,
FT                   18169369..18169482,18170031..18171020)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT170865"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT170865.0 created
FT                   on 25-JUL-2002"
FT   CDS             join(<18160723..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167731,18169369..18169460)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_b"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT193692.0
FT                   protein_id=mCP114627.0 isoform=CRA_b"
FT                   /protein_id="EDL38436.1"
FT   CDS             join(18160777..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18170168)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_c"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT8809.1
FT                   protein_id=mCP20453.1 isoform=CRA_c"
FT                   /protein_id="EDL38437.1"
FT   CDS             join(18161566..18161773,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18170168)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_a"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT170865.0
FT                   protein_id=mCP93783.0 isoform=CRA_a"
FT                   /protein_id="EDL38435.1"
FT                   FLSLYTGV"
FT   CDS             18173587..18173943
FT                   /codon_start=1
FT                   /locus_tag="mCG_148344"
FT                   /product="mCG148344"
FT                   /note="gene_id=mCG148344.0 transcript_id=mCT188607.0
FT                   protein_id=mCP108824.0"
FT                   /protein_id="EDL38424.1"
FT                   FYVSFSVLYKSDLF"
FT   assembly_gap    18191229..18191295
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            18199339..18375138
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /note="gene_id=mCG1116.2"
FT   mRNA            join(18199339..18199859,18217355..18217536,
FT                   18219825..18219962,18229086..18229279,18232336..18232447,
FT                   18233204..18233286,18236976..18237359,18245469..18245527,
FT                   18251061..18252458,18257910..18258059,18261603..18261830,
FT                   18265015..18265175,18266286..18266375,18266792..18266923,
FT                   18268780..18268961,18269940..18270073,18270884..18271045,
FT                   18271138..18271269,18271771..18271868,18274871..18275018,
FT                   18276400..18276533,18277897..18278043,18280005..18280192,
FT                   18280967..18281296,18281545..18281644,18282903..18283117,
FT                   18283256..18283464,18283907..18284253,18285285..18285504,
FT                   18286206..18286339,18287127..18287237,18290334..18290461,
FT                   18291605..18291736,18293934..18294149,18294807..18294990,
FT                   18295649..18295804,18297004..18297137,18298860..18299013,
FT                   18301299..18301415,18302854..18303008,18303505..18303631,
FT                   18306684..18306794,18307651..18307784,18310231..18310358,
FT                   18311668..18312230,18313521..18313696,18314149..18314245,
FT                   18314380..18314574,18315183..18315383,18318357..18318636,
FT                   18319068..18319324,18319581..18319689,18319982..18320203,
FT                   18321487..18322267,18323772..18323915,18324481..18324610,
FT                   18326253..18326384,18327036..18327203,18330007..18330180,
FT                   18331372..18331568,18332595..18332895,18334814..18335031,
FT                   18340929..18341093,18342384..18342552,18349336..18349549,
FT                   18361293..18361438,18362433..18362543,18363077..18363294,
FT                   18364259..18364420,18365523..18365600,18368312..18368500,
FT                   18369460..18369594,18374279..18375138)
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /product="baculoviral IAP repeat-containing 6"
FT                   /note="gene_id=mCG1116.2 transcript_id=mCT8808.2 created on
FT                   25-JUL-2002"
FT   assembly_gap    18203211..18203464
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    18213929..18214316
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    18216651..18216695
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    18219635..18219660
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    18220542..18221038
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    18221631..18221856
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    18241896..18243962
FT                   /estimated_length=2067
FT                   /gap_type="unknown"
FT   gene            complement(18247277..>18289027)
FT                   /locus_tag="mCG_146329"
FT                   /note="gene_id=mCG146329.0"
FT   mRNA            complement(join(18247277..18247476,18279955..18281288,
FT                   18283341..18283441,18288729..>18289027))
FT                   /locus_tag="mCG_146329"
FT                   /product="mCG146329"
FT                   /note="gene_id=mCG146329.0 transcript_id=mCT186432.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    18253243..18253262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(18261787..18261830,18265015..18265175,
FT                   18266286..18266375,18266792..18266923,18268780..18268961,
FT                   18269940..18270073,18270884..18271045,18271138..18271269,
FT                   18271771..18271868,18274871..18275018,18276400..18276533,
FT                   18277897..18278043,18280005..18280192,18280967..18281296,
FT                   18281545..18281644,18282903..18283117,18283256..18283464,
FT                   18283907..18284253,18285285..18285504,18286206..18286339,
FT                   18287127..18287237,18290334..18290461,18291605..18291736,
FT                   18293934..18294149,18294807..18294990,18295649..18295804,
FT                   18297004..18297137,18298860..18299013,18301299..18301415,
FT                   18302854..18303008,18303505..18303631,18306684..18306794,
FT                   18307651..18307784,18310231..18310358,18311668..18312230,
FT                   18313521..18313696,18314149..18314245,18314380..18314574,
FT                   18315183..18315383,18318357..18318636,18319068..18319324,
FT                   18319581..18319689,18319982..18320203,18321487..18322267,
FT                   18323772..18323915,18324481..18324610,18326253..18326384,
FT                   18327036..18327203,18330007..18330180,18331372..18331568,
FT                   18332595..18332895,18334814..18335031,18340929..18341093,
FT                   18342384..18342552,18349336..18349549,18361293..18361438,
FT                   18362433..18362543,18363077..18363294,18364259..18364420,
FT                   18365523..18365600,18368312..18368500,18369460..18369594,
FT                   18374279..18374458)
FT                   /codon_start=1
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /product="baculoviral IAP repeat-containing 6"
FT                   /note="gene_id=mCG1116.2 transcript_id=mCT8808.2
FT                   protein_id=mCP20444.2"
FT                   /protein_id="EDL38438.1"
FT   assembly_gap    18263060..18263799
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    18265610..18265886
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   CDS             complement(join(18281056..18281288,18283341..18283441,
FT                   18288729..>18288745))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146329"
FT                   /product="mCG146329"
FT                   /note="gene_id=mCG146329.0 transcript_id=mCT186432.0
FT                   protein_id=mCP107779.0"
FT                   /protein_id="EDL38439.1"
FT                   PGAATGLEGTAL"
FT   assembly_gap    18289477..18289496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18304323..18304684
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    18328694..18328713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18337939..18337958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18354348..18354405
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            <18389535..18529925
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /note="gene_id=mCG1120.2"
FT   mRNA            join(18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18529771..18529925)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT172465"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT172465.1 created
FT                   on 27-MAR-2003"
FT   mRNA            join(<18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529689..18529924)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT193661"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT193661.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529692..18529924)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT8812"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT8812.2 created on
FT                   27-MAR-2003"
FT   CDS             join(<18389674..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529689..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT193661.0
FT                   protein_id=mCP114628.0 isoform=CRA_c"
FT                   /protein_id="EDL38442.1"
FT   CDS             join(18389698..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18529771..18529815)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT172465.1
FT                   protein_id=mCP95384.1 isoform=CRA_a"
FT                   /protein_id="EDL38440.1"
FT   CDS             join(18389698..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529692..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT8812.2
FT                   protein_id=mCP20450.3 isoform=CRA_d"
FT                   /protein_id="EDL38443.1"
FT   assembly_gap    18398099..18398118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18411230..18411249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(18433124..18433191,18436768..18436881,
FT                   18444317..18444412,18447459..18447581,18465825..18466052,
FT                   18496046..18496144,18501895..18501947,18506861..18507026,
FT                   18522964..18523161,18524564..18524675,18528402..18528502,
FT                   18529689..18529918)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT181397"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT181397.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(18433180..18433191,18436768..18436881,
FT                   18444317..18444412,18447459..18447581,18465825..18466052,
FT                   18496046..18496144,18501895..18501947,18506861..18507026,
FT                   18522964..18523161,18524564..18524675,18528402..18528502,
FT                   18529689..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT181397.0
FT                   protein_id=mCP104319.0 isoform=CRA_b"
FT                   /protein_id="EDL38441.1"
FT                   LEAELQDLSNQLRNRY"
FT   assembly_gap    18434355..18434374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18437130..18437291
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    18462500..18462519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18468150..18468169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18490704..18490723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18562370..18562464
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    18573147..18573206
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    18591308..18591327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18592463..18592482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18609239..18609258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18610338..18610357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18617411..18617430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18628733..18628752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18638589..18638703
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    18642956..18643566
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    18649072..18649307
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    18655833..18656686
FT                   /estimated_length=854
FT                   /gap_type="unknown"
FT   gene            18661330..19050521
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /note="gene_id=mCG120941.1"
FT   mRNA            join(18661330..18662215,18663183..18663253,
FT                   18721474..18721765,18806995..18807164,18834919..18835086,
FT                   18881044..18881268,18882852..18883126,18906024..18906129,
FT                   18909477..18909548,18923624..18923746,18931032..18931199,
FT                   18933561..18933788,18936117..18936139,18939501..18939600,
FT                   18940085..18940183,18947185..18947310,18948452..18948577,
FT                   18949919..18950041,18953373..18953492,18968913..18969035,
FT                   18971733..18971855,18973761..18973883,18979725..18979847,
FT                   18985952..18986077,19007471..19007596,19011413..19011556,
FT                   19018018..19018197,19019443..19019529,19021241..19021369,
FT                   19022069..19022209,19023070..19023240,19043814..19043936,
FT                   19048182..19048331,19049124..19050521)
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, transcript variant mCT122131"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT122131.1
FT                   created on 03-SEP-2002"
FT   mRNA            join(18661330..18662215,18663183..18663253,
FT                   18664272..18664605)
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, transcript variant mCT170878"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT170878.0
FT                   created on 03-SEP-2002"
FT   CDS             join(18661740..18662215,18663183..18663253,
FT                   18721474..18721765,18806995..18807164,18834919..18835086,
FT                   18881044..18881268,18882852..18883126,18906024..18906129,
FT                   18909477..18909548,18923624..18923746,18931032..18931199,
FT                   18933561..18933788,18936117..18936139,18939501..18939600,
FT                   18940085..18940183,18947185..18947310,18948452..18948577,
FT                   18949919..18950041,18953373..18953492,18968913..18969035,
FT                   18971733..18971855,18973761..18973883,18979725..18979847,
FT                   18985952..18986077,19007471..19007596,19011413..19011556,
FT                   19018018..19018197,19019443..19019529,19021241..19021369,
FT                   19022069..19022209,19023070..19023240,19043814..19043936,
FT                   19048182..19048331,19049124..19049305)
FT                   /codon_start=1
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT122131.1
FT                   protein_id=mCP70792.1 isoform=CRA_b"
FT                   /protein_id="EDL38445.1"
FT                   TPLNSALNLDKESDLE"
FT   CDS             join(18661740..18662215,18663183..18663253,
FT                   18664272..18664297)
FT                   /codon_start=1
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT170878.0
FT                   protein_id=mCP93796.0 isoform=CRA_a"
FT                   /protein_id="EDL38444.1"
FT   assembly_gap    18676141..18676160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18718331..18718464
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    18739687..18739706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18743918..18744088
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    18763224..18763305
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    18769135..18769333
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    18779543..18780024
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    18792059..18792146
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    18827943..18828113
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    18829969..18830063
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    18832622..18832730
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    18844389..18845059
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    18852973..18853096
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    18876288..18876361
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    18902367..18902386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18956159..18956568
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    19013514..19013659
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    19016219..19016250
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    19061777..19063126
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    19081645..19081664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19087933..19182890
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /note="gene_id=mCG11038.2"
FT   mRNA            join(19087933..19088183,19143642..19143844,
FT                   19146032..19146134,19148267..19148329,19148825..19148956,
FT                   19150269..19150446,19152525..19152641,19154982..19155257,
FT                   19161587..19161664,19163810..19163926,19165924..19166039,
FT                   19168163..19168310,19178010..19178046,19178327..19178452,
FT                   19178752..19179113,19180704..19182890)
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, transcript
FT                   variant mCT11160"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT11160.2 created
FT                   on 18-SEP-2002"
FT   assembly_gap    19105556..19105575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(19117550..19117592,19140701..19140833,
FT                   19143642..19143844,19146032..19146134,19148267..19148329,
FT                   19148825..19148956,19150269..19150416,19151944..19152117,
FT                   19152525..19152641,19154982..19155257,19161587..19161664,
FT                   19163813..19163926,19165924..19166039,19168163..19168310,
FT                   19178010..19178046,19178327..19178452,19178752..19179113,
FT                   19180704..19182890)
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, transcript
FT                   variant mCT173269"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT173269.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(19143775..19143844,19146032..19146134,
FT                   19148267..19148329,19148825..19148956,19150269..19150446,
FT                   19152525..19152641,19154982..19155257,19161587..19161664,
FT                   19163810..19163926,19165924..19166039,19168163..19168310,
FT                   19178010..19178046,19178327..19178452,19178752..19179113,
FT                   19180704..19180712)
FT                   /codon_start=1
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT11160.2
FT                   protein_id=mCP20445.2 isoform=CRA_a"
FT                   /protein_id="EDL38446.1"
FT                   AKQGGEDG"
FT   CDS             join(19143775..19143844,19146032..19146134,
FT                   19148267..19148329,19148825..19148956,19150269..19150416,
FT                   19151944..19152117,19152525..19152641,19154982..19155257,
FT                   19161587..19161664,19163813..19163926,19165924..19166039,
FT                   19168163..19168310,19178010..19178046,19178327..19178452,
FT                   19178752..19179113,19180704..19180712)
FT                   /codon_start=1
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT173269.0
FT                   protein_id=mCP96188.0 isoform=CRA_b"
FT                   /protein_id="EDL38447.1"
FT   assembly_gap    19169241..19169260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19171461..19172473
FT                   /estimated_length=1013
FT                   /gap_type="unknown"
FT   gene            complement(19190954..19205533)
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /note="gene_id=mCG11040.1"
FT   mRNA            complement(join(19190954..19192723,19192809..19192976,
FT                   19193263..19193379,19193973..19194053,19195058..19195242,
FT                   19198610..19198744,19201473..19201621,19205395..19205533))
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, transcript variant
FT                   mCT11162"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT11162.2 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(19190955..19192976,19193263..19193379,
FT                   19193973..19194053,19195058..19195242,19198610..19198744,
FT                   19201473..19201621,19205395..>19205518))
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, transcript variant
FT                   mCT193680"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT193680.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(19192064..19192723,19192809..19192976,
FT                   19193263..19193379,19193973..19194053,19195058..19195242,
FT                   19198610..19198744,19201473..19201621,19205395..19205447))
FT                   /codon_start=1
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, isoform CRA_a"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT11162.2
FT                   protein_id=mCP20446.2 isoform=CRA_a"
FT                   /protein_id="EDL38448.1"
FT   CDS             complement(join(19192770..19192976,19193263..19193379,
FT                   19193973..19194053,19195058..19195242,19198610..19198744,
FT                   19201473..19201621,19205395..>19205507))
FT                   /codon_start=1
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, isoform CRA_b"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT193680.0
FT                   protein_id=mCP114625.0 isoform=CRA_b"
FT                   /protein_id="EDL38449.1"
FT   assembly_gap    19210156..19218456
FT                   /estimated_length=8301
FT                   /gap_type="unknown"
FT   assembly_gap    19227194..19227213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19253197..19253216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19257244..19258572
FT                   /estimated_length=1329
FT                   /gap_type="unknown"
FT   assembly_gap    19268657..19268858
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    19270183..19271072
FT                   /estimated_length=890
FT                   /gap_type="unknown"
FT   gene            19316644..19317630
FT                   /pseudo
FT                   /locus_tag="mCG_50080"
FT                   /note="gene_id=mCG50080.2"
FT   mRNA            19316644..19317630
FT                   /pseudo
FT                   /locus_tag="mCG_50080"
FT                   /note="gene_id=mCG50080.2 transcript_id=mCT50263.2 created
FT                   on 05-NOV-2002"
FT   assembly_gap    19328976..19331331
FT                   /estimated_length=2356
FT                   /gap_type="unknown"
FT   assembly_gap    19374913..19374932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19378076..19378095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19380643..19385012
FT                   /estimated_length=4370
FT                   /gap_type="unknown"
FT   assembly_gap    19389747..19389914
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    19407197..19407216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19429036..19429225
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    19441301..19441320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19471493..19471993
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    19473253..19473272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19476456..19476475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19478537..19479858
FT                   /estimated_length=1322
FT                   /gap_type="unknown"
FT   gene            19491612..19492092
FT                   /pseudo
FT                   /locus_tag="mCG_1039334"
FT                   /note="gene_id=mCG1039334.1"
FT   mRNA            19491612..19492092
FT                   /pseudo
FT                   /locus_tag="mCG_1039334"
FT                   /note="gene_id=mCG1039334.1 transcript_id=mCT157038.1
FT                   created on 05-NOV-2002"
FT   assembly_gap    19493219..19493295
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    19501448..19501467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19514147..19514252
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            19518908..19547007
FT                   /locus_tag="mCG_1039549"
FT                   /note="gene_id=mCG1039549.1"
FT   mRNA            join(19518908..19519205,19519397..19519498,
FT                   19535872..19535977,19544127..19544320,19546531..19547007)
FT                   /locus_tag="mCG_1039549"
FT                   /product="mCG1039549"
FT                   /note="gene_id=mCG1039549.1 transcript_id=mCT157253.1
FT                   created on 22-APR-2003"
FT   assembly_gap    19533629..19533786
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   CDS             join(19544242..19544320,19546531..19546700)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039549"
FT                   /product="mCG1039549"
FT                   /note="gene_id=mCG1039549.1 transcript_id=mCT157253.1
FT                   protein_id=mCP71316.1"
FT                   /protein_id="EDL38450.1"
FT   assembly_gap    19544734..19544756
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    19548867..19548886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19578163..19586009
FT                   /estimated_length=7847
FT                   /gap_type="unknown"
FT   assembly_gap    19605754..19605993
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    19607381..19607400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19608588..19608607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19615352..19615371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19655482..19658234
FT                   /estimated_length=2753
FT                   /gap_type="unknown"
FT   assembly_gap    19674338..19674357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19675941..19675960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19678631..19678650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19687081..19687447
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    19690234..19690253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19692176..19692195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19696455..19696474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19715066..19715085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19723631..19727788
FT                   /estimated_length=4158
FT                   /gap_type="unknown"
FT   assembly_gap    19739085..19739104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19752317..19752336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19779030..19779049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19792489..19792557
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    19794775..19794902
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    19827264..19827283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19833458..19833477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19836208..19836814
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   assembly_gap    19850462..19850481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19861089..19861302
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    19868617..19870280
FT                   /estimated_length=1664
FT                   /gap_type="unknown"
FT   assembly_gap    19888619..19888699
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    19898557..19898765
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(19937167..19937918)
FT                   /locus_tag="mCG_16218"
FT                   /note="gene_id=mCG16218.0"
FT   mRNA            complement(19937167..19937918)
FT                   /locus_tag="mCG_16218"
FT                   /product="mCG16218"
FT                   /note="gene_id=mCG16218.0 transcript_id=mCT16232.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(19937394..19937840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16218"
FT                   /product="mCG16218"
FT                   /note="gene_id=mCG16218.0 transcript_id=mCT16232.0
FT                   protein_id=mCP8447.1"
FT                   /protein_id="EDL38451.1"
FT   assembly_gap    20044888..20045379
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    20057117..20057136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20097717..20097736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20103489..20105327
FT                   /estimated_length=1839
FT                   /gap_type="unknown"
FT   assembly_gap    20180779..20180798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20214481..20214500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20231673..20231692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20236215..20236234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20248731..20248750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20252159..20252178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20261546..20261979
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    20264055..20264074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20308287..20308953
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    20315301..20315366
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    20353948..20354562
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    20368764..20368874
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    20372814..20373092
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    20405626..20405645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20440703..20440722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20479422..20479597
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    20504548..20504887
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    20505889..20506129
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    20510859..20510878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20531481..20531500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20536812..20542343
FT                   /estimated_length=5532
FT                   /gap_type="unknown"
FT   assembly_gap    20545526..20545545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20548027..20551542
FT                   /estimated_length=3516
FT                   /gap_type="unknown"
FT   assembly_gap    20555825..20555844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20572590..20572941
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   gene            complement(20587611..20588770)
FT                   /locus_tag="mCG_1050357"
FT                   /note="gene_id=mCG1050357.0"
FT   mRNA            complement(20587611..20588770)
FT                   /locus_tag="mCG_1050357"
FT                   /product="mCG1050357"
FT                   /note="gene_id=mCG1050357.0 transcript_id=mCT194363.0
FT                   created on 23-APR-2004"
FT   CDS             complement(20587799..20588314)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050357"
FT                   /product="mCG1050357"
FT                   /note="gene_id=mCG1050357.0 transcript_id=mCT194363.0
FT                   protein_id=mCP115392.0"
FT                   /protein_id="EDL38452.1"
FT                   MFIEKKTV"
FT   assembly_gap    20602112..20604327
FT                   /estimated_length=2216
FT                   /gap_type="unknown"
FT   assembly_gap    20607439..20607458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20608644..20608663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20609863..20609882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20611238..20611257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20612734..20612753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20617288..20618376
FT                   /estimated_length=1089
FT                   /gap_type="unknown"
FT   assembly_gap    20621744..20621763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20623624..20623643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20625364..20625383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20632963..20633839
FT                   /estimated_length=877
FT                   /gap_type="unknown"
FT   assembly_gap    20646921..20648155
FT                   /estimated_length=1235
FT                   /gap_type="unknown"
FT   assembly_gap    20649655..20649886
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    20654186..20654325
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    20674031..20674050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20679409..20679815
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    20737596..20737615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20739599..20739618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20740697..20740716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20741895..20741914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20742940..20742959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20744418..20744437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20755269..20755361
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    20758778..20758797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20790936..20790955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20802117..20802136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20803344..20803363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20853193..20853270
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    20855518..20855537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20888573..20888592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20902040..20902059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20908884..20908903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20912746..20912765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20929559..20931073
FT                   /estimated_length=1515
FT                   /gap_type="unknown"
FT   assembly_gap    20932210..20932229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20936239..20937375
FT                   /estimated_length=1137
FT                   /gap_type="unknown"
FT   assembly_gap    20939267..20939286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20941271..20941290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20959536..20959555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20995981..20996000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21014574..21015418)
FT                   /pseudo
FT                   /locus_tag="mCG_49156"
FT                   /note="gene_id=mCG49156.2"
FT   mRNA            complement(21014574..21015418)
FT                   /pseudo
FT                   /locus_tag="mCG_49156"
FT                   /note="gene_id=mCG49156.2 transcript_id=mCT49339.2 created
FT                   on 28-OCT-2002"
FT   assembly_gap    21030782..21030801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21065137..21065156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21092124..21092143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21112100..21112119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21114127..21114146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21115712..21115731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21119885..21119904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21120917..21120936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21122654..21122673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21129142..21129161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21170542..21170561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21179305..21179324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21198432..21198451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21201564..21201583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21206137..21206156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21207285..21207304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21209666..21209685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21211777..21211796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21212897..21212916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21214182..21214201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21255426..21255445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21263587..21263820
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    21269171..21269190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21293988..21294007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21301049..21301764
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    21313313..21314412
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   assembly_gap    21328931..21329186
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    21330351..21330370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21331525..21335195
FT                   /estimated_length=3671
FT                   /gap_type="unknown"
FT   assembly_gap    21336948..21336967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21344619..21344840
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    21359108..21359239
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    21373819..21373838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21388597..21388616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21390402..21390421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21396590..21396609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21398337..21398356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21401615..21401634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21406214..21407416
FT                   /estimated_length=1203
FT                   /gap_type="unknown"
FT   assembly_gap    21410048..21410776
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    21450009..21450028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21477808..21477837
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    21498446..21498465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21507029..21507048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21519230..21519249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21561420..21561549
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    21581079..21581384
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    21584337..21586571
FT                   /estimated_length=2235
FT                   /gap_type="unknown"
FT   assembly_gap    21638773..21639673
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    21659072..21661024
FT                   /estimated_length=1953
FT                   /gap_type="unknown"
FT   assembly_gap    21662241..21662260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21665877..21665896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21667555..21667574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21700624..21700643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21708675..21708694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21709697..21709716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21710719..21710738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21727372..21727391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21730362..21730381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21733339..21739377
FT                   /estimated_length=6039
FT                   /gap_type="unknown"
FT   assembly_gap    21742424..21742538
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    21749773..21749878
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    21750515..21750703
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            21772093..21772660
FT                   /pseudo
FT                   /locus_tag="mCG_57490"
FT                   /note="gene_id=mCG57490.2"
FT   mRNA            21772093..21772660
FT                   /pseudo
FT                   /locus_tag="mCG_57490"
FT                   /note="gene_id=mCG57490.2 transcript_id=mCT57673.2 created
FT                   on 05-NOV-2002"
FT   assembly_gap    21797382..21797401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21839658..21839837
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            complement(21840588..21841151)
FT                   /pseudo
FT                   /locus_tag="mCG_2763"
FT                   /note="gene_id=mCG2763.2"
FT   mRNA            complement(21840588..21841151)
FT                   /pseudo
FT                   /locus_tag="mCG_2763"
FT                   /note="gene_id=mCG2763.2 transcript_id=mCT1968.2 created on
FT                   05-NOV-2002"
FT   assembly_gap    21850092..21850506
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    21863279..21863298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <21863373..22039722
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /note="gene_id=mCG140969.0"
FT   mRNA            join(<21863373..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010297..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035838..22035905,22037214..22039722)
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), transcript variant mCT172470"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT172470.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<21863374..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010297..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035838..22035905,22037214..22037369)
FT                   /codon_start=1
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), isoform CRA_a"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT172470.0
FT                   protein_id=mCP95389.0 isoform=CRA_a"
FT                   /protein_id="EDL38453.1"
FT   mRNA            join(<21863926..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010261..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035715..22035905,22037193..22038276)
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), transcript variant mCT193662"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT193662.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<21863926..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010261..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035715..22035905,22037193..22037369)
FT                   /codon_start=1
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), isoform CRA_b"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT193662.0
FT                   protein_id=mCP114642.0 isoform=CRA_b"
FT                   /protein_id="EDL38454.1"
FT   assembly_gap    21865753..21866072
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    21909474..21909493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21916881..21916900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21944573..21944727
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    21965799..21965872
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    21980211..21980230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21990647..21990666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22041018..>22081236)
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /note="gene_id=mCG2768.2"
FT   mRNA            complement(join(22041018..22041568,22047845..22047920,
FT                   22063753..22064021,22065854..22065995,22067842..22067958,
FT                   22075978..22076086,22080974..>22081199))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT193693"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193693.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(22041022..22041884,22044720..22044785,
FT                   22047845..22047920,22050090..22050170,22063753..22064021,
FT                   22065854..22065995,22067842..22067958,22075978..22076086,
FT                   22080974..>22081227))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT1961"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT1961.2 created on
FT                   19-SEP-2002"
FT   mRNA            complement(join(22041027..22041884,22044720..22044785,
FT                   22047845..22047920,22063753..22064021,22065854..22065995,
FT                   22067842..22067958,22075978..22076086,22080974..>22081236))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT193694"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193694.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(22041537..22041568,22047845..22047920,
FT                   22063753..22064021,22065854..22065995,22067842..22067958,
FT                   22075978..22076086,22080974..>22081197))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_a"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193693.0
FT                   protein_id=mCP114658.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR011680"
FT                   /db_xref="InterPro:IPR015641"
FT                   /db_xref="MGI:MGI:2675856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P395"
FT                   /protein_id="EDL38455.1"
FT   CDS             complement(join(22041868..22041884,22044720..22044785,
FT                   22047845..22047920,22063753..22064021,22065854..22065995,
FT                   22067842..22067958,22075978..22076086,22080974..>22081236))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_b"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193694.0
FT                   protein_id=mCP114659.0 isoform=CRA_b"
FT                   /protein_id="EDL38456.1"
FT                   LTDYILKVLCPT"
FT   CDS             complement(join(22041868..22041884,22044720..22044785,
FT                   22047845..22047920,22050090..22050170,22063753..22064021,
FT                   22065854..22065995,22067842..22067958,22075978..22076086,
FT                   22080974..>22081227))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_c"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT1961.2
FT                   protein_id=mCP2872.2 isoform=CRA_c"
FT                   /protein_id="EDL38457.1"
FT   assembly_gap    22044337..22044356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22076635..22076679
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    22081738..22081757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22082782..22082801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22137335..22139148
FT                   /estimated_length=1814
FT                   /gap_type="unknown"
FT   assembly_gap    22149842..22149861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22151227..22151246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22156428..22159013
FT                   /locus_tag="mCG_128529"
FT                   /note="gene_id=mCG128529.1"
FT   mRNA            join(22156428..22156550,22157158..22159013)
FT                   /locus_tag="mCG_128529"
FT                   /product="mCG128529"
FT                   /note="gene_id=mCG128529.1 transcript_id=mCT129825.1
FT                   created on 22-APR-2003"
FT   CDS             join(22156445..22156550,22157158..22158500)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128529"
FT                   /product="mCG128529"
FT                   /note="gene_id=mCG128529.1 transcript_id=mCT129825.1
FT                   protein_id=mCP70835.1"
FT                   /db_xref="GOA:D3YYI8"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="MGI:MGI:3704479"
FT                   /db_xref="UniProtKB/TrEMBL:D3YYI8"
FT                   /protein_id="EDL38458.1"
FT   assembly_gap    22157130..22157149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22164852..22164962
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    22172392..22172411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22173510..22173572
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            <22173573..22295879
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /note="gene_id=mCG128538.2"
FT   mRNA            join(<22173573..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293335,22295233..22295879)
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, transcript variant mCT193690"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT193690.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(22173573..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293334,22295233..22295879)
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, transcript variant mCT129836"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT129836.1
FT                   created on 30-AUG-2002"
FT   CDS             join(<22173694..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293335,22295233..22295339)
FT                   /codon_start=1
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, isoform CRA_b"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT193690.0
FT                   protein_id=mCP114638.0 isoform=CRA_b"
FT                   /protein_id="EDL38460.1"
FT                   PFLLCGRF"
FT   assembly_gap    22184189..22184208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22187357..22187376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22190480..22190499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(22203109..22203160,22213752..22213817,
FT                   22234570..22234726,22242458..22242591,22247594..22247671,
FT                   22255175..22255360,22268080..22268124,22269937..22269999,
FT                   22273552..22273699,22287608..22287711,22290704..22290930,
FT                   22292822..22293334,22295233..22295412)
FT                   /codon_start=1
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, isoform CRA_a"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT129836.1
FT                   protein_id=mCP71119.1 isoform=CRA_a"
FT                   /protein_id="EDL38459.1"
FT                   IIQNICTEFNSQPRN"
FT   assembly_gap    22206535..22206554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22215295..22215314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22228849..22233758
FT                   /estimated_length=4910
FT                   /gap_type="unknown"
FT   assembly_gap    22238196..22238443
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    22240564..22240710
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    22241859..22242148
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    22250548..22251239
FT                   /estimated_length=692
FT                   /gap_type="unknown"
FT   assembly_gap    22263556..22263575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22266236..22266255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22268934..22268953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22277895..22277914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22293856..22294215
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   gene            complement(22318373..22320556)
FT                   /locus_tag="mCG_148337"
FT                   /note="gene_id=mCG148337.0"
FT   mRNA            complement(join(22318373..22319517,22319547..22320556))
FT                   /locus_tag="mCG_148337"
FT                   /product="mCG148337"
FT                   /note="gene_id=mCG148337.0 transcript_id=mCT188600.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22318711..22318860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148337"
FT                   /product="mCG148337"
FT                   /note="gene_id=mCG148337.0 transcript_id=mCT188600.0
FT                   protein_id=mCP108817.0"
FT                   /protein_id="EDL38461.1"
FT                   QCLF"
FT   assembly_gap    22321460..22321479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22323601..>22415666)
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /note="gene_id=mCG2766.2"
FT   mRNA            complement(join(22323601..22324066,22324156..22324242,
FT                   22326039..22326146,22336162..22336302,22338324..22338491,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT1959"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT1959.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(22323638..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22331406..22331453,22332964..22333139,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT170902"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170902.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(22323638..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT170901"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170901.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22323897..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22331406..22331453,22332964..22333139,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170902.0
FT                   protein_id=mCP93820.0 isoform=CRA_a"
FT                   /protein_id="EDL38462.1"
FT   CDS             complement(join(22323897..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170901.0
FT                   protein_id=mCP93819.0 isoform=CRA_b"
FT                   /protein_id="EDL38463.1"
FT   assembly_gap    22325098..22325117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22326488..22326507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22335363..22335382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(22338362..22338491,22342196..22342243,
FT                   22343771..22343946,22346310..22346446,22348932..22349075,
FT                   22351788..22351898,22356490..22356625,22362027..22362162,
FT                   22363429..22363596,22366791..22366869,22371562..22371635,
FT                   22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT1959.2
FT                   protein_id=mCP2888.2 isoform=CRA_c"
FT                   /protein_id="EDL38464.1"
FT   assembly_gap    22339875..22341109
FT                   /estimated_length=1235
FT                   /gap_type="unknown"
FT   assembly_gap    22342503..22342594
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    22343631..22343689
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    22345014..22345033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22396267..22396286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22418934..22419735
FT                   /estimated_length=802
FT                   /gap_type="unknown"
FT   assembly_gap    22426984..22427303
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   gene            complement(22428119..22429889)
FT                   /locus_tag="mCG_2767"
FT                   /note="gene_id=mCG2767.1"
FT   mRNA            complement(22428119..22429889)
FT                   /locus_tag="mCG_2767"
FT                   /product="mCG2767"
FT                   /note="gene_id=mCG2767.1 transcript_id=mCT1960.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(22429426..22429734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2767"
FT                   /product="mCG2767"
FT                   /note="gene_id=mCG2767.1 transcript_id=mCT1960.1
FT                   protein_id=mCP2894.2"
FT                   /db_xref="InterPro:IPR013544"
FT                   /db_xref="MGI:MGI:2444098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8A9"
FT                   /protein_id="EDL38465.1"
FT   gene            complement(22431955..22513178)
FT                   /locus_tag="mCG_1040528"
FT                   /note="gene_id=mCG1040528.1"
FT   mRNA            complement(join(22431955..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22453537..22453671,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22513119..22513178))
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, transcript variant mCT129835"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT129835.1
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(22431955..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22452867..22453046,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22512697..>22512822))
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, transcript variant mCT161026"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT161026.2
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(22432128..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22452867..22453046,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22512697..>22512821))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, isoform CRA_b"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT161026.2
FT                   protein_id=mCP90021.2 isoform=CRA_b"
FT                   /protein_id="EDL38467.1"
FT   CDS             complement(join(22432128..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22453537..22453671,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, isoform CRA_a"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT129835.1
FT                   protein_id=mCP70774.1 isoform=CRA_a"
FT                   /protein_id="EDL38466.1"
FT   assembly_gap    22444300..22445476
FT                   /estimated_length=1177
FT                   /gap_type="unknown"
FT   assembly_gap    22453112..22453131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22454974..22463091
FT                   /estimated_length=8118
FT                   /gap_type="unknown"
FT   assembly_gap    22464685..22464704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22467763..22467898
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    22494491..22494510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22499849..22499930
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            22513397..22523634
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /note="gene_id=mCG2760.2"
FT   mRNA            join(22513397..22513491,22514612..22514738,
FT                   22515663..22515734,22516820..22517046,22517891..22517932,
FT                   22518778..22518898,22519034..22519124,22519928..22520044,
FT                   22521634..22521715,22522960..22523634)
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /product="RIKEN cDNA 2310002B06"
FT                   /note="gene_id=mCG2760.2 transcript_id=mCT1965.2 created on
FT                   30-AUG-2002"
FT   CDS             join(22515676..22515734,22516820..22517046,
FT                   22517891..22517932,22518778..22518898,22519034..22519124,
FT                   22519928..22520044,22521634..22521715,22522960..22523015)
FT                   /codon_start=1
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /product="RIKEN cDNA 2310002B06"
FT                   /note="gene_id=mCG2760.2 transcript_id=mCT1965.2
FT                   protein_id=mCP2896.2"
FT                   /db_xref="GOA:A0A0R4J215"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="MGI:MGI:1858435"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J215"
FT                   /protein_id="EDL38468.1"
FT   gene            complement(22528295..22530069)
FT                   /pseudo
FT                   /locus_tag="mCG_2756"
FT                   /note="gene_id=mCG2756.2"
FT   mRNA            complement(22528295..22530069)
FT                   /pseudo
FT                   /locus_tag="mCG_2756"
FT                   /note="gene_id=mCG2756.2 transcript_id=mCT1962.2 created on
FT                   14-OCT-2002"
FT   gene            complement(22531578..22562053)
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /note="gene_id=mCG2769.2"
FT   mRNA            complement(join(22531578..22533096,22533178..22533234,
FT                   22534402..22534503,22536336..22536467,22541679..22541859,
FT                   22543133..22543252,22544147..22544269,22546588..22546638,
FT                   22547308..22547342,22548319..22548367,22548486..22548565,
FT                   22548982..22549102,22551754..22551890,22553577..22553697,
FT                   22555520..22555651,22561911..22562053))
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /product="eukaryotic translation initiation factor 2-alpha
FT                   kinase 2"
FT                   /note="gene_id=mCG2769.2 transcript_id=mCT1952.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(22532974..22533096,22533178..22533234,
FT                   22534402..22534503,22536336..22536467,22541679..22541859,
FT                   22543133..22543252,22544147..22544269,22546588..22546638,
FT                   22547308..22547342,22548319..22548367,22548486..22548565,
FT                   22548982..22549102,22551754..22551890,22553577..22553697,
FT                   22555520..22555635))
FT                   /codon_start=1
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /product="eukaryotic translation initiation factor 2-alpha
FT                   kinase 2"
FT                   /note="gene_id=mCG2769.2 transcript_id=mCT1952.2
FT                   protein_id=mCP2895.1"
FT                   /db_xref="GOA:Q91YN2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033366"
FT                   /db_xref="MGI:MGI:1353449"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YN2"
FT                   /protein_id="EDL38469.1"
FT   assembly_gap    22547911..22548102
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    22553475..22553494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22557473..22557492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22558863..22558882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22561152..22561171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22564330..22574615)
FT                   /locus_tag="mCG_60634"
FT                   /note="gene_id=mCG60634.3"
FT   mRNA            complement(join(22564330..22564724,22568441..22568597,
FT                   22570359..22570453,22574057..22574183,22574550..22574615))
FT                   /locus_tag="mCG_60634"
FT                   /product="mCG60634"
FT                   /note="gene_id=mCG60634.3 transcript_id=mCT172488.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(22564594..22564724,22568441..22568498))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60634"
FT                   /product="mCG60634"
FT                   /note="gene_id=mCG60634.3 transcript_id=mCT172488.0
FT                   protein_id=mCP95407.0"
FT                   /protein_id="EDL38470.1"
FT                   AGTSLGDKLKYEAYCLA"
FT   gene            <22595947..22599765
FT                   /locus_tag="mCG_146121"
FT                   /note="gene_id=mCG146121.0"
FT   mRNA            join(<22595947..22595972,22597822..22597937,
FT                   22598521..22598565,22599224..22599308,22599442..22599765)
FT                   /locus_tag="mCG_146121"
FT                   /product="mCG146121"
FT                   /note="gene_id=mCG146121.0 transcript_id=mCT186224.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<22595947..22595972,22597822..22597937,
FT                   22598521..22598565,22599224..22599306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146121"
FT                   /product="mCG146121"
FT                   /note="gene_id=mCG146121.0 transcript_id=mCT186224.0
FT                   protein_id=mCP107777.0"
FT                   /protein_id="EDL38471.1"
FT   gene            complement(22598471..>22618811)
FT                   /locus_tag="mCG_12062"
FT                   /note="gene_id=mCG12062.2"
FT   mRNA            complement(join(22598471..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616636..22617842,22618645..>22618811))
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, transcript variant mCT15066"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT15066.1 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(22599213..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616350..22617842,22618645..22618811))
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, transcript variant mCT170876"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT170876.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22599346..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616350..22617842,22618645..22618800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, isoform CRA_a"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT170876.0
FT                   protein_id=mCP93794.0 isoform=CRA_a"
FT                   /protein_id="EDL38472.1"
FT                   RQRK"
FT   CDS             complement(join(22614145..22614167,22616636..22617842,
FT                   22618645..>22618809))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, isoform CRA_b"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT15066.1
FT                   protein_id=mCP2882.1 isoform=CRA_b"
FT                   /protein_id="EDL38473.1"
FT                   RCWIQA"
FT   gene            <22618905..22629933
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /note="gene_id=mCG12058.3"
FT   mRNA            join(<22618905..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22629933)
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, transcript variant
FT                   mCT193658"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT193658.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<22618905..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628418)
FT                   /codon_start=1
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, isoform CRA_a"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT193658.0
FT                   protein_id=mCP114633.0 isoform=CRA_a"
FT                   /protein_id="EDL38474.1"
FT   mRNA            join(<22618906..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628361,22628769..22629384)
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, transcript variant
FT                   mCT12070"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT12070.1 created
FT                   on 30-AUG-2002"
FT   CDS             join(<22618908..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628361,22628769..22628984)
FT                   /codon_start=1
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, isoform CRA_b"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT12070.1
FT                   protein_id=mCP2879.1 isoform=CRA_b"
FT                   /protein_id="EDL38475.1"
FT   assembly_gap    22627753..22627772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22633520..22695146)
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /note="gene_id=mCG12054.3"
FT   mRNA            complement(join(22633520..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657484,
FT                   22663570..22663727,22665324..22665455,22667013..22667151,
FT                   22689854..>22690099))
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, transcript variant
FT                   mCT193655"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT193655.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657461,
FT                   22663553..22663727,22665324..22665455,22667013..22667151,
FT                   22694231..22695146))
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, transcript variant
FT                   mCT170870"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT170870.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657461,
FT                   22663553..22663727,22665324..22665455,22667013..22667151,
FT                   22694231..22694518))
FT                   /codon_start=1
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, isoform CRA_b"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT170870.0
FT                   protein_id=mCP93788.0 isoform=CRA_b"
FT                   /protein_id="EDL38477.1"
FT                   PKHFIMAPNPDDMEEDP"
FT   CDS             complement(join(22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657484,
FT                   22663570..22663727,22665324..22665455,22667013..22667151,
FT                   22689854..>22689913))
FT                   /codon_start=1
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, isoform CRA_c"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT193655.0
FT                   protein_id=mCP114631.0 isoform=CRA_c"
FT                   /protein_id="EDL38478.1"