spacer

EBI Dbfetch

ID   CH466537; SV 1; linear; genomic DNA; CON; MUS; 38648868 BP.
XX
AC   CH466537;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009836019 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-38648868
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-38648868
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; c835dbb7ce67de85876f3e3ba5c83175.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000225.
DR   Ensembl-Gn; ENSMUSG00000002379; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002658; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019489; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024151; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024164; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024256; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034116; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049672; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061062; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091636; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002733; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005889; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024761; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067931; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172466; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177425; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..38648868
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<1247..>7910)
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /note="gene_id=mCG22968.1"
FT   mRNA            complement(join(<1247..1332,1485..1683,2831..2913,
FT                   7770..>7910))
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   transcript variant mCT22627"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT22627.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<1247..1332,1485..1683,2831..2913,
FT                   7770..>7908))
FT                   /codon_start=1
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT22627.1
FT                   protein_id=mCP9055.1 isoform=CRA_a"
FT                   /protein_id="EDL38158.1"
FT                   /translation="SHQAACRVDPRAQRSKGPRRPAACLSQDLEWPGNGGQNVVARERN
FT                   AATAAETMSSNGTDAPAEAQAAMEEPVVQPSVVDRVAGLPLISSTYGMVSAAYTSTKEN
FT                   YPHVRTVCDVAEKGVKTLTTAAVSTAQPILSKLEPQIATASEYAHRGLDRLQESLPILQ
FT                   QPTEKV"
FT   mRNA            complement(join(<1248..1332,1485..1683,2831..2913,
FT                   5491..>5549))
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   transcript variant mCT170638"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT170638.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<1248..1332,1485..1683,2831..2913,
FT                   5491..>5548))
FT                   /codon_start=1
FT                   /gene="M6prbp1"
FT                   /locus_tag="mCG_22968"
FT                   /product="mannose-6-phosphate receptor binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22968.1 transcript_id=mCT170638.0
FT                   protein_id=mCP93556.0 isoform=CRA_b"
FT                   /protein_id="EDL38159.1"
FT                   /translation="RSKLDLVGEVSSLGRPEDFATAAETMSSNGTDAPAEAQAAMEEPV
FT                   VQPSVVDRVAGLPLISSTYGMVSAAYTSTKENYPHVRTVCDVAEKGVKTLTTAAVSTAQ
FT                   PILSKLEPQIATASEYAHRGLDRLQESLPILQQPTEKV"
FT   gene            complement(9147..>15280)
FT                   /locus_tag="mCG_22963"
FT                   /note="gene_id=mCG22963.1"
FT   mRNA            complement(join(9147..9701,12864..13069,15028..>15280))
FT                   /locus_tag="mCG_22963"
FT                   /product="mCG22963"
FT                   /note="gene_id=mCG22963.1 transcript_id=mCT22623.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(9183..9701,12864..13069,15028..15280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22963"
FT                   /product="mCG22963"
FT                   /note="gene_id=mCG22963.1 transcript_id=mCT22623.1
FT                   protein_id=mCP9071.0"
FT                   /protein_id="EDL38160.1"
FT                   /translation="MSVVKSIEVVLPQDAVYLAGSIIDGQVVLTLNSTLVDPVVKVELV
FT                   GRGYVEWNEEIGETRDYSRDVICNNKADYVHKTKTFPIKDNWLRAGSHTFDFHFNLPPR
FT                   LPSTFNSKIGHISYFVQALCLDREHILAKKKLYLLVQGISEFRQRNLSENSVSVEAEKK
FT                   VSYNCCSQGWVSLHVQMSKNTYVPGEKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFT
FT                   PSAERRRRADSSELLRQMANARIPAFNSTTVVSAFNLPLVLSVSSGSQENEIMRTSYEL
FT                   VVTIHLPWSLSTVKARLPIIITSTREGQADCPRLDELPYEDHMV"
FT   gene            <18463..>33421
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /note="gene_id=mCG22967.1"
FT   mRNA            join(<18463..18598,20123..20287,24374..24616,25713..25873,
FT                   27091..27306,27901..28004,28078..28288,30229..30352,
FT                   30436..30543,30814..30918,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT15422"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT15422.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(<18479..18598,20123..20287,24374..24616,25713..25873,
FT                   27091..27306,27901..28004,28078..28288,30229..30352,
FT                   30436..30543,30814..30918,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_a"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT15422.1
FT                   protein_id=mCP9087.1 isoform=CRA_a"
FT                   /protein_id="EDL38161.1"
FT                   /translation="CSLGSSATHAAPFWVTQPQSPSLEPGVPRERRVRIAAVREYIGIM
FT                   WIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFD
FT                   YDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADD
FT                   KTVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDI
FT                   MYHVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDV
FT                   EICRKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPA
FT                   LRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLT
FT                   SVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTE
FT                   CTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYED
FT                   DVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWR
FT                   QGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEP
FT                   EPWTREGKDRTRQLGLTMQ"
FT   mRNA            join(<19375..19430,20123..20287,24374..>24611)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT170637"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170637.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<19377..19430,20123..20287,24374..>24611)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_c"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170637.0
FT                   protein_id=mCP93554.0 isoform=CRA_c"
FT                   /protein_id="EDL38163.1"
FT                   /translation="QGLCPEGKLGQPAVGGVQYIGIMWIQVRTMDGKETHTVNSLSRLT
FT                   KVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFDYDVRLNDTIQLLVRQSLALPLS
FT                   TKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGL"
FT   mRNA            join(<19405..19430,20123..20136,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, transcript variant mCT170636"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170636.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<19406..19430,20123..20136,32041..32147,33028..33187,
FT                   33284..>33421)
FT                   /codon_start=1
FT                   /gene="Uhrf1"
FT                   /locus_tag="mCG_22967"
FT                   /product="ubiquitin-like, containing PHD and RING finger
FT                   domains, 1, isoform CRA_b"
FT                   /note="gene_id=mCG22967.1 transcript_id=mCT170636.0
FT                   protein_id=mCP93555.0 isoform=CRA_b"
FT                   /protein_id="EDL38162.1"
FT                   /translation="AASCGWGSVHRHHDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLT
FT                   NNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVV
FT                   KYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQ"
FT   gene            58608..109808
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /note="gene_id=mCG22918.1"
FT   mRNA            join(58608..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101708..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106793,106888..107007,108162..108254,
FT                   108485..109808)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT22620"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT22620.2 created
FT                   on 09-AUG-2002"
FT   mRNA            join(<58609..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101729..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106739,108162..108254,108485..109798)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT193699"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT193699.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<58618..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101729..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106739,108162..108254,108485..108667)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_b"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT193699.0
FT                   protein_id=mCP114656.0 isoform=CRA_b"
FT                   /protein_id="EDL38165.1"
FT                   /translation="LHFAATMGSEDHSAQNPSCKIMTFRPTMDEFRDFNRYVAYIESQG
FT                   AHRAGLAKIIPPKEWKPRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEY
FT                   RRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGSLYDDDVAQWNIGNLRTI
FT                   LDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEH
FT                   GKRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYG
FT                   YHAGFNHGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDVFVRILQPERYEQWK
FT                   QGRDLTVLDHTRPTALSSPELSSWSASRTSIKAKLLRRQISVKESRPWRKAEEERRREP
FT                   TRRPGPASHRRRSQPKKSKPEESRSPGEATAGVSTLDEARGCSRGEAMPEDEEEEELLP
FT                   SQGHEAEGVEEDGRGKPRPTKARNKKKTPSPSSPPLLSAPPALFPTEEVLRPPPQPKSP
FT                   GPAMGPMAAEGGPPPTPLNVVPPGAPVEEAEVRPRPIIPMLYVLPRTSSTDGDREHSAH
FT                   AQLAPMELGPEEENQAQAGDSQLKVEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEAFL
FT                   FSGEDDVTDPEALRSLLSLQWKNKAASFQAERKFNAAAALSEPYCAICTLFYPYSQSVQ
FT                   TERDSAVQPPSKSGQRTRPLIPEMCFTSSGENTEPLPANSYVGEDGTSPLISCAHCCLQ
FT                   VHASCYGVRPELAKEGWTCSRCAAHAWTAECCLCNLRGGALQRTTEHRWIHVICAIAVP
FT                   EVRFLNVIERNPVDVSAIPEQRWKLKCIYCRKRMKRVSGACIQCSYEHCSTSFHVTCAH
FT                   AAGVLMEPDDWPYVVSITCLKHRASGAGGQLLRTVSLGQIVITKNRNGLYYRCRVIGTT
FT                   AQTFYEVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGTPQEPSFSGDDVKAAKR
FT                   PRVASVLATTTEDTGRSPEYLSFMESLLQAQGRPGAPF"
FT   CDS             join(58636..58776,59955..60130,60504..60618,62842..63035,
FT                   76102..76151,79403..79506,82833..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..101045,101708..101828,
FT                   103143..103321,103436..103631,103841..103917,
FT                   104062..104117,104241..104349,106320..106505,
FT                   106629..106793,106888..107007,108162..108254,
FT                   108485..108667)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_c"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT22620.2
FT                   protein_id=mCP9075.2 isoform=CRA_c"
FT                   /protein_id="EDL38166.1"
FT                   /translation="MGSEDHSAQNPSCKIMTFRPTMDEFRDFNRYVAYIESQGAHRAGL
FT                   AKIIPPKEWKPRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANS
FT                   EKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGSLYDDDVAQWNIGNLRTILDMVER
FT                   ECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLER
FT                   LAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFN
FT                   HGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDVFVRILQPERYEQWKQGRDLT
FT                   VLDHTRPTALSSPELSSWSASRTSIKAKLLRRQISVKESRPWRKAEEERRREPTRRPGP
FT                   ASHRRRSQPKKSKPEESRSPGEATAGVSTLDEARGCSRGEAMPEDEEEEELLPSQGHEA
FT                   EGVEEDGRGKPRPTKARNKKKTPSPSSPPLLSAPPALFPTEEVLRPPPQPKSPGPAMGP
FT                   MAAEGGPPPTPLNVVPPGAPVEEAEVRPRPIIPMLYVLPRTSSTDGDREHSAHAQLAPM
FT                   ELGPEEENQAQAGDSQGTTPFSKLKVEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEAF
FT                   LFSGEDDVTDPEALRSLLSLQWKNKAASFQAERKFNAAAALSEPYCAICTLFYPYSQSV
FT                   QTERDSAVQPPSKSGQRTRPLIPEMCFTSSGENTEPLPANSYVGEDGTSPLISCAHCCL
FT                   QVHASCYGVRPELAKEGWTCSRCAAHAWTAECCLCNLRGGALQRTTEHRWIHVICAIAV
FT                   PEVRFLNVIERNPVDVSAIPEQRWKLKCIYCRKRMKRVSGACIQCSYEHCSTSFHVTCA
FT                   HAAGVLMEPDDWPYVVSITCLKHRASGAGGQLLRTVSLGQIVITKNRNGLYYRCRVIGT
FT                   TAQTFYEVNFDDGSYSDNLYPESITSRDCLRLGPPPEGELVELRWTDGNLYRARFISMA
FT                   TSLIYQVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGTPQEPSFSGDDVKAAKR
FT                   PRVASVLATTTEDTGRSPEYLSFMESLLQAQGRPGAPF"
FT   mRNA            join(58698..58776,59955..60005,82950..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..>100727)
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, transcript variant
FT                   mCT171417"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT171417.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(58699..58776,59955..60005,82950..82970,93022..93218,
FT                   96198..96281,96424..96611,100657..>100727)
FT                   /codon_start=1
FT                   /gene="Jmjd2b"
FT                   /locus_tag="mCG_22918"
FT                   /product="jumonji domain containing 2B, isoform CRA_a"
FT                   /note="gene_id=mCG22918.1 transcript_id=mCT171417.0
FT                   protein_id=mCP94336.0 isoform=CRA_a"
FT                   /protein_id="EDL38164.1"
FT                   /translation="MDEFRDFNRYVAYIESQGAHRAGLAKIIPPKEWKPRQTYDDIDYG
FT                   KVATQCTCRKDMVKISMDVFVRILQPERYEQWKQGRDLTVLDHTRPTALSSPELSSWSA
FT                   SRTSIKAKLLRRQISVKESRPWRKAEEERRREPTRRPGPASHRRRSQPKKSKPEESRSP
FT                   GEATAGVSTLDEARGCSRGEAMPEDEEEEELLPSQGHEAEGVEEDGRGKPRPTKARNKK
FT                   KTPSPSSP"
FT   gene            complement(119361..183398)
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /note="gene_id=mCG22917.2"
FT   mRNA            complement(join(119361..120332,120668..120803,
FT                   120890..121044,121622..121747,121824..121950,
FT                   123820..123998,124165..124450,124530..124684,
FT                   125650..125769,125849..126024,126343..126466,
FT                   126562..126659,128179..128291,128772..128783,
FT                   129068..129225,130122..130337,130433..130526,
FT                   130964..131217,131819..131916,132266..132865,
FT                   133326..133443,134878..135071,135791..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165399,
FT                   183369..183398))
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   transcript variant mCT22619"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT22619.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(120264..120332,120668..120803,
FT                   120890..121044,121622..121747,121824..121950,
FT                   123820..123998,124165..124450,124530..124684,
FT                   125650..125769,125849..126024,126343..126466,
FT                   126562..126659,128179..128291,128772..128783,
FT                   129068..129225,130122..130337,130433..130526,
FT                   130964..131217,131819..131916,132266..132865,
FT                   133326..133443,134878..135071,135791..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165304))
FT                   /codon_start=1
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT22619.2
FT                   protein_id=mCP9091.2 isoform=CRA_b"
FT                   /protein_id="EDL38168.1"
FT                   /translation="MAPTWSPSVVSVVGPVGLFLVLLARGCLAEEPPRFIREPKDQIGV
FT                   SGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENV
FT                   YECVAQNSVGEITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPD
FT                   PEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPAN
FT                   LYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVG
FT                   RNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWD
FT                   SGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGP
FT                   PSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHP
FT                   VGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMN
FT                   LRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVEDLKPNTE
FT                   YAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHN
FT                   GALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPE
FT                   SSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGA
FT                   EARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLG
FT                   RPTLSVQQTPEGSLLARWEPPADAAEDPVLGYRLQFGREDAAPATLELAAWERRFAAPA
FT                   HKGATYVFRLAARGRAGLGEEAAAALSIPEDAPRGFPQILGAAGNVSAGSVLLRWLPPV
FT                   PAERNGAIIKYTVSVREAGAPGPATETELAAAAQPGAETALTLRGLRPETAYELRVRAH
FT                   TRRGPGPFSPPLRYRLARDPVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGL
FT                   TLDVDGRTTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTARTAFNMLSGKPSVAPKP
FT                   DNDGFIVVYLPDGQSPVTVQNYFIVMVPLRKSRGGQFPVLLGSPEDMDLEELIQDISRL
FT                   QRRSLRHSRQLEVPRPYIAARFSILPAVFHPGNQKQYGGFDNRGLEPGHRYVLFVLAVL
FT                   QKNEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNK
FT                   PDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMER
FT                   LKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMG
FT                   SDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCD
FT                   QYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVP
FT                   EYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGH
FT                   VTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTG
FT                   MELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINA
FT                   SFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAE
FT                   RSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGF
FT                   IDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVL
FT                   RTQRPAMVQTEDEYQFCFQAALEYLGSFDHYAT"
FT   mRNA            complement(join(129176..129225,130122..130337,
FT                   130433..130526,130964..131217,131819..131916,
FT                   136038..136096,141472..141616,141900..142033,
FT                   142629..143210,144806..145075,154382..154492,
FT                   158674..158862,161209..161350,161896..162041,
FT                   165214..165399,183369..183398))
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   transcript variant mCT171416"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT171416.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(131893..131916,136038..136096,
FT                   141472..141616,141900..142033,142629..143210,
FT                   144806..145075,154382..154492,158674..158862,
FT                   161209..161350,161896..162041,165214..165304))
FT                   /codon_start=1
FT                   /gene="Ptprs"
FT                   /locus_tag="mCG_22917"
FT                   /product="protein tyrosine phosphatase, receptor type, S,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22917.2 transcript_id=mCT171416.0
FT                   protein_id=mCP94335.0 isoform=CRA_a"
FT                   /protein_id="EDL38167.1"
FT                   /translation="MAPTWSPSVVSVVGPVGLFLVLLARGCLAEEPPRFIREPKDQIGV
FT                   SGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENV
FT                   YECVAQNSVGEITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPD
FT                   PEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPAN
FT                   LYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVG
FT                   RNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWD
FT                   SGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGP
FT                   PSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHP
FT                   VGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMN
FT                   LRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVEDLKPNTE
FT                   YAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSLRSTAILSPQRTSR"
FT   gene            <215319..215828
FT                   /locus_tag="mCG_1039422"
FT                   /note="gene_id=mCG1039422.1"
FT   mRNA            join(<215319..215442,215799..215828)
FT                   /locus_tag="mCG_1039422"
FT                   /product="mCG1039422"
FT                   /note="gene_id=mCG1039422.1 transcript_id=mCT157126.1
FT                   created on 09-AUG-2002"
FT   CDS             <215320..215397
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039422"
FT                   /product="mCG1039422"
FT                   /note="gene_id=mCG1039422.1 transcript_id=mCT157126.1
FT                   protein_id=mCP71357.1"
FT                   /protein_id="EDL38169.1"
FT                   /translation="FPIVKNTGANRSGGQARLSERLSLL"
FT   gene            complement(218019..>219260)
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /note="gene_id=mCG22916.1"
FT   mRNA            complement(218019..>219260)
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /product="zinc and ring finger 4"
FT                   /note="gene_id=mCG22916.1 transcript_id=mCT22618.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(218093..>219259)
FT                   /codon_start=1
FT                   /gene="Znrf4"
FT                   /locus_tag="mCG_22916"
FT                   /product="zinc and ring finger 4"
FT                   /note="gene_id=mCG22916.1 transcript_id=mCT22618.1
FT                   protein_id=mCP9090.1"
FT                   /protein_id="EDL38170.1"
FT                   /translation="TSCGLNCRREPLPLEAPEFGHSRRRSHPATGSPRGSGDARGASVP
FT                   SHQGLIGAREPEVGTAMARFAWTRVAPVALVTFWLVLSLSPTDAQVNLSSVDFLDLPAL
FT                   LGVPVDPKRARGYLLVARPADACHAIEGPWPDNHSLDPLVLVRPLGCSWEQTGRRAQRA
FT                   GATAASVGPEAPGQLREFEDLEVTVRCDQPARVLLPHAEPCPDPECHPVVVASWALARA
FT                   LALAASTLFVLRQLWPWVRGLGSRGTAVKTQTCQKAQVRTFTRLSDLCAICLDDYEEGE
FT                   RLKILPCAHAYHCRCIDPWFSRAAQRSCPLCKQSVASTHDGSTDGSVGGEEPPLPGHRP
FT                   PIWAIQARLRSRRLELLARTVPCRRCSSTTSLGVAENVAQSEATSELS"
FT   gene            complement(256431..>259854)
FT                   /locus_tag="mCG_56863"
FT                   /note="gene_id=mCG56863.1"
FT   mRNA            complement(join(256431..258404,258857..258970,
FT                   259526..>259854))
FT                   /locus_tag="mCG_56863"
FT                   /product="mCG56863"
FT                   /note="gene_id=mCG56863.1 transcript_id=mCT57046.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(258967..258970,259526..>259854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56863"
FT                   /product="mCG56863"
FT                   /note="gene_id=mCG56863.1 transcript_id=mCT57046.2
FT                   protein_id=mCP38800.2"
FT                   /protein_id="EDL38171.1"
FT                   /translation="VEAGGSAGLAGADLRESLRLAMAMEELRRGLSRWKRYHIKVHLAD
FT                   EALLLPLTVRPRDTLSDLRAQLVGQGVSSWRRTFYYNSRPLPDHQTVREARLQDGSVLL
FT                   LLSDTR"
FT   gene            complement(268349..>289931)
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /note="gene_id=mCG5574.3"
FT   mRNA            complement(join(268349..268839,268920..269032,
FT                   269912..270042,270627..270669,271353..271490,
FT                   271734..272024,272287..272426,272941..273032,
FT                   274303..274430,276665..276727,276808..276957,
FT                   280311..280360,282286..282313,283251..283313,
FT                   284045..284252,284329..284393,288392..288479,
FT                   289682..>289920))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT193677"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT193677.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(268356..268651,268770..268839,
FT                   268920..269032,269912..270042,270627..270669,
FT                   271353..271490,271734..272024,272287..272423,
FT                   272941..273032,274303..274430,276618..276727,
FT                   276808..276957,279610..279710,280311..280360,
FT                   280763..281420,282286..282313,283251..283313,
FT                   284049..284252,284329..284393,288392..288479,
FT                   289682..>289931))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT3944"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT3944.2 created on
FT                   09-AUG-2002"
FT   mRNA            complement(join(268356..268651,268770..268839,
FT                   268920..268983,277784..>277906))
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, transcript variant
FT                   mCT171418"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT171418.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(268507..268651,268770..268839,
FT                   268920..269032,269912..270042,270627..270669,
FT                   271353..271490,271734..272024,272287..272423,
FT                   272941..273032,274303..274430,276618..276727,
FT                   276808..276957,279610..279710,280311..280360,
FT                   280763..281420,282286..282313,283251..283313,
FT                   284049..284252,284329..284393,288392..288479,
FT                   289682..>289930))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_b"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT3944.2
FT                   protein_id=mCP18173.2 isoform=CRA_b"
FT                   /protein_id="EDL38173.1"
FT                   /translation="TTSEPPQLVPASGGGSGASWEVAEARMAEPGTGSGDPAFGPGASE
FT                   SGTRRLSDLRVIDLRAELKKRNLDTGGNKSVLMERLRKAFKEEGQEPEEVGISWGAVSK
FT                   RAVKRNTKGSKMEEEGSEDNGLEEDSRYGQDGVVILQSSQDRDTMDTGVPDGMEAEDLS
FT                   VPCLGKADTVNQILHAFDDSKEYVAAQLGQLPAQLLKHAVDEEVFKNTLEASVSDLKVT
FT                   LADEEAPMEPENEKILDILGETCKSEPVKEEGSELEQPFAQATSSVGPDRKLAEEEDLF
FT                   ESCGHPEEEEEEEEEDQEEEQEEEGDLALASSSKSESPSTRCQWSEADAPLAVVKRELA
FT                   DAPGGGGGTRHRRKRKRRRKHQAQAEALGTGGGAGMNCEPVGLEEPVEQSSTAAQLPEA
FT                   TSQELVRAPTAALSPEPQDSKEDVKKFAFDACNDVPAPPKESSASEGADQKMSSVKEEQ
FT                   DIKPVIKDEKGRASCSSGRNLWVSGLSSSTRAADLKSLFSKHGKVIGAKVVTNARSPGA
FT                   RCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPSEKKSSDRRACDQKEKVPG
FT                   PDRPHPVKIKTEKTVIKKEEKLERKEEKGPEDIKKEKDQDELTPGAAGHSRVTKSGSRG
FT                   MERTVVMDKSKGEPVISVKATSRSKDRSSKSQDRKSEGREKRDILSFDKIKEQRERERQ
FT                   RQREREIRETERRREREQREREQRLDAFQERREKARLQRERMQLQCQRQRLERERLERE
FT                   RLERERMRVERERRKEQQRIMREREELRRQQEQLRAEQERRALRRPYDLDARRDDGYWP
FT                   EGKRAALEDRYRDFPRPDHRFHDFDHRDRGHYQEHVIDRRDGSRTRVEERDGQYYPDDQ
FT                   HSHGRLLEHHAWDSGDGWHGYSSDKKLNEGQGLPPPPRVSREWAEHSSQLEEQQVPVWH
FT                   SAVDTNMTGHEHIRWRGAERGLAGGPGHGHVAAGRGGMAGQGSFAHGGHSQGYIVPSGR
FT                   LEGGGMASQDQGGRVPNPHPHPHFTRRY"
FT   CDS             complement(join(268507..268651,268770..268839,
FT                   268920..268983,277784..>277906))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_c"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT171418.0
FT                   protein_id=mCP94337.0 isoform=CRA_c"
FT                   /protein_id="EDL38174.1"
FT                   /translation="ECFQRNTLGFLGSAFPAPILGTHIVNPLGTLQIIVFMGLRQVPVW
FT                   HSAVDTNMTGHEHIRWRGAERGLAGGPGHGHVAAGRGGMAGQGSFAHGGHSQGYIVPSG
FT                   RLEGGGMASQDQGGRVPNPHPHPHFTRRY"
FT   CDS             complement(join(268766..268839,268920..269032,
FT                   269912..270042,270627..270669,271353..271490,
FT                   271734..272024,272287..272426,272941..273032,
FT                   274303..274430,276665..276727,276808..>276821))
FT                   /codon_start=1
FT                   /gene="Safb2"
FT                   /locus_tag="mCG_5574"
FT                   /product="scaffold attachment factor B2, isoform CRA_a"
FT                   /note="gene_id=mCG5574.3 transcript_id=mCT193677.0
FT                   protein_id=mCP114665.0 isoform=CRA_a"
FT                   /protein_id="EDL38172.1"
FT                   /translation="SLWRRPRMNPLRRSRQTGEHVTKRRRTVIKKEEKLERKEEKGPED
FT                   IKKEKDQDELTPGAAGHSRVTKSGSRGMERTVVMDKSKGEPVISVKATSRSKDRQSSKS
FT                   QDRKSEGREKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLDAFQER
FT                   REKARLQRERMQLQCQRQRLERERLERERLERERMRVERERRKEQQRIMREREELRRQQ
FT                   EQLRAEQERRALRRPYDLDARRDDGYWPEGKRAALEDRYRDFPRPDHRFHDFDHRDRGH
FT                   YQEHVIDRRDGSRTRVEERDGQYYPDDQHSHGRLLEHHAWDSGDGWHGYSSDKKLNEGQ
FT                   GLPPPPRVSREWAEHSSQLEEQQVPVWHSAVDTNMTGHEHIRWRGAERGLAGGPGHGHV
FT                   AAGRGGMAG"
FT   gene            290235..311681
FT                   /locus_tag="mCG_127409"
FT                   /note="gene_id=mCG127409.1"
FT   mRNA            join(290235..290762,294194..294278,299101..299165,
FT                   299246..299452,301063..301125,303199..303226,
FT                   304055..304631,305034..305083,305749..305843,
FT                   306233..306382,306459..306541,306638..306777,
FT                   306854..306942,308288..308394,308943..309233,
FT                   309557..309694,309777..309819,310695..310810,
FT                   310956..311056,311196..311262,311375..311681)
FT                   /locus_tag="mCG_127409"
FT                   /product="mCG127409"
FT                   /note="gene_id=mCG127409.1 transcript_id=mCT128732.1
FT                   created on 09-AUG-2002"
FT   CDS             join(290574..290762,294194..294278,299101..299165,
FT                   299246..299452,301063..301125,303199..303226,
FT                   304055..304631,305034..305083,305749..305843,
FT                   306233..306382,306459..306541,306638..306777,
FT                   306854..306942,308288..308394,308943..309233,
FT                   309557..309694,309777..309819,310695..310810,
FT                   310956..311056,311196..311262,311375..311504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127409"
FT                   /product="mCG127409"
FT                   /note="gene_id=mCG127409.1 transcript_id=mCT128732.1
FT                   protein_id=mCP71130.1"
FT                   /db_xref="GOA:D3YXK2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2146974"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YXK2"
FT                   /protein_id="EDL38175.1"
FT                   /translation="MAETLSGLGDASAAGAAAVSSAASETGTRRLSDLRVIDLRAELKK
FT                   RNLDSSGNKSVLMERLKKAIEDEGGNPDEIEVTSECNKKMPKRPSKGRKPEDEGVEDNG
FT                   LEENSGDGQEDVETSLENLQDMDMMDISVLDEADIDNGSVADCVEEEEEATLPEGLADS
FT                   TELVEGDLKGLPEQLQEHAIDDKDTVNNVDTSSSDFTMLQEMEEASLEPENEKILDILG
FT                   ETCKSEPVKEEGSELEQPFAQATSSVGPDRKLAEEEDLFESCGHPEEEEEEEEEDQEEE
FT                   QEEEGDLALASSSKSESPSTRCQWSEADAPLAVVKREPADAPGGGTGMDREPVGLEEPV
FT                   EQSSTAAQLPEATSQELVRAPTAALSPEPQDSKEDVKKFAFDACNDVPAPPKESSASEG
FT                   ADQKMSSVEEDSDTKRLSREEKGRSSCGRNFWVSGLSSTTRATDLKNLFSRYGKVVGAK
FT                   VVTNARSPGARCYGFVTMSTAEEATKCISHLHKTELHGKMISVEKAKSEPTGKRVPDRR
FT                   DGDSKKEKASTSDRSANLKREEKGERKDDAKKTDDGSTEKSKDADDQKPGPSERSRTTK
FT                   SGSRGTERTVVMDKSKGVPVISVKTSGSKERASKSQDRKSASREKRSVVSFDKVKESRK
FT                   SRDSESRRERERSEREQRLQAQWEREERERLEIARERLAFHRHRLERERMERERLERER
FT                   MHVEQERRREQERIHREREELRRQQELRYEQERRPAVRRPYEVDGRRDDAYWPEAKRAA
FT                   LDDRYHSDFSRQDRFHDFDHRDRGRYPNHSVDRREGSRSMMGDREGQHYPERHGGPERH
FT                   GRDSRDGWGYGSNKRLSEGRGLPPPPRRDWGEHGRRLEDDRAWQGTADGGMMERDHKRW
FT                   QGGERSMSGHSGPGHMMNRGGMSGRGSFAPGGASRGHVIPRGGMQAGFGGQSRGSRPSD
FT                   ARFTRRY"
FT   gene            complement(312357..315226)
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /note="gene_id=mCG5602.1"
FT   mRNA            complement(join(312357..313240,314037..314091,
FT                   314245..314422,315039..315226))
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, transcript variant
FT                   mCT3915"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT3915.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(<313087..313196,314060..314091,
FT                   314245..314422,315039..315070))
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, transcript variant
FT                   mCT171804"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT171804.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(<313087..313196,314060..314091,
FT                   314245..314422,315039..315067))
FT                   /codon_start=1
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, isoform CRA_b"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT171804.0
FT                   protein_id=mCP94723.0 isoform=CRA_b"
FT                   /protein_id="EDL38177.1"
FT                   /translation="MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSEAALRKAE
FT                   EVVPPAMYQFSQYVCQQTGLEMPQLPTPPKIKFPKPENTPRRAGSTSRNTASNGCHLPQ
FT                   HYGGQDQDGRDI"
FT   CDS             complement(join(313143..313240,314037..314091,
FT                   314245..314422,315039..315067))
FT                   /codon_start=1
FT                   /gene="2410015M20Rik"
FT                   /locus_tag="mCG_5602"
FT                   /product="RIKEN cDNA 2410015M20, isoform CRA_a"
FT                   /note="gene_id=mCG5602.1 transcript_id=mCT3915.2
FT                   protein_id=mCP18142.1 isoform=CRA_a"
FT                   /protein_id="EDL38176.1"
FT                   /translation="MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSEAALRKAE
FT                   EVVPPAMYQFSQYVCQQTGLEMPQLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAR
FT                   EYSKEGWEYLKEHSK"
FT   gene            <318815..319646
FT                   /locus_tag="mCG_5564"
FT                   /note="gene_id=mCG5564.2"
FT   mRNA            join(<318815..318847,318980..319079,319306..319440,
FT                   319523..319646)
FT                   /locus_tag="mCG_5564"
FT                   /product="mCG5564"
FT                   /note="gene_id=mCG5564.2 transcript_id=mCT3955.2 created on
FT                   17-JUL-2002"
FT   CDS             join(<318816..318847,318980..319079,319306..319440,
FT                   319523..319612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5564"
FT                   /product="mCG5564"
FT                   /note="gene_id=mCG5564.2 transcript_id=mCT3955.2
FT                   protein_id=mCP18145.2"
FT                   /protein_id="EDL38178.1"
FT                   /translation="FLSRPPSESISTAMALRYPMAVGLNKGHKVTKNVSKPRHSRRRGR
FT                   LTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELS
FT                   NVLAAMRKAAAKKD"
FT   gene            complement(319695..>332359)
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /note="gene_id=mCG5590.2"
FT   mRNA            complement(join(319695..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..323855,324571..324791,
FT                   325385..325468,325622..325751,325913..325974,
FT                   327323..327557,327833..327952,328536..328624,
FT                   331880..>332359))
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, transcript variant mCT3927"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT3927.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(319700..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..325468,325622..325751,
FT                   325913..325974,327323..327557,327833..327952,
FT                   328536..328624,331765..>332274))
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, transcript variant
FT                   mCT193678"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT193678.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(319783..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..323855,324571..324791,
FT                   325385..325468,325622..325751,325913..325974,
FT                   327323..327557,327833..327952,328536..328624,
FT                   331880..>332359))
FT                   /codon_start=1
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, isoform CRA_b"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT3927.2
FT                   protein_id=mCP18156.2 isoform=CRA_b"
FT                   /protein_id="EDL38180.1"
FT                   /translation="PEARERHHVRKRGASRDDVSAVRRQYGCSMAASTGYVRLWAAARC
FT                   WVLRRPLLAVTGGRVPSASGSWLRRGCRACDMSAPWGGRVLPGGVQWRGLWDSGNRGGS
FT                   DETSEGGAEDGATASTGEGPVVTALAPMTVPDVFPHLPLIAITRNPVFPRFIKIVEVKN
FT                   KKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESLDEIYHTGTFAQIHEMQDLGDKLR
FT                   MIVTGHRRIHISRQLEVEPEGLEPEAEKQKSRRKLKRGKKEVEDELGPKPQLEMVTEAA
FT                   TDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQ
FT                   RVVDNPIYLSDMGAALTGAESHELQDVLEETNILKRLYKALSLLKKEFELSKLQQRLGR
FT                   EVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLRELVVPKHVMDVVDE
FT                   ELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQAVLEEDHYGMEDVKK
FT                   RVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVGGMTDVAEI
FT                   KGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNA
FT                   NFLDHYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVP
FT                   QARTLCGLDESKAQLSAAVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSGEAQTV
FT                   QVTPENLQDFVGKPVFTVERMYEVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPSGSKE
FT                   DKDGSLEVTGQLGDVMKESARIAYTYARAFLMEQDPENDFLVTSHIHLHVPEGATPKDG
FT                   PSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIIL
FT                   PAENRKDYSDLAPFITEGLEVHFVEHYRDIFPIAFPRREHREALAVER"
FT   CDS             complement(join(319783..319962,320035..320199,
FT                   320273..320490,320649..320814,320903..321043,
FT                   321325..321441,321529..321651,321758..321845,
FT                   323153..323331,323717..>323887))
FT                   /codon_start=1
FT                   /gene="Prss15"
FT                   /locus_tag="mCG_5590"
FT                   /product="protease, serine, 15, isoform CRA_a"
FT                   /note="gene_id=mCG5590.2 transcript_id=mCT193678.0
FT                   protein_id=mCP114666.0 isoform=CRA_a"
FT                   /protein_id="EDL38179.1"
FT                   /translation="EHLVTVPCPCSVTRNYLDWLTSIPWGRQSDENLDLARAQAVLEED
FT                   HYGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSV
FT                   GGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALL
FT                   ELLDPEQNANFLDHYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKL
FT                   AIAERYLVPQARTLCGLDESKAQLSAAVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYK
FT                   IVSGEAQTVQVTPENLQDFVGKPVFTVERMYEVTPPGVVMGLAWTAMGGSTLFVETSLR
FT                   RPQPSGSKEDKDGSLEVTGQLGDVMKESARIAYTYARAFLMEQDPENDFLVTSHIHLHV
FT                   PEGATPKDGPSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAK
FT                   RAGVTCIILPAENRKDYSDLAPFITEGLEVHFVEHYRDIFPIAFPRREHREALAVER"
FT   gene            <333541..>353212
FT                   /locus_tag="mCG_127445"
FT                   /note="gene_id=mCG127445.1"
FT   mRNA            join(<333541..333649,336935..336989,337689..337765,
FT                   338909..339993)
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, transcript variant mCT172064"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT172064.0
FT                   created on 22-AUG-2002"
FT   CDS             join(<333543..333649,336935..336989,337689..337765,
FT                   338909..339107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, isoform CRA_b"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT172064.0
FT                   protein_id=mCP94983.0 isoform=CRA_b"
FT                   /protein_id="EDL38182.1"
FT                   /translation="AWRLKSSVSCGEPGKMLVLMLAAAVATMVRAHTLCRVHTVRTGKV
FT                   FKSNIQLQGDPLFYAFPNTFVLKNVCKADISVYLGQKVFLTIDNFESSLLPLTVPKSLA
FT                   VDIPSSAAPKNYMQRKPWGSGAGVCQLWVLLLDSLRDAELQ"
FT   mRNA            join(<335801..335876,336935..336989,337689..337765,
FT                   338909..339036,341674..341738,346880..346993,
FT                   353131..>353212)
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, transcript variant mCT128728"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT128728.1
FT                   created on 22-AUG-2002"
FT   CDS             join(<335803..335876,336935..336989,337689..337765,
FT                   338909..339036,341674..341738,346880..346993,
FT                   353131..>353212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127445"
FT                   /product="mCG127445, isoform CRA_a"
FT                   /note="gene_id=mCG127445.1 transcript_id=mCT128728.1
FT                   protein_id=mCP70809.1 isoform=CRA_a"
FT                   /protein_id="EDL38181.1"
FT                   /translation="GRLPTVRAPPPGSSPSRAWKASSLGVHTVRTGKVFKSNIQLQGDP
FT                   LFYAFPNTFVLKNVCKADISVYLGQKVFLTIDNFESSLLPLTVPKSLAVDIPSSAAPKN
FT                   YMQRKPWGISEPVSHISGDVCCFKGSFCLELSNNLFAYLRGGQIPGTNIYFSDNGGFSF
FT                   QLMNTDKLSHLTGTLGGIFHLHSMSQVGVLMVENN"
FT   gene            356209..369785
FT                   /locus_tag="mCG_145771"
FT                   /note="gene_id=mCG145771.0"
FT   mRNA            join(356209..356228,357130..357225,357792..357874,
FT                   358915..359091,360432..360521,361324..361382,
FT                   363403..363481,364859..364911,365501..365575,
FT                   366572..366700,367992..368175,368598..368755,
FT                   369364..369785)
FT                   /locus_tag="mCG_145771"
FT                   /product="mCG145771"
FT                   /note="gene_id=mCG145771.0 transcript_id=mCT185851.0
FT                   created on 17-JUN-2003"
FT   CDS             join(357854..357874,358915..359091,360432..360521,
FT                   361324..361382,363403..363481,364859..364911,
FT                   365501..365575,366572..366700,367992..368175,
FT                   368598..368755,369364..369685)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145771"
FT                   /product="mCG145771"
FT                   /note="gene_id=mCG145771.0 transcript_id=mCT185851.0
FT                   protein_id=mCP107109.0"
FT                   /db_xref="GOA:E9Q9F6"
FT                   /db_xref="InterPro:IPR028751"
FT                   /db_xref="MGI:MGI:2147030"
FT                   /db_xref="UniProtKB/Swiss-Prot:E9Q9F6"
FT                   /protein_id="EDL38183.1"
FT                   /translation="MGTYVIKLPHQPLWSTHTSIYFEDIGILQVLTPVADPHFAAYDFD
FT                   KCTVNVQSSLMDEKLALQPCNVMVSNPHALGFKANLNEFGNTFDGNSKYKLDIELKQQH
FT                   HWGNSDFNFTASIKRHAISSVTVDIADKTLSCVDLKPLSTLISVGCDMTKKIVVQNKIS
FT                   ACTMGILNPVQLQKNYTYTIEKEAYDPINHNGEAQDDLIVFYEYKDLGCPRLVYYDKPW
FT                   KPVVELWKNGIVEEIMNAEYVISEINGLVTYSYSLTAATANCRSQPQNWSTFESDIENE
FT                   EPFLWNRENYVSCHEDNKDNPLLWPNVEYQVLGGQTNNKIIFGQRNGIYTFHLSVVDPY
FT                   YSYCNLNTIFSVYVHGALPVTKFQPLLTILLMVTTTLLTAWLAYAIPKQLRSEKGQRLL
FT                   GFCYQILQLCLGVCFCTWLRGKLRQWLRPRRVKDQNRGKVRVAQKHPET"
FT   gene            378562..417104
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /note="gene_id=mCG5598.3"
FT   mRNA            join(378562..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406876,408098..408225,
FT                   410792..410905,412197..412300,412498..412573,
FT                   413186..413288,413506..413615,414549..414669,
FT                   415423..415565,415926..416112,416191..416942)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186667"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186667.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378562..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416877)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186666"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186666.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,397856..398056,
FT                   401937..401973,402053..402124,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..417104)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT3919"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT3919.3 created on
FT                   14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416877)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172085"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172085.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,404443..404552,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416748)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172089"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172089.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410917,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416677)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186668"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186668.0 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416012,
FT                   416235..416561)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172086"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172086.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,397856..398056,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416354)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172087"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172087.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,397080..397217,
FT                   397856..398056,401937..401973,402053..402124,
FT                   406358..406423,406784..406876,408098..408225,
FT                   410792..410905,412197..412300,412498..412573,
FT                   413186..413288,413506..413615,414549..415127)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172088"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172088.1 created
FT                   on 14-AUG-2003"
FT   mRNA            join(378581..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..407255)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT186665"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186665.0 created
FT                   on 14-AUG-2003"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416012,
FT                   416235..416486)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172086.1
FT                   protein_id=mCP95008.1 isoform=CRA_c"
FT                   /protein_id="EDL38186.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPREQQRGVLRPAVL
FT                   QAPQPKVLSQTVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQ
FT                   KTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSETPSATN
FT                   YFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQSGSES
FT                   SSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQ
FT                   SWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKASEKSIRI
FT                   TATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQERRSHCTRLLLCCLS
FT                   AARPSLQAASWWCLLPGWPQAGSECPLCSRRGRQDAAWDSDLIILMSRKNVPPPSSDRN
FT                   GTLTLVTASW"
FT   CDS             join(378725..378746,391341..391396,397856..398056,
FT                   401937..401973,402053..402124,406358..406423,
FT                   406784..406876,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_i"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT3919.3
FT                   protein_id=mCP18149.2 isoform=CRA_i"
FT                   /protein_id="EDL38192.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKSSTEHRDLPESGEEPRGEA
FT                   EAPCPDTGYPESIGEHALDPSAPASASTSSLPPPAPAAQPPCVRELAGRSAGSSSPEAG
FT                   EDSDHEDGNYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPREQQR
FT                   GVLRPAVLQAPQPKVLSQTVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAEETH
FT                   TLEEKVPQKTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPS
FT                   SETPSATNYFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETT
FT                   HAQSGSESSSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKL
FT                   FVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDK
FT                   ASEKSIRITATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPP
FT                   EPGATRATEEEDSDEDAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410917,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_h"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186668.0
FT                   protein_id=mCP107907.0 isoform=CRA_h"
FT                   /protein_id="EDL38191.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPREQQRGVLRPAVL
FT                   QAPQPKVLSQTVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQ
FT                   KTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKVFGLLMNENASVADVDSAAHPSSETP
FT                   SATNYFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQS
FT                   GSESSSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFD
FT                   KTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKASEK
FT                   SIRITATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPGA
FT                   TRATEEEDSDEDAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_j"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186666.0
FT                   protein_id=mCP107904.0 isoform=CRA_j"
FT                   /protein_id="EDL38194.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPREQQRGVLRPAVL
FT                   QAPQPKVLSQTVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQ
FT                   KTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSETPSATN
FT                   YFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQSGSES
FT                   SSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQ
FT                   SWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKASEKSIRI
FT                   TATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPGATRAT
FT                   EEEDSDEDAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172085.0
FT                   protein_id=mCP95005.0 isoform=CRA_b"
FT                   /protein_id="EDL38185.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAEETHTL
FT                   EEKVPQKTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSE
FT                   TPSATNYFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHA
FT                   QSGSESSSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFV
FT                   FDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKAS
FT                   EKSIRITATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEP
FT                   GATRATEEEDSDEDAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406423,406784..407070)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_f"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186665.0
FT                   protein_id=mCP107906.0 isoform=CRA_f"
FT                   /protein_id="EDL38189.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPREQQRGVLRPAVL
FT                   QAPQPKVLSQTGKGLRHSLKYRGKRTLWVSPILRGTSIGYCQGFLCPQVSCQPPKLLCK
FT                   GFQLCWVLVLLLKTQK"
FT   CDS             join(378725..378746,391341..391396,401937..401973,
FT                   402053..402124,406358..406431)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_g"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT186667.0
FT                   protein_id=mCP107905.0 isoform=CRA_g"
FT                   /protein_id="EDL38190.1"
FT                   /translation="MADLANEEKPAVAPSVFVFQKDKGQKRSAGSSSPEAGEDSDHEDG
FT                   NYCPPVKRERTSSLTHSEEKSSGFRLKPPTLIHGQAPSAGG"
FT   CDS             join(404510..404552,406358..406423,406784..406876,
FT                   408098..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_e"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172089.1
FT                   protein_id=mCP95006.1 isoform=CRA_e"
FT                   /protein_id="EDL38188.1"
FT                   /translation="MPTQWPGSGPHTGAEEKSSGFRLKPPTLIHGQAPSAGLPSQKPRE
FT                   QQRGVLRPAVLQAPQPKVLSQTVPSSGTNGVSMPADCTGPATSVSPENLTQRSPSESAE
FT                   ETHTLEEKVPQKTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAA
FT                   HPSSETPSATNYFLQYISSSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSR
FT                   ETTHAQSGSESSSQEAAPKKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQ
FT                   CKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQ
FT                   MDKASEKSIRITATDAEDQGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKA
FT                   PPPEPGATRATEEEDSDEDAVLAPSGVTGAGTGDEGDGQAPGST"
FT   mRNA            join(407048..407209,408098..408225,410792..410905,
FT                   412197..412300,412498..412573,413186..413288,
FT                   413506..413615,414549..414669,415423..415565,
FT                   415926..416112,416191..416748)
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, transcript variant
FT                   mCT172084"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172084.1 created
FT                   on 14-AUG-2003"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172084.1
FT                   protein_id=mCP95003.1 isoform=CRA_a"
FT                   /protein_id="EDL38184.1"
FT                   /translation="MPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQKTPHGTS
FT                   EEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSETPSATNYFLQYIS
FT                   SSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQSGSESSSQEAAP
FT                   KKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQSWVERGR
FT                   GLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKASEKSIRITATDAED
FT                   QGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPGATRATEEEDSDE
FT                   DAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414669,415423..415565,415926..416112,
FT                   416191..416234)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172087.1
FT                   protein_id=mCP95007.1 isoform=CRA_a"
FT                   /protein_id="EDL38193.1"
FT                   /translation="MPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQKTPHGTS
FT                   EEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSETPSATNYFLQYIS
FT                   SSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQSGSESSSQEAAP
FT                   KKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQSWVERGR
FT                   GLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQMDKASEKSIRITATDAED
FT                   QGVKVFLISASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPGATRATEEEDSDE
FT                   DAVLAPSGVTGAGTGDEGDGQAPGST"
FT   CDS             join(408127..408225,410792..410905,412197..412300,
FT                   412498..412573,413186..413288,413506..413615,
FT                   414549..414719)
FT                   /codon_start=1
FT                   /gene="Ranbp3"
FT                   /locus_tag="mCG_5598"
FT                   /product="RAN binding protein 3, isoform CRA_d"
FT                   /note="gene_id=mCG5598.3 transcript_id=mCT172088.1
FT                   protein_id=mCP95004.1 isoform=CRA_d"
FT                   /protein_id="EDL38187.1"
FT                   /translation="MPADCTGPATSVSPENLTQRSPSESAEETHTLEEKVPQKTPHGTS
FT                   EEGHCEEEQAAPQAFVFGQNLRDRVKLMNENASVADVDSAAHPSSETPSATNYFLQYIS
FT                   SSADNATHSADNSTKFVFGQNMSERVLSPPKLNEANSDTSRETTHAQSGSESSSQEAAP
FT                   KKESLAESAAAYTKATAWTCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQSWVERGR
FT                   GLLRLNDMASTDDGTLQSRLGELWGRTDPLRGGLKL"
FT   gene            complement(419272..423036)
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /note="gene_id=mCG5578.2"
FT   mRNA            complement(join(419272..421152,421969..422255))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT3939"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT3939.2 created on
FT                   23-AUG-2002"
FT   mRNA            complement(join(420502..421152,422933..423036))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT172068"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172068.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(420819..421152,421969..422159))
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_b"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT3939.2
FT                   protein_id=mCP18158.1 isoform=CRA_b"
FT                   /protein_id="EDL38196.1"
FT                   /translation="MSAPPPLQIREANAHLAAVHRRAAELERRLLAAERTIGAQAERLA
FT                   CHDQHLRAALDELGRAKDREISALQEQLLSSEATVRSLQAAVDQRDQMIQQLQPRADLL
FT                   QDITRHRPPLAALLATLEEAEELGPLPASHSHRAQLLPDGPGPPLGNNMGKEEGQDDQD
FT                   DQQPAVFGTTV"
FT   CDS             complement(420819..421067)
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_a"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172068.0
FT                   protein_id=mCP94986.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA49"
FT                   /db_xref="MGI:MGI:2146912"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA49"
FT                   /protein_id="EDL38195.1"
FT                   /translation="MIQQLQPRADLLQDITRHRPPLAALLATLEEAEELGPLPASHSHR
FT                   AQLLPDGPGPPLGNNMGKEEGQDDQDDQQPAVFGTTV"
FT   mRNA            complement(join(<421037..421152,421969..422135,
FT                   422933..>423020))
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, transcript variant
FT                   mCT172067"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172067.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(<421037..421152,421969..422135,
FT                   422933..>422965))
FT                   /codon_start=1
FT                   /gene="AI662250"
FT                   /locus_tag="mCG_5578"
FT                   /product="expressed sequence AI662250, isoform CRA_c"
FT                   /note="gene_id=mCG5578.2 transcript_id=mCT172067.0
FT                   protein_id=mCP94987.0 isoform=CRA_c"
FT                   /protein_id="EDL38197.1"
FT                   /translation="IWTETPVTSGKIREANAHLAAVHRRAAELERRLLAAERTIGAQAE
FT                   RLACHDQHLRAALDELGRAKDREISALQEQLLSSEATVRSLQAAVDQRDQMIQQLQPRA
FT                   D"
FT   gene            423097..428026
FT                   /locus_tag="mCG_5603"
FT                   /note="gene_id=mCG5603.2"
FT   mRNA            join(423097..423277,426370..426462,426654..426776,
FT                   427320..428026)
FT                   /locus_tag="mCG_5603"
FT                   /product="mCG5603"
FT                   /note="gene_id=mCG5603.2 transcript_id=mCT3916.2 created on
FT                   23-AUG-2002"
FT   CDS             join(423175..423277,426370..426462,426654..426776,
FT                   427320..427432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5603"
FT                   /product="mCG5603"
FT                   /note="gene_id=mCG5603.2 transcript_id=mCT3916.2
FT                   protein_id=mCP18148.1"
FT                   /db_xref="GOA:G5E814"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="MGI:MGI:1917125"
FT                   /db_xref="UniProtKB/TrEMBL:G5E814"
FT                   /protein_id="EDL38198.1"
FT                   /translation="MAMVKRFFESYHEVPDGTQCHRKTYITTALGGICGIIGSAYSVSL
FT                   NPADSTLEAVARVGRYTFTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLG
FT                   ARTHSYGTAAMGCVYMGTAAALFKIGKLEGWELFPTPKV"
FT   gene            439561..444627
FT                   /locus_tag="mCG_54169"
FT                   /note="gene_id=mCG54169.2"
FT   mRNA            join(439561..440243,442814..444627)
FT                   /locus_tag="mCG_54169"
FT                   /product="mCG54169"
FT                   /note="gene_id=mCG54169.2 transcript_id=mCT54352.2 created
FT                   on 31-OCT-2002"
FT   CDS             442942..443370
FT                   /codon_start=1
FT                   /locus_tag="mCG_54169"
FT                   /product="mCG54169"
FT                   /note="gene_id=mCG54169.2 transcript_id=mCT54352.2
FT                   protein_id=mCP38801.2"
FT                   /protein_id="EDL38199.1"
FT                   /translation="MGRCGIQMKPESSFSWRRLPRWRVISSVFRRRWTPEARSLGLWFL
FT                   AVSDIPLSTVTSHIRNKNNLYQIWLEVDVHAGEGRRSTASPATEQSEASVGYTRPFRKT
FT                   QVASNVNTSCSHSTRRHSTAVTAVSDLPPLARSPGSWI"
FT   gene            complement(456666..462871)
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /note="gene_id=mCG5566.1"
FT   mRNA            complement(join(456666..457171,457650..457831,
FT                   462537..462871))
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /product="neurturin"
FT                   /note="gene_id=mCG5566.1 transcript_id=mCT3952.0 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(456753..457171,457650..457818))
FT                   /codon_start=1
FT                   /gene="Nrtn"
FT                   /locus_tag="mCG_5566"
FT                   /product="neurturin"
FT                   /note="gene_id=mCG5566.1 transcript_id=mCT3952.0
FT                   protein_id=mCP18147.1"
FT                   /protein_id="EDL38200.1"
FT                   /translation="MRRWKAAALVSLICSSLLSVWMCQEGLLLGHRLGPALAPLRRPPR
FT                   TLDARIARLAQYRALLQGAPDAVELRELSPWAARIPGPRRRAGPRRRRARPGARPCGLR
FT                   ELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCC
FT                   RPTAYEDEVSFLDVHSRYHTLQELSARECACV"
FT   gene            470071..475435
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /note="gene_id=mCG5567.2"
FT   mRNA            join(470071..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475434)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT3953"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT3953.2 created on
FT                   05-MAR-2003"
FT   mRNA            join(470071..470282,472123..472389)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT172065"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172065.1 created
FT                   on 05-MAR-2003"
FT   mRNA            join(<470125..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475433)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT193696"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT193696.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<470188..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473599)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT193696.0
FT                   protein_id=mCP114662.0 isoform=CRA_c"
FT                   /protein_id="EDL38203.1"
FT                   /translation="GASMAETAAESGGGGDSGVGACERGVAPIKAQYRTTKERFHEYLD
FT                   GDKQEGACQEVPTGDPAEPGAKRIRLEDGQENGKTEVAIESRERQVPKRARGQNKSRPH
FT                   VKPAHYDKDRLCPSFLQEPATPCAFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRC
FT                   PFSMTCRFAGAHLGPEGQNLVQEEVVARCAQLPSVRNGLDRALQQQLRKRQVCFERAEQ
FT                   ALNRLTQSPMPTVVPETTVAMATPKQNSCHAQLDTVGGAGTPQSSPVPTCGPLTDEDVI
FT                   RLRPCEKKRLDISGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEW
FT                   ALLKRHPCEDIFGVQLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYKKVMAAL
FT                   PWSLGWVWPKPGTLPCWPCVSVSPSGHGAH"
FT   CDS             join(470197..470282,470866..471133,472123..472629,
FT                   472974..473015,473124..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475149)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT3953.2
FT                   protein_id=mCP18167.3 isoform=CRA_d"
FT                   /protein_id="EDL38204.1"
FT                   /translation="MAETAAESGGGGDSGVGACERGVAPIKAQYRTTKERFHEYLDGDK
FT                   QEGACQEVPTGDPAEPGAKRIRLEDGQENGKTEVAIESRERQVPKRARGQNKSRPHVKP
FT                   AHYDKDRLCPSFLQEPATPCAFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPFS
FT                   MTCRFAGAHLGPEGQNLVQEEVVARCAQLPSVRNGLDRALQQQLRKRQVCFERAEQALN
FT                   RLTQSPMPTVVPETTVAMATPKQNSCHAQLDTVGGAGTPQSSPVPTCGPLTDEDVIRLR
FT                   PCEKKRLDISGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALL
FT                   KRHPCEDIFGVQLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYKKGGGCALMN
FT                   RSAKFQQIVRGVNEVLDVPLTVKMRTGVQERVSLAHRLLPELRDWGVALVTLHGRSREQ
FT                   RYTRLADWPYIEQCAKVASPMPLFGNGDILSFEDANCAMQTGVAGIMVARGALLKPWLF
FT                   TEIKEQRHWDISSSERLDILRDFTHYGLEHWGSDTQGVERTRRFLLEWLSFLCRYVPVG
FT                   LLERPPQRINERPPYYLGRDYLETLMASQQAADWIRISEMLLGPVPPGFVFLPKHKANA
FT                   YK"
FT   CDS             join(470197..470282,472123..472261)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172065.1
FT                   protein_id=mCP94984.1 isoform=CRA_a"
FT                   /protein_id="EDL38201.1"
FT                   /translation="MAETAAESGGGGDSGVGACERGVAPIKAQSRPPHVHLETVAASCT
FT                   MWGATWRPNRQTWAPAACSSKPLAGALSA"
FT   mRNA            join(<470872..471013,473220..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475435)
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   transcript variant mCT172066"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172066.1 created
FT                   on 05-MAR-2003"
FT   CDS             join(<470873..471013,473220..473276,473375..473491,
FT                   473689..473754,473859..473969,474147..474243,
FT                   474391..474466,474591..474779,474875..475003,
FT                   475077..475149)
FT                   /codon_start=1
FT                   /gene="Dus3l"
FT                   /locus_tag="mCG_5567"
FT                   /product="dihydrouridine synthase 3-like (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5567.2 transcript_id=mCT172066.1
FT                   protein_id=mCP94985.1 isoform=CRA_b"
FT                   /protein_id="EDL38202.1"
FT                   /translation="TTKERFHEYLDGDKQEGACQEVPTGDPAEPGAKRIRLEDGQENGK
FT                   TEMSEWALLKRHPCEDIFGVQLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYK
FT                   KGGGCALMNRSAKFQQIVRGVNEVLDVPLTVKMRTGVQERVSLAHRLLPELRDWGVALV
FT                   TLHGRSREQRYTRLADWPYIEQCAKVASPMPLFGNGDILSFEDANCAMQTGVAGIMVAR
FT                   GALLKPWLFTEIKEQRHWDISSSERLDILRDFTHYGLEHWGSDTQGVERTRRFLLEWLS
FT                   FLCRYVPVGLLERPPQRINERPPYYLGRDYLETLMASQQAADWIRISEMLLGPVPPGFV
FT                   FLPKHKANAYK"
FT   gene            complement(481386..536914)
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /note="gene_id=mCG5568.2"
FT   mRNA            complement(join(481386..482415,482773..482815,
FT                   483180..483333,485221..485429,486096..486245,
FT                   487592..487689,488948..489102,489641..489753,
FT                   489989..490107,490638..490753,491950..492069,
FT                   492920..493101,508816..509077,509664..509734,
FT                   510696..510785,514129..514220,536777..536914))
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), transcript variant mCT3950"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT3950.2 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(482303..482415,482773..482815,
FT                   483180..483333,485221..485429,486096..486245,
FT                   487592..487689,488948..489102,489641..489753,
FT                   489989..490107,490638..490753,491950..492069,
FT                   492920..493101,508816..509077,509664..509734,
FT                   510696..510785,514129..514212))
FT                   /codon_start=1
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), isoform CRA_b"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT3950.2
FT                   protein_id=mCP18159.2 isoform=CRA_b"
FT                   /protein_id="EDL38206.1"
FT                   /translation="MQNSEGGADSPASVALRPAAQPMPASPQRVLVQAAGSTPKGTPMQ
FT                   TLTLPRVQPVPPQVQHVYPAQVQYVEGGDAVYANGAIRAAYAYNPDPQLYAPSSAASYF
FT                   ETPGGTQVTVAASSPPAVPSHGMVGITMDVSGTPIVSGAGAYLIHGGMDGTRHSLAHTA
FT                   RSSPATLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGL
FT                   RTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLG
FT                   DGSAHSNMHGMPDQAMATQGQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQ
FT                   LVYRRHCEATLDVVMNLQFQYIEKLWLSFWNCKATSSDSCASLPASDEDPEVTLLPKEK
FT                   LISLCKCEPILQWMRSCDHILYQTLVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINA
FT                   MSGFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFA
FT                   NVQEQASWVCQCEESLVQRLEHDFKVTLQQQSSLDQWASWLDNVVTQVLKQHSGSPSFP
FT                   KAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETP
FT                   IAVMGEFNDLASLSLTLLDKEDIGDGHSSEADVDGRSLGEPLVKRERSDPSHPLQGI"
FT   mRNA            complement(join(<491946..492069,492920..493101,
FT                   504588..504662,508816..>508853))
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), transcript variant mCT170641"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT170641.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<491946..492069,492920..493101,
FT                   504588..504662,508816..>508851))
FT                   /codon_start=1
FT                   /gene="Rfx2"
FT                   /locus_tag="mCG_5568"
FT                   /product="regulatory factor X, 2 (influences HLA class II
FT                   expression), isoform CRA_a"
FT                   /note="gene_id=mCG5568.2 transcript_id=mCT170641.0
FT                   protein_id=mCP93559.0 isoform=CRA_a"
FT                   /protein_id="EDL38205.1"
FT                   /translation="SLAHTARSSPATLEMAIETLQKSEGLAPHKGGLLNSHLQWLLDNY
FT                   ETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYH
FT                   YYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRW"
FT   gene            complement(548997..580332)
FT                   /locus_tag="mCG_5594"
FT                   /note="gene_id=mCG5594.2"
FT   mRNA            complement(join(548997..549271,551298..551407,
FT                   551987..552233,552416..552555,553505..553722,
FT                   555609..555842,555929..556110,559631..559807,
FT                   562761..562910,567421..567504,568753..568873,
FT                   570346..570434,574112..574341,578683..578783,
FT                   580083..580332))
FT                   /locus_tag="mCG_5594"
FT                   /product="mCG5594"
FT                   /note="gene_id=mCG5594.2 transcript_id=mCT3920.2 created on
FT                   23-AUG-2002"
FT   CDS             complement(join(551331..551407,551987..552233,
FT                   552416..552555,553505..553722,555609..555842,
FT                   555929..556110,559631..559807,562761..562910,
FT                   567421..567504,568753..568873,570346..570434,
FT                   574112..574341,578683..578737))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5594"
FT                   /product="mCG5594"
FT                   /note="gene_id=mCG5594.2 transcript_id=mCT3920.2
FT                   protein_id=mCP18163.2"
FT                   /protein_id="EDL38207.1"
FT                   /translation="MTQEKKAEDLERGTDATSAVPRLWSTHCDGEVLLRLSKHGPGHET
FT                   PMTIPELFQESAERFSAYPALASKNGKKWDTLTFSQYYEMCRKAAKSLIKLGLQRFQCV
FT                   GILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKI
FT                   LLIPPDKMETVKAIVQYKLPLMESMANLYSWNDFMELGNDIPNIQLDRVILSQKANQCA
FT                   VILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLT
FT                   DIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSR
FT                   LRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSAS
FT                   PLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNK
FT                   EGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILI
FT                   TAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSV
FT                   EAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDF
FT                   SIQGGELGPTSKLKRSVITQKYKAQIDSMYLS"
FT   gene            581358..594785
FT                   /locus_tag="mCG_127436"
FT                   /note="gene_id=mCG127436.1"
FT   mRNA            join(581358..581564,581972..582280,583247..583473,
FT                   586337..586425,586832..586952,588048..588128,
FT                   588422..588571,588769..588867,589197..589378,
FT                   589508..589741,590632..590849,590965..591104,
FT                   592322..592568,594518..594779)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT128719"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT128719.0
FT                   created on 28-OCT-2002"
FT   mRNA            join(<581367..581564,581972..582280,583247..583473,
FT                   586337..586425,586832..586952,588048..588128,
FT                   588422..588571,588661..588867,589197..589378,
FT                   589508..589741,590632..590849,590965..591104,
FT                   592322..592568,594518..594785)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT193656"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT193656.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(581386..581564,581972..582280,583247..583702)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT175250"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT175250.0
FT                   created on 28-OCT-2002"
FT   CDS             join(<582115..582280,583247..583473,586337..586425,
FT                   586832..586952,588048..588128,588422..588571,
FT                   588661..588867,589197..589378,589508..589741,
FT                   590632..590849,590965..591104,592322..592568,
FT                   594518..594603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_d"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT193656.0
FT                   protein_id=mCP114637.0 isoform=CRA_d"
FT                   /protein_id="EDL38211.1"
FT                   /translation="TSLCWVCVVGMTDPKESDNLQTSRRILKTKTILKNKIHSAISKKA
FT                   QADNFEILTPGSSYWTSKREGQVQLRMGKDPLDNEPPVTVPDLIMSAATKYSHYLAIGS
FT                   KYKKSWQLLTYIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGI
FT                   SVGILSSISPKACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAIIQYREDIQEA
FT                   QPNLYSWKGFLDLADGISDEKLDKIIDTLKPNQCCALVYNQGTTGPSKAIMLSHDNITW
FT                   TTAAIVQSLGFKCPPQGQEILVSYLPLCFPGIQILDVWVAISVAGTVYFPSLDSGKWSG
FT                   LPRTPGTGFLMELLREVQPTTFCGIPWVWDRMLDSLKTKFLDSTAFRRRIDHWAMRMGL
FT                   HTNKKLMMGEIHQPLCFGLAKRLTFERARKFLGLNHCQQFLNMGMGLPSGTLDFFLSVN
FT                   IPIMELYGLSECTGLHTVSNLQAYRILSAGKALPKTHTKVEKENKDGIGNLCIWGRHIF
FT                   MGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKFLYVMGNNNDLIKLSSGEMVNPYPIEE
FT                   RVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINPETGEARSNLTSEVVACCRKLRSQST
FT                   WLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKIIKWVILDNDFSVDGGELGPMSKMN
FT                   RSIVVKIYQEEIQKLYETSTS"
FT   CDS             join(582145..582280,583247..583473,586337..586425,
FT                   586832..586952,588048..588128,588422..588571,
FT                   588769..588867,589197..589378,589508..589741,
FT                   590632..590849,590965..591104,592322..592568,
FT                   594518..594603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_a"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT128719.0
FT                   protein_id=mCP70752.1 isoform=CRA_a"
FT                   /protein_id="EDL38208.1"
FT                   /translation="MTDPKESDNLQTSRRILKTKTILKNKIHSAISKKAQADNFEILTP
FT                   GSSYWTSKREGQVQLRMGKDPLDNEPPVTVPDLIMSAATKYSHYLAIGSKYKKSWQLLT
FT                   YIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISP
FT                   KACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAIIQYREDIQEAQPNLYSWKGF
FT                   LDLADGISDEKLDKIIDTLKPNQCCALVYNQGTTGPSKAIMLSHDNILDVWVAISVAGT
FT                   VYFPSLDSGKWSGLPRTPGTGFLMELLREVQPTTFCGIPWVWDRMLDSLKTKFLDSTAF
FT                   RRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFERARKFLGLNHCQQFLNMGMG
FT                   LPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKALPKTHTKVEKENKD
FT                   GIGNLCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKFLYVMGNNNDLIKL
FT                   SSGEMVNPYPIEERVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINPETGEARSNLTSE
FT                   VVACCRKLRSQSTWLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKIIKWVILDNDFS
FT                   VDGGELGPMSKMNRSIVVKIYQEEIQKLYETSTS"
FT   CDS             join(582145..582280,583247..583506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_c"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT175250.0
FT                   protein_id=mCP98169.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D2T1"
FT                   /db_xref="MGI:MGI:1925875"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2T1"
FT                   /protein_id="EDL38210.1"
FT                   /translation="MTDPKESDNLQTSRRILKTKTILKNKIHSAISKKAQADNFEILTP
FT                   GSSYWTSKREGQVQLRMGKDPLDNEPPVTVPDLIMSAATKYSHYLAIGSKYKKSWQLLT
FT                   YIEYYEACRRAAKAFLKVRLLCKQVHR"
FT   mRNA            join(<585848..585915,586337..586425,586832..586952,
FT                   588048..588128,588422..>588517)
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, transcript variant mCT172060"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT172060.0
FT                   created on 28-OCT-2002"
FT   CDS             join(<585850..585915,586337..586425,586832..586952,
FT                   588048..588128,588422..>588517)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127436"
FT                   /product="mCG127436, isoform CRA_b"
FT                   /note="gene_id=mCG127436.1 transcript_id=mCT172060.0
FT                   protein_id=mCP94979.0 isoform=CRA_b"
FT                   /protein_id="EDL38209.1"
FT                   /translation="HGHRPCKGPGLKDTFCAKDASLVGLERFHGVGIMGINSSEWVIAS
FT                   IGAIMAGGISVGILSSISPKACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAII
FT                   QYREDIQEAQPNLYSWKGFLDLADGISDEKLDKIIDTLKPNQCCALV"
FT   gene            complement(<600343..>641371)
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /note="gene_id=mCG5570.2"
FT   mRNA            complement(join(<600343..600471,600548..600619,
FT                   600712..600783,600880..600979,602090..602198,
FT                   603261..603348,605650..606177,608444..608569,
FT                   611593..611736,625781..625863,632873..633053,
FT                   641145..>641371))
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), transcript variant
FT                   mCT3946"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT3946.2 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(600343..600471,600548..600619,
FT                   600712..600783,600880..600979,602090..602198,
FT                   603261..603348,605650..606177,608444..608569,
FT                   611593..611736,625781..625863,632873..633053,
FT                   641145..>641369))
FT                   /codon_start=1
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT3946.2
FT                   protein_id=mCP18162.1 isoform=CRA_a"
FT                   /protein_id="EDL38212.1"
FT                   /translation="EAGPESAAGGPRSLSRPGWRRFPVQRGWRAGGRPGTAAAAVRPPT
FT                   DNESGGALLSGGSESDAGPGAGRAPVMDNQCTVQVKLELGHRAQLRKKPTTEGFTHDWM
FT                   VFVRGPEQCDIQHFVEKVIFRLHDSFPKPKRVCKEPPYKVEESGYAGFIMLIEVYFKNK
FT                   EEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRCKLLMAGGVMVMPEGADTV
FT                   SRPSPDYPMLPTIPLSAFSDPKKNKPSHGSKDANKESGKASKPHKVAREHRERPRKDSE
FT                   SRSCSKEPEREPKSAKDAARKLPKEEKAPVPKAAFKEPKMALKETKLESLSPKGVPQPP
FT                   TLPKASSKRPAATDSPKLSAKKPKKSGSKGTRRAPGTSPRASSFPDKKVARDKNSKGDK
FT                   GKAESEPREAKRTLQTEDSNSEDEASFRSESAQSSPANASSSSDSSSDSDFEPSQNHSQ
FT                   GPLRSMVEDLQSEGSDEDDSSSGEENTGKANPGRESRLSFSDSESDNSADSCLPGREPL
FT                   PPQKPPPPSSKVSGRRSPEPCSKPEKMLKKATYDKAYTDELVELHRRLMALRERNVLQQ
FT                   IVNLIEETGHFNVTNTTFDFDLFSLDESTVRKLQSCLEAVAT"
FT   mRNA            complement(join(<606113..606177,611593..611736,
FT                   625781..625863,632873..633053,641145..>641371))
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), transcript variant
FT                   mCT170642"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT170642.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(<606113..606177,611593..611736,
FT                   625781..625863,632873..633053,641145..>641369))
FT                   /codon_start=1
FT                   /gene="Mllt1"
FT                   /locus_tag="mCG_5570"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 1 homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG5570.2 transcript_id=mCT170642.0
FT                   protein_id=mCP93560.0 isoform=CRA_b"
FT                   /protein_id="EDL38213.1"
FT                   /translation="EAGPESAAGGPRSLSRPGWRRFPVQRGWRAGGRPGTAAAAVRPPT
FT                   DNESGGALLSGGSESDAGPGAGRAPVMDNQCTVQVKLELGHRAQLRKKPTTEGFTHDWM
FT                   VFVRGPEQCDIQHFVEKVIFRLHDSFPKPKRVCKEPPYKVEESGYAGFIMLIEVYFKNK
FT                   EEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRCKLLMAGGDANKESGKASK
FT                   PHKVAREHRER"
FT   gene            complement(663469..>691235)
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /note="gene_id=mCG5600.1"
FT   mRNA            complement(join(663469..664372,664621..664758,
FT                   667438..667575,668020..668161,668248..668362,
FT                   691113..>691235))
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /product="N-acylsphingosine amidohydrolase (alkaline
FT                   ceramidase) 3"
FT                   /note="gene_id=mCG5600.1 transcript_id=mCT3926.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(664204..664372,664621..664758,
FT                   667438..667575,668020..668161,668248..668362,
FT                   691113..>691235))
FT                   /codon_start=1
FT                   /gene="Asah3"
FT                   /locus_tag="mCG_5600"
FT                   /product="N-acylsphingosine amidohydrolase (alkaline
FT                   ceramidase) 3"
FT                   /note="gene_id=mCG5600.1 transcript_id=mCT3926.1
FT                   protein_id=mCP18171.1"
FT                   /protein_id="EDL38214.1"
FT                   /translation="RMHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNV
FT                   FFLIFGPLMMFLMHPYAQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILW
FT                   LLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHI
FT                   LYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVL
FT                   ISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC"
FT   gene            699158..705483
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /note="gene_id=mCG5584.2"
FT   mRNA            join(699158..699639,699732..699803,700420..700516,
FT                   701952..702139,702574..702679,705004..705483)
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /product="caseinolytic peptidase, ATP-dependent,
FT                   proteolytic subunit homolog (E. coli)"
FT                   /note="gene_id=mCG5584.2 transcript_id=mCT3932.1 created on
FT                   17-JUL-2002"
FT   CDS             join(699454..699639,699732..699803,700420..700516,
FT                   701952..702139,702574..702679,705004..705173)
FT                   /codon_start=1
FT                   /gene="Clpp"
FT                   /locus_tag="mCG_5584"
FT                   /product="caseinolytic peptidase, ATP-dependent,
FT                   proteolytic subunit homolog (E. coli)"
FT                   /note="gene_id=mCG5584.2 transcript_id=mCT3932.1
FT                   protein_id=mCP18130.1"
FT                   /protein_id="EDL38215.1"
FT                   /translation="MWPRVLLGEARVAVDGCRALLSRLAVHFSPPWTAVSCSPLRRSLH
FT                   GTATRAFPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQS
FT                   ESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGSPGMR
FT                   HSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMER
FT                   DRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKETATAPTDPPAPTST"
FT   gene            <706463..708517
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /note="gene_id=mCG5589.0"
FT   mRNA            join(<706463..706693,707515..707688,707797..707921,
FT                   708056..708517)
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   transcript variant mCT3930"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT3930.1 created on
FT                   23-AUG-2002"
FT   CDS             join(<706463..706693,707515..707688,707797..707921,
FT                   708056..708218)
FT                   /codon_start=1
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT3930.1
FT                   protein_id=mCP18154.0 isoform=CRA_b"
FT                   /protein_id="EDL38217.1"
FT                   /translation="SACCGQSLKMAGSRRLAMRLLSGCAWVRGSDSAVLGRLRDEAVVH
FT                   PGFLSQEEEDTLTRELEPQLRRRRYEYDHWDAAIHGFRETEKSCWSDASQVILQRVRAA
FT                   AFGPDQSLLSPVHVLDLEPRGYIKPHVDSVKFCGSTIAGLSLLSPSVMKLVHTQEPEQW
FT                   LELLLEPGSLYILRGSARYDFSHEILRDEESFFGEHRVPRGRRISVICRSLPEGMGPGR
FT                   PEEPPPAC"
FT   mRNA            join(<706464..706693,707797..707921,708056..708420)
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   transcript variant mCT172071"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT172071.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(<706466..706693,707797..707921,708056..708218)
FT                   /codon_start=1
FT                   /gene="Alkbh7"
FT                   /locus_tag="mCG_5589"
FT                   /product="alkB, alkylation repair homolog 7 (E. coli),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5589.0 transcript_id=mCT172071.0
FT                   protein_id=mCP94990.0 isoform=CRA_a"
FT                   /protein_id="EDL38216.1"
FT                   /translation="ACCGQSLKMAGSRRLAMRLLSGCAWVRGSDSAVLGRLRDEAVVHP
FT                   GFLSQEEEDTLTRELEPQLRRRRYEYDHWDAFCGSTIAGLSLLSPSVMKLVHTQEPEQW
FT                   LELLLEPGSLYILRGSARYDFSHEILRDEESFFGEHRVPRGRRISVICRSLPEGMGPGR
FT                   PEEPPPAC"
FT   gene            complement(<708583..>709141)
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /note="gene_id=mCG5585.0"
FT   mRNA            complement(join(<708583..708899,708988..>709141))
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /product="persephin"
FT                   /note="gene_id=mCG5585.0 transcript_id=mCT3933.1 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(708583..708899,708988..709141))
FT                   /codon_start=1
FT                   /gene="Pspn"
FT                   /locus_tag="mCG_5585"
FT                   /product="persephin"
FT                   /note="gene_id=mCG5585.0 transcript_id=mCT3933.1
FT                   protein_id=mCP18135.1"
FT                   /db_xref="GOA:A1L3Q1"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1201684"
FT                   /db_xref="UniProtKB/TrEMBL:A1L3Q1"
FT                   /protein_id="EDL38218.1"
FT                   /translation="MAAGRLRILCLLLLSLHPSLGWVLDLQEASVADKLSFGKMAETRG
FT                   TWTPHQGNNHVRLPRALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEAHTQ
FT                   HSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG"
FT   gene            complement(712527..720543)
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /note="gene_id=mCG5591.1"
FT   mRNA            complement(join(712527..712757,712847..712937,
FT                   713041..713179,713248..713321,713435..713554,
FT                   713637..713698,713792..713945,714486..714670,
FT                   716112..716282,716839..717032,718814..718886,
FT                   720102..720148,720235..720543))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT3928"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT3928.2 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(712553..712757,712847..712937,
FT                   713041..713179,713248..713321,713435..713554,
FT                   713637..713698,713792..713945,714486..714670,
FT                   716112..716282,716839..717032,718814..718886,
FT                   720102..720148,720235..720246))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT3928.2
FT                   protein_id=mCP18165.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3THK3"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:1923848"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3THK3"
FT                   /protein_id="EDL38221.1"
FT                   /translation="MAALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQA
FT                   RLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNG
FT                   KSGRKFKGIKKGGVTENTAYYIFTQCADGAFEAFPVQNWYNFTPLARHRTLTAEEAEEE
FT                   WERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRSRKKPSELRIHDLEDDLEMSSDASD
FT                   ASGEEGSRTSKAKKKAPVTKAGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSS
FT                   PDETEGKPKVPQQEDGPKGVDEQSESSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKD
FT                   SSDDSDSSEESDIDSETSSALFMAKKKTPPKRERKPSGGSSKGTSRPGTPSAEAASTSS
FT                   TLRAAASKLEQGKRTSETPAAKRLRMDTGPQSLSGKSTPSSGDVQVTEDAVRRYLTRKP
FT                   MTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMIGDKMHFSLKE"
FT   mRNA            complement(join(712856..712937,713041..713058,
FT                   720092..720148,720235..720482))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170911"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170911.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(<712902..712937,713041..713156,
FT                   713637..713698,713792..713945,714486..>714528))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170912"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170912.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(<712902..712937,713041..713156,
FT                   713637..713698,713792..713945,714486..>714528))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170912.0
FT                   protein_id=mCP93829.0 isoform=CRA_d"
FT                   /protein_id="EDL38222.1"
FT                   /translation="LEMSSDASDASGEEGSRTSKAKKKAPVTKAGRKKKKKKGSDDEAF
FT                   EDSDDGDFEGQEVDYMSDGSSSSPDETEGKPKVPQQEDGPKGSGSHRGGVQRAPVGQGL
FT                   PVQKQQAPLLPCGLQPASWSRGSGRVRLQQPSV"
FT   mRNA            complement(join(<716149..716282,716839..717032,
FT                   718814..718886,720102..720437))
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   transcript variant mCT170910"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170910.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(<716149..716282,716839..717032,
FT                   718814..718861))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170910.0
FT                   protein_id=mCP93828.0 isoform=CRA_a"
FT                   /protein_id="EDL38219.1"
FT                   /translation="MAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNR
FT                   KLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTAYYIFTQCAD
FT                   GAFEAFPVQNWYNFTPLARHR"
FT   CDS             complement(join(720098..720148,720235..720246))
FT                   /codon_start=1
FT                   /gene="Gtf2f1"
FT                   /locus_tag="mCG_5591"
FT                   /product="general transcription factor IIF, polypeptide 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5591.1 transcript_id=mCT170911.0
FT                   protein_id=mCP93830.0 isoform=CRA_b"
FT                   /protein_id="EDL38220.1"
FT                   /translation="MAALGSSSQNVTEYVVRVPK"
FT   gene            <721722..>728727
FT                   /locus_tag="mCG_5576"
FT                   /note="gene_id=mCG5576.2"
FT   mRNA            join(<721722..721921,723778..723891,728530..>728727)
FT                   /locus_tag="mCG_5576"
FT                   /product="mCG5576"
FT                   /note="gene_id=mCG5576.2 transcript_id=mCT3949.2 created on
FT                   23-AUG-2002"
FT   CDS             join(<721724..721921,723778..723891,728530..>728727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5576"
FT                   /product="mCG5576"
FT                   /note="gene_id=mCG5576.2 transcript_id=mCT3949.2
FT                   protein_id=mCP18151.2"
FT                   /protein_id="EDL38223.1"
FT                   /translation="ILRYPLIIFVVGGPGCGKGTQCRNMALKYGFYHVELGQLLREEAQ
FT                   RSTQRGRQIRDIMQKGLLVPTGLILDMISDNLLSYPKIRGFLIDGFPRELEQAKEFERI
FT                   VGRAPNMVIVFDCSMETMVRRVLRRGQVEHRADDSEPAIRKRLETHYTLCEPVLTFYQQ
FT                   KNLLRHV"
FT   gene            complement(730177..>740634)
FT                   /locus_tag="mCG_140911"
FT                   /note="gene_id=mCG140911.0"
FT   mRNA            complement(join(730177..730974,731936..732096,
FT                   732185..732262,732339..732539,732631..732719,
FT                   732953..733062,733113..733297,733373..733618,
FT                   733915..734017,734106..734204,734434..734532,
FT                   734622..734796,735006..735063,735969..736040,
FT                   736175..736224,736943..736982,737082..737120,
FT                   738168..738264,740274..>740634))
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, transcript variant mCT172091"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT172091.0
FT                   created on 23-AUG-2002"
FT   mRNA            complement(join(730177..732096,732185..732262,
FT                   732339..732539,732631..732719,732953..733062,
FT                   733137..733297,733373..733618,733915..734017,
FT                   734106..734204,734434..734532,734622..734796,
FT                   735006..735063,735969..736040,736175..736224,
FT                   736943..736982,737082..737120,738168..738264,
FT                   740274..>740601))
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, transcript variant mCT193681"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT193681.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(730939..730974,731936..732096,
FT                   732185..732262,732339..732539,732631..732719,
FT                   732953..733062,733113..733297,733373..733618,
FT                   733915..734017,734106..734204,734434..734532,
FT                   734622..734796,735006..735063,735969..736040,
FT                   736175..736224,736943..736982,737082..737120,
FT                   738168..738264,740274..>740633))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, isoform CRA_a"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT172091.0
FT                   protein_id=mCP95010.0 isoform=CRA_a"
FT                   /protein_id="EDL38224.1"
FT                   /translation="IVLRGRVERGLVPALSRRRLRLLSLKPPHQARPRRAMSDYNTGGP
FT                   PPGPPPPAGGGGGAAGAGGGPPPGPPGAGDRGGGGPGGGGPGGGGASGGPSQPPGGGGP
FT                   GIRKDAFADAVQRARQIAAKIGGDAATTVNNNTPDFGFGGQKRQLEDGDQPDSKKLASQ
FT                   GDSIGSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSG
FT                   GLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGK
FT                   AGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDIL
FT                   RERDQGGFGDRNEYGSRVGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDD
FT                   GTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGAPGMPPGGRGRGRGQGNWG
FT                   PPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVIRGS
FT                   PQQIDHAKQLIEEKIEVRSWVLVKGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAP
FT                   PHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPNKAAAAATDPNAAWAAYYSHYYQQPPGP
FT                   VPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWE
FT                   EYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQ
FT                   QANEANGYELHL"
FT   CDS             complement(join(731819..732096,732185..732262,
FT                   732339..732539,732631..732719,732953..733062,
FT                   733137..733297,733373..733618,733915..734017,
FT                   734106..734204,734434..734532,734622..734796,
FT                   735006..735063,735969..736040,736175..736224,
FT                   736943..736982,737082..737120,738168..738264,
FT                   740274..>740600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140911"
FT                   /product="mCG140911, isoform CRA_b"
FT                   /note="gene_id=mCG140911.0 transcript_id=mCT193681.0
FT                   protein_id=mCP114641.0 isoform=CRA_b"
FT                   /protein_id="EDL38225.1"
FT                   /translation="VPALSRRRLRLLSLKPPHQARPRRAMSDYNTGGPPPGPPPPAGGG
FT                   GGAAGAGGGPPPGPPGAGDRGGGGPGGGGPGGGGASGGPSQPPGGGGPGIRKDAFADAV
FT                   QRARQIAAKIGGDAATTVNNNTPDFGFGGQKRQLEDGDQPDSKKLASQGDSIGSQLGPI
FT                   HPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTG
FT                   APESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGET
FT                   IKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDR
FT                   NEYGSRVGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIM
FT                   GPPDRCEHAARIINDLLQSLRSGPPGPPGAPGMPPGGRGRGRGQGNWGPPGGEMTFSIP
FT                   THKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVIRGSPQQIDHAKQLI
FT                   EEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNT
FT                   YPQWQPPAPHDPNKAAAAATDPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQ
FT                   PPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPP
FT                   GSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQASGNCHPPPPPFSFQPPA
FT                   TVHPALVGSAGNPFPCGVCP"
FT   gene            complement(741909..>749103)
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /note="gene_id=mCG140912.0"
FT   mRNA            complement(join(741909..742309,742846..742993,
FT                   743913..744080,747455..747562,747660..747812,
FT                   748948..>749103))
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /product="RIKEN cDNA 4933406J04"
FT                   /note="gene_id=mCG140912.0 transcript_id=mCT172090.0
FT                   created on 23-AUG-2002"
FT   CDS             complement(join(742122..742309,742846..742993,
FT                   743913..744080,747455..747562,747660..747812,
FT                   748948..>749103))
FT                   /codon_start=1
FT                   /gene="4933406J04Rik"
FT                   /locus_tag="mCG_140912"
FT                   /product="RIKEN cDNA 4933406J04"
FT                   /note="gene_id=mCG140912.0 transcript_id=mCT172090.0
FT                   protein_id=mCP95009.0"
FT                   /protein_id="EDL38226.1"
FT                   /translation="VLDTGEQLMVPVDVLEEENKGTLWKFLLSGAMAGAVSRTGTAPLD
FT                   RARVYMQVYSSKSNFRNLLSGLRSLVQEGGVRSLWRGNGINVLKIAPEYAIKFSVCEQS
FT                   KNFFYGVHSSQLFQERVVAGSLAVAVSQTLINPMEVLKTRLTLRFTGQYKGLLDCARQI
FT                   LERDGTRALYRGYLPNMLGIIPYACTDLAVYELLQCLWQKLGRDMKDPSGLVSLSSVTL
FT                   STTCGQMASYPLTLVRTRMQAQDTVEGSNPTMQGVFKRILSQQGWPGLYRGMTPTLLKV
FT                   LPAGGISYLVYEAMKKTLGVQVLSR"
FT   gene            complement(752844..>768958)
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /note="gene_id=mCG5562.2"
FT   mRNA            complement(join(752844..753060,763026..763066,
FT                   764398..764509,765702..765789,767228..>767258))
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, transcript variant
FT                   mCT170640"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT170640.0 created
FT                   on 19-JUL-2002"
FT   mRNA            complement(join(752849..754792,756311..756461,
FT                   761806..761973,762365..762472,762671..762823,
FT                   762908..763066,764398..764509,765702..765789,
FT                   767228..767354,768641..>768958))
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, transcript variant mCT3957"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT3957.2 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(752985..753060,763026..763066,
FT                   764398..764509,765702..765789,767228..767258))
FT                   /codon_start=1
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, isoform CRA_a"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT170640.0
FT                   protein_id=mCP93558.0 isoform=CRA_a"
FT                   /protein_id="EDL38227.1"
FT                   /translation="MFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDG
FT                   TMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFPIPSTLQDWILSL
FT                   DLGYPAPPLSL"
FT   CDS             complement(join(754608..754792,756311..756461,
FT                   761806..761973,762365..762472,762671..762823,
FT                   762908..763066,764398..764509,765702..765789,
FT                   767228..767354,768641..>768916))
FT                   /codon_start=1
FT                   /gene="Slc25a23"
FT                   /locus_tag="mCG_5562"
FT                   /product="solute carrier family 25 (mitochondrial carrier;
FT                   phosphate carrier), member 23, isoform CRA_b"
FT                   /note="gene_id=mCG5562.2 transcript_id=mCT3957.2
FT                   protein_id=mCP18160.2 isoform=CRA_b"
FT                   /protein_id="EDL38228.1"
FT                   /translation="RGCGAGGRGSWLCGDPGGEGEPESPRRGRRCGASPPPWAGAMRGG
FT                   SSDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGRGDPDRAQQGVSSDWDADPDG
FT                   GLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILH
FT                   SMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKLT
FT                   GMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSL
FT                   WRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGATAQTIIYPM
FT                   EVLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETL
FT                   KNRWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVSM
FT                   VGLLRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR"
FT   gene            768222..775037
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /note="gene_id=mCG5582.2"
FT   mRNA            join(768222..768273,771261..771348,771715..771886,
FT                   772757..772818,774210..775030)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT172070"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172070.0 created
FT                   on 23-AUG-2002"
FT   mRNA            join(771390..771493,771715..771886,772757..772818,
FT                   774210..774353,774729..775037)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT3937"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT3937.1 created on
FT                   23-AUG-2002"
FT   mRNA            join(771397..771493,771715..771886,772757..772818,
FT                   774210..775032)
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), transcript variant
FT                   mCT172069"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172069.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(771814..771886,772757..772818,774210..774353,
FT                   774729..774803)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT3937.1
FT                   protein_id=mCP18128.1 isoform=CRA_b"
FT                   /protein_id="EDL38231.1"
FT                   /translation="MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGL
FT                   SSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQFSHAAAEARAP
FT                   QDSKEPVRGCLPI"
FT   CDS             join(771814..771886,772757..772818,774210..774416)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172069.0
FT                   protein_id=mCP94989.0 isoform=CRA_a"
FT                   /protein_id="EDL38229.1"
FT                   /translation="MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGL
FT                   SSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQVGARAPPPPNL
FT                   KLPPEERLI"
FT   CDS             join(771814..771886,772757..772818,774210..774416)
FT                   /codon_start=1
FT                   /gene="Crb3"
FT                   /locus_tag="mCG_5582"
FT                   /product="crumbs homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5582.2 transcript_id=mCT172070.0
FT                   protein_id=mCP94988.0 isoform=CRA_a"
FT                   /protein_id="EDL38230.1"
FT                   /translation="MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGL
FT                   SSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQVGARAPPPPNL
FT                   KLPPEERLI"
FT   gene            complement(774440..787635)
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /note="gene_id=mCG127437.0"
FT   mRNA            complement(join(774440..775353,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   779233..779304,779528..779568,779650..779743,
FT                   780039..780143,780692..780817,780908..781009,
FT                   781129..781174,781456..781556,782893..783003,
FT                   783070..783147,783234..783299,783394..783474,
FT                   783613..783682,784489..784608,785767..785816,
FT                   785938..785981,786061..786125,787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT128720"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT128720.1
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(775025..775761,775852..776236,
FT                   776713..776820,776909..776953,779233..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783316,
FT                   783394..783474,783613..783682,784489..784679,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT172062"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172062.1
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(775176..775761,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   777037..777069,779233..779304,779528..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783299,
FT                   783394..783474,783613..783682,784489..784608,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT180823"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT180823.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(775231..775761,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   777037..777069,779233..779304,779528..779568,
FT                   779650..779743,780039..780143,780692..780817,
FT                   780908..781009,781129..781174,781456..781556,
FT                   782893..783003,783094..783147,783234..783299,
FT                   783394..783474,783613..783682,784489..784608,
FT                   785767..785816,785938..785981,786061..786125,
FT                   787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_c"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT180823.0
FT                   protein_id=mCP103745.0 isoform=CRA_c"
FT                   /protein_id="EDL38234.1"
FT                   /translation="MGSTETRHPPAMFDWFFEAGCPNSLEEDPPILRQFPPDFQEQEAM
FT                   QMVPRFCFPFDIEREPPSPAVQHFTFALTDLVGNRRFGFCRLRAGARSCLCILSHFPWF
FT                   EVFYKILNNVGDLLAQNQVAEAEELLQNLQQHPLLGPRFSGRSEMDSSITVRSECGILP
FT                   PALGNSKLLSCFVAPDAASLPSIPENRNLTELVVAVTDENIVGLFAALLAERRVLLTAS
FT                   KLSTLTACVHASCALLYPMRWEHVLIPTLPPHLLDYCCAPMPYLIGVHGSLAERVREKA
FT                   LEDVVVLNADSNTLETPFDDVQALPPDVVSLLRLRLRKVALSPGEGVSRLFLKVQALLF
FT                   GGYRDALVCIPGQPVTFSEEAFLAQKPGAPLQAFHKKAVHLQLFKQFIESRLEKLNAGE
FT                   GFSDQFEQEIIACRGASSGTLRSYQLWVDSLKKGSDALLHSMKTKTQPAVRNMYRSGDS
FT                   LQEYCASKAKSGLKGMQNLLTIKDGDSGLQRGGSLRTPSLTSRSDRLQQRLPISQHFGQ
FT                   NRPLRPSRRLKTEEGPSEPLRERSPTLSPGDTQNPWAEDTLDGSFLGSGEELDLLSEIL
FT                   DSLNVETKSGDLQRASQSLDCCQRGAASESCSSLPDIPVGLPWQLEEDKRSQDPQPWSL
FT                   PGDLSLLQDTPFSEVVSYSKNSCSQPFQQSPPSQGDPGPSLSKLDPRPSQSPCPKLLRV
FT                   PTRHSPPESPQLLVSTEPNSDAVQRLQSISSPSCSHSAENPRNQPPQVLLGQACVQPLE
FT                   ELGAPTYVSHVSTQQRPQDKQPRVADLKKCFEN"
FT   CDS             complement(join(775231..775353,775852..776062,
FT                   776169..776236,776713..776820,776909..776953,
FT                   779233..779304,779528..779568,779650..779743,
FT                   780039..780143,780692..780817,780908..781009,
FT                   781129..781174,781456..781556,782893..783003,
FT                   783070..783147,783234..783299,783394..783474,
FT                   783613..783682,784489..784608,785767..785816,
FT                   785938..785981,786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_a"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT128720.1
FT                   protein_id=mCP70759.1 isoform=CRA_a"
FT                   /protein_id="EDL38232.1"
FT                   /translation="MGSTETRHPPAMFDWFFEAGCPNSLEEDPPILRQFPPDFQEQEAM
FT                   QMVPRFCFPFDIEREPPSPAVQHFTFALTDLVGNRRFGFCRLRAGARSCLCILSHFPWF
FT                   EVFYKILNNVGDLLAQNQVAEAEELLQNLQQHPLLGPRFSGRSEMDSSITVRSECGILP
FT                   PALGNSKLLSCFVAPDAASLPSIPENVSKEELQKRNLTELVVAVTDENIVGLFAALLAE
FT                   RRVLLTASKLSTLTACVHASCALLYPMRWEHVLIPTLPPHLLDYCCAPMPYLIGVHGSL
FT                   AERVREKALEDVVVLNADSNTLETPFDDVQALPPDVVSLLRLRLRKVALSPGEGVSRLF
FT                   LKVQALLFGGYRDALVCIPGQPVTFSEEAFLAQKPGAPLQAFHKKAVHLQLFKQFIESR
FT                   LEKLNAGEGFSDQFEQEIIACRGASSGTLRSYQLWVDSLKKGSDALLHSMKTKTQPAVR
FT                   NMYRSAKSGLKGMQNLLTIKDGDSGLQRGGSLRTPSLTSRSDRLQQRLPISQHFGQNRP
FT                   LRPSRRLKTEEGPSEPLRERSPTLSPGDTQNPWAEDTLDGSFLGSGEELDLLSEILDSL
FT                   NVETKSGDLQRASQSLDCCQRGAASESCSSLACVQPLEELGAPTYVSHVSTQQRPQDKQ
FT                   PRVADLKKCFEN"
FT   mRNA            complement(join(781289..783003,783094..783147,
FT                   783234..783299,783394..783474,783613..783682,
FT                   784489..784608,785767..785816,785938..785981,
FT                   786061..786125,787510..787635))
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, transcript
FT                   variant mCT172061"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172061.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(782767..783003,783094..783147,
FT                   783234..783299,783394..783474,783613..783682,
FT                   784489..784608,785767..785816,785938..785981,
FT                   786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_d"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172061.0
FT                   protein_id=mCP94981.0 isoform=CRA_d"
FT                   /protein_id="EDL38235.1"
FT                   /translation="MGSTETRHPPAMFDWFFEAGCPNSLEEDPPILRQFPPDFQEQEAM
FT                   QMVPRFCFPFDIEREPPSPAVQHFTFALTDLVGNRRFGFCRLRAGARSCLCILSHFPWF
FT                   EVFYKILNNVGDLLAQNQVAEAEELLQNLQQHPLLGPRFSGRSEMDSSITVRSECGILP
FT                   PALGNSKLLSCFVAPDAASLPSIPENRNLTELVVAVTDENIVGLFAALLAERRVLLTAS
FT                   KLSTVRRDHFSRGRDTIKPFFCSVPPLSEQSEEVAQWLQFIGSTI"
FT   CDS             complement(join(784670..784679,785767..785816,
FT                   785938..785981,786061..786125,787510..787526))
FT                   /codon_start=1
FT                   /gene="Dennd1c"
FT                   /locus_tag="mCG_127437"
FT                   /product="DENN/MADD domain containing 1C, isoform CRA_b"
FT                   /note="gene_id=mCG127437.0 transcript_id=mCT172062.1
FT                   protein_id=mCP94980.1 isoform=CRA_b"
FT                   /protein_id="EDL38233.1"
FT                   /translation="MGSTETRHPPAMFDWFFEAGCPNSLEEDPPILRQFPPDFQEQEAM
FT                   QMVPRFCFPFDIERPP"
FT   gene            complement(789186..796722)
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /note="gene_id=mCG5587.2"
FT   mRNA            complement(join(789186..790867,795112..795222,
FT                   795352..795460,796578..796722))
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /product="tubulin, beta 4"
FT                   /note="gene_id=mCG5587.2 transcript_id=mCT3935.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(789810..790867,795112..795222,
FT                   795352..795460,796578..796634))
FT                   /codon_start=1
FT                   /gene="Tubb4"
FT                   /locus_tag="mCG_5587"
FT                   /product="tubulin, beta 4"
FT                   /note="gene_id=mCG5587.2 transcript_id=mCT3935.1
FT                   protein_id=mCP18144.0"
FT                   /protein_id="EDL38236.1"
FT                   /translation="MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE
FT                   RINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRI
FT                   MNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTY
FT                   GDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQY
FT                   RALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSY
FT                   FVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYT
FT                   GEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA"
FT   gene            complement(801126..>815653)
FT                   /locus_tag="mCG_145591"
FT                   /note="gene_id=mCG145591.0"
FT   mRNA            complement(join(801126..802527,813085..813219,
FT                   815628..>815653))
FT                   /locus_tag="mCG_145591"
FT                   /product="mCG145591"
FT                   /note="gene_id=mCG145591.0 transcript_id=mCT185015.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(802104..>802418)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145591"
FT                   /product="mCG145591"
FT                   /note="gene_id=mCG145591.0 transcript_id=mCT185015.0
FT                   protein_id=mCP106313.0"
FT                   /protein_id="EDL38237.1"
FT                   /translation="YVHIFSDLGNPSLAVSHMWHHLLAICPLVPPPSIAKAVGSLDLHL
FT                   ATRCCRKELRRQTQLSTNSTLILGNPSIPNTPVLGQRILCLFGSLSSKISTHCQFNDTI
FT                   "
FT   gene            815046..817492
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /note="gene_id=mCG5588.2"
FT   mRNA            join(815046..815590,815980..816016,816771..817492)
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 9"
FT                   /note="gene_id=mCG5588.2 transcript_id=mCT3936.2 created on
FT                   19-JUL-2002"
FT   CDS             join(815162..815590,815980..816016,816771..817234)
FT                   /codon_start=1
FT                   /gene="Tnfsf9"
FT                   /locus_tag="mCG_5588"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 9"
FT                   /note="gene_id=mCG5588.2 transcript_id=mCT3936.2
FT                   protein_id=mCP18146.1"
FT                   /db_xref="GOA:Q3U1Z9"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="MGI:MGI:1101058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1Z9"
FT                   /protein_id="EDL38238.1"
FT                   /translation="MDQHTLDVEDTADARHPAGTSCPSDAALLRDTGLLADAALLSDTV
FT                   RPTNAALPTDAAYPAVNVRDREAAWPPALNFCSRHPKLYGLVALVLLLLIAACVPIFTR
FT                   TEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTT
FT                   LNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVS
FT                   LVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQ
FT                   DAYRDWELSYPNTTSFGLFLVKPDNPWE"
FT   gene            complement(856660..860439)
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /note="gene_id=mCG5599.1"
FT   mRNA            complement(join(856660..857122,859429..859462,
FT                   860096..860439))
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 7"
FT                   /note="gene_id=mCG5599.1 transcript_id=mCT3924.1 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(856737..857122,859429..859462,
FT                   860096..860263))
FT                   /codon_start=1
FT                   /gene="Tnfsf7"
FT                   /locus_tag="mCG_5599"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 7"
FT                   /note="gene_id=mCG5599.1 transcript_id=mCT3924.1
FT                   protein_id=mCP18169.2"
FT                   /db_xref="GOA:Q05A52"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1195273"
FT                   /db_xref="UniProtKB/TrEMBL:Q05A52"
FT                   /protein_id="EDL38239.1"
FT                   /translation="MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLS
FT                   KQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDG
FT                   LYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYL
FT                   VHGDVLCTNLTLPLLPSRNADETFFGVQWICP"
FT   gene            complement(899238..>903930)
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /note="gene_id=mCG5572.0"
FT   mRNA            complement(join(899238..900684,902305..902346,
FT                   902649..902685,903603..>903930))
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 14"
FT                   /note="gene_id=mCG5572.0 transcript_id=mCT3948.0 created on
FT                   19-JUL-2002"
FT   CDS             complement(join(900257..900684,902305..902346,
FT                   902649..902685,903603..>903929))
FT                   /codon_start=1
FT                   /gene="Tnfsf14"
FT                   /locus_tag="mCG_5572"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 14"
FT                   /note="gene_id=mCG5572.0 transcript_id=mCT3948.0
FT                   protein_id=mCP18127.0"
FT                   /protein_id="EDL38240.1"
FT                   /translation="PFAVCTARACWAIVVSSGEEELRLANPFPGLRSLSCSGMESVVQP
FT                   SVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDI
FT                   VAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLT
FT                   YHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRR
FT                   SPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV"
FT   gene            complement(913189..>937295)
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /note="gene_id=mCG140909.1"
FT   mRNA            complement(join(913189..913339,931408..931563,
FT                   932001..932207,932333..>932513))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172072"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172072.0
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(913190..913327,931210..931230,
FT                   931408..931563,932001..>932039))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172073"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172073.0
FT                   created on 05-MAR-2003"
FT   mRNA            complement(join(913196..913376,913473..913608,
FT                   913689..913772,914519..914602,914878..914967,
FT                   915412..915517,916556..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   919377..919535,920784..920947,921817..921973,
FT                   922978..923076,923888..924047,924326..924401,
FT                   924941..925144,926297..926383,926478..926544,
FT                   927671..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930385,930535..930606,
FT                   931101..931230,931408..931563,932001..932207,
FT                   932333..932542,933043..933189,933275..933390,
FT                   933499..933625,933856..933958,934065..934155,
FT                   934247..934329,934428..934522,935209..935279,
FT                   935378..935543,935905..936094,937156..>937291))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172077"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172077.1
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(913235..913376,913473..913608,
FT                   913689..913772,914519..914602,914878..914967,
FT                   915412..915517,916556..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   919377..919535,920784..920947,921817..921973,
FT                   922978..923076,923888..924047,924326..924401,
FT                   924941..925144,926297..926383,926478..926544,
FT                   927671..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930385,930535..930606,
FT                   931101..931230,931408..931563,932001..932207,
FT                   932333..932542,933043..933189,933275..933390,
FT                   933499..933625,933856..933958,934065..934155,
FT                   934247..934329,934428..934522,935209..935279,
FT                   935378..935543,935905..936094,937156..>937289))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_c"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172077.1
FT                   protein_id=mCP94996.1 isoform=CRA_c"
FT                   /protein_id="EDL38243.1"
FT                   /translation="LCPPLPLTPSFLPPFSFTMGPASGSQLLVLLLLLASSPLALGIPM
FT                   YSIITPNVLRLESEETIVLEAHDAQGDIPVTVTVQDFLKRQVLTSEKTVLTGASGHLRS
FT                   VSIKIPASKEFNSDKEGHKYVTVVANFGETVVEKAVMVSFQSGYLFIQTDKTIYTPGST
FT                   VLYRIFTVDNNLLPVGKTVVILIETPDGIPVKRDILSSNNQHGILPLSWNIPELVNMGQ
FT                   WKIRAFYEHAPKQIFSAEFEVKEYVLPSFEVRVEPTETFYYIDDPNGLEVSIIAKFLYG
FT                   KNVDGTAFVIFGVQDGDKKISLAHSLTRVVIEDGVGDAVLTRKVLMEGVRPSNADALVG
FT                   KSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTKTPKFFKPAMPFDLMVFVTNPD
FT                   GSPASKVLVVTQGSNAKALTQDDGVAKLSINTPNSRQPLTITVRTKKDTLPESRQATKT
FT                   MEAHPYSTMHNSNNYLHLSVSRMELKPGDNLNVNFHLRTDPGHEAKIRYYTYLVMNKGK
FT                   LLKAGRQVREPGQDLVVLSLPITPEFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDS
FT                   CIGTLVVKGDPRDNHLAPGQQTTLRIEGNQGARVGLVAVDKGVFVLNKKNKLTQSKIWD
FT                   VVEKADIGCTPGSGKNYAGVFMDAGLAFKTSQGLQTEQRADLECTKPAARRRRSVQLME
FT                   RRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLR
FT                   EQHRRDHVLGLARSELEEDIIPEEDIISRSHFPQSWLWTIEELKEPEKNGISTKVMNIF
FT                   LKDSITTWEILAVSLSDKKGICVADPYEIRVMQDFFIDLRLPYSVVRNEQVEIRAVLFN
FT                   YREQEELKVRVELLHNPAFCSMATAKNRYFQTIKIPPKSSVAVPYVIVPLKIGQQEVEV
FT                   KAAVFNHFISDGVKKTLKVVPEGMRINKTVAIHTLDPEKLGQGGVQKVDVPAADLSDQV
FT                   PDTDSETRIILQGSPVVQMAEDAVDGERLKHLIVTPAGCGEQNMIGMTPTVIAVHYLDQ
FT                   TEQWEKFGIEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTAYVVKVFSLA
FT                   ANLIAIDSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNAKEADVSLTAFVL
FT                   IALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMNKLEEPYL
FT                   GKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQRYYGGGY
FT                   GSTQATFMVFQALAQYQTDVPDHKDLNMDVSFHLPSRSSATTFRLLWENGNLLRSEETK
FT                   QNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTM
FT                   FLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNT
FT                   LIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGML
FT                   SKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEY
FT                   TMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSY
FT                   IIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN"
FT   CDS             complement(join(913235..913339,931408..931563,
FT                   932001..932207,932333..>932512))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_a"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172072.0
FT                   protein_id=mCP94999.0 isoform=CRA_a"
FT                   /protein_id="EDL38241.1"
FT                   /translation="SRQATKTMEAHPYSTMHNSNNYLHLSVSRMELKPGDNLNVNFHLR
FT                   TDPGHEAKIRYYTYLVMNKGKLLKAGRQVREPGQDLVVLSLPITPEFIPSFRLVAYYTL
FT                   IGASGQREVVADSVWVDVKDSCIGTLVVKGDPRDNHLAPGQQTTLRIEGNQGARVGLVA
FT                   VDKGVFVLNKKNKLTQSKHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN"
FT   CDS             complement(join(913235..913327,931210..931230,
FT                   931408..931563,932001..>932039))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_f"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172073.0
FT                   protein_id=mCP94992.0 isoform=CRA_f"
FT                   /db_xref="GOA:H3BL60"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="MGI:MGI:88227"
FT                   /db_xref="UniProtKB/TrEMBL:H3BL60"
FT                   /protein_id="EDL38246.1"
FT                   /translation="SVWVDVKDSCIGTLVVKGDPRDNHLAPGQQTTLRIEGNQGARVGL
FT                   VAVDKGVFVLNKKNKLTQSKIWDVVEKAEECQDQKYQKQCEELGAFTESMVVYGCPN"
FT   mRNA            complement(join(913281..913376,913473..913497,
FT                   919390..919535,920784..920947,921817..>921865))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172076"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172076.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(913494..913497,919390..919535,
FT                   920784..920947,921817..>921865))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_g"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172076.0
FT                   protein_id=mCP94994.0 isoform=CRA_g"
FT                   /protein_id="EDL38247.1"
FT                   /translation="NKLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLK
FT                   DFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNMDVSFHLPSR
FT                   SSATTFRLLWENGNLL"
FT   mRNA            complement(join(<913709..913772,914519..914602,
FT                   914878..914967,915412..915517,916556..916645,
FT                   916754..916841,918461..918489,923897..924047,
FT                   924326..>924407))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172079"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172079.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(<913709..913772,914519..914602,
FT                   914878..914967,915412..915517,916556..916645,
FT                   916754..916841,918461..918489,923897..924047,
FT                   924326..>924405))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_d"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172079.0
FT                   protein_id=mCP95001.0 isoform=CRA_d"
FT                   /protein_id="EDL38244.1"
FT                   /translation="TGYTQQLAFKQPSSAYAAFNNRPPSTWLTAYVVKVFSLAANLIAI
FT                   DSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQNTMFLEICTKYLGDVDATMSILDISMM
FT                   TGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYF
FT                   NVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEK
FT                   INLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMT"
FT   mRNA            complement(join(<916555..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   927857..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930235,936050..936094,
FT                   937156..937203))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172075"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172075.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(<916555..916645,916754..916841,
FT                   918461..918512,918633..918723,918811..918870,
FT                   927857..927883,928010..928152,928752..928837,
FT                   929306..929414,930185..930235,936050..936074))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_b"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172075.0
FT                   protein_id=mCP95000.0 isoform=CRA_b"
FT                   /protein_id="EDL38242.1"
FT                   /translation="MSYGWRAKTKLREQHRRDHVLGLARSELEEDIIPEEDIISRSHFP
FT                   QSWLWTIEELKEPEKNGISTKVMNIFLKDSITTWEILAVSLSDKKGICVADPYEIRVMQ
FT                   DFFIDLRLPYSVVRNEQVEIRAVLFNYREQEELKVRVELLHNPTKQNEAFSLTAKGKGR
FT                   GTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDA
FT                   TMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEK"
FT   mRNA            complement(join(918645..918723,918811..918855,
FT                   935441..935543,935905..936094,937156..>937295))
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, transcript variant
FT                   mCT172081"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172081.0
FT                   created on 05-MAR-2003"
FT   CDS             complement(join(918668..918723,918811..918855,
FT                   935441..935543,935905..936094,937156..>937295))
FT                   /codon_start=1
FT                   /gene="C3"
FT                   /locus_tag="mCG_140909"
FT                   /product="complement component 3, isoform CRA_e"
FT                   /note="gene_id=mCG140909.1 transcript_id=mCT172081.0
FT                   protein_id=mCP95002.0 isoform=CRA_e"
FT                   /protein_id="EDL38245.1"
FT                   /translation="ARLCPPLPLTPSFLPPFSFTMGPASGSQLLVLLLLLASSPLALGI
FT                   PMYSIITPNVLRLESEETIVLEAHDAQGDIPVTVTVQDFLKRQVLTSEKTVLTGASGHL
FT                   RSVSIKIPASKEFNSDKEGHKYVTVVANFGETVVEKAVMVSLLSNSQRKRPRHIVGGGS
FT                   VSCQTQKQSHLQEV"
FT   gene            complement(943833..>957644)
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /note="gene_id=mCG140910.0"
FT   mRNA            complement(join(943833..944251,944499..944564,
FT                   945121..945245,945354..945437,945572..945621,
FT                   945895..945938,946069..946199,946404..946521,
FT                   946622..946695,947049..947124,947228..947361,
FT                   951932..952036,952139..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956709..956889))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172082"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172082.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(943833..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952311,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..956889))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172078"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172078.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(943833..944462,945172..945245,
FT                   945354..945437,945572..945621,945895..945923))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172080"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172080.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(944115..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952332,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..>956839))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT193679"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT193679.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(944137..944251,944499..944564,
FT                   945121..945245,945354..945437,945572..945621,
FT                   945895..945938,946069..946199,946404..946521,
FT                   946622..946695,947049..947124,947228..947361,
FT                   951932..952036,952139..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956709..956834))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_e"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172082.1
FT                   protein_id=mCP94991.1 isoform=CRA_e"
FT                   /protein_id="EDL38252.1"
FT                   /translation="MAVSERRGLSGESPTQCRWGYLSLLVLTLSGCSGRIHRLTLTGEK
FT                   RADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLPKVGFSLSRVRSGSVRSYSRRNSH
FT                   ECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGLLPEAPTQSGPPKPDPAGTP
FT                   KDNHEMSAVKENQTAPQVSGDKTTPGEHRHSSERQPPTQDPSGKEKDQVLGLGHLNDSY
FT                   NFSFHIVISSRAEEGQYSLNFHNCHNSIPGQEQPFDLTVMIREKNPEGFLSAAEIPLFK
FT                   LYLIMSACFLAADIFWVSVLCKNTYSVFKIHWLMAALAFTKSVSLLFHSINYYFINSQG
FT                   HPIEGLAVMHYITHLLKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANV
FT                   AYIVIESREEGASDYGLWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLA
FT                   RLKLFRHYYVMVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQP
FT                   AGDNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELYDLSSRGGTCLSSHC
FT                   SGEPGLHKTLISKQIKKKWNSQ"
FT   CDS             complement(join(944246..944462,945172..945245,
FT                   945354..945437,945572..945574))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_b"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172080.1
FT                   protein_id=mCP94995.1 isoform=CRA_b"
FT                   /protein_id="EDL38249.1"
FT                   /translation="MVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGY
FT                   KFQPAGDNPPPAPRTPTLVPSVQGAGGDAADKASRMWIPKEPSEKMPSPHQGASSSASC
FT                   GTIRTSLLTWRVLSIYGRLHL"
FT   CDS             complement(join(944492..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952332,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..>956837))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_c"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT193679.0
FT                   protein_id=mCP114640.0 isoform=CRA_c"
FT                   /protein_id="EDL38250.1"
FT                   /translation="EMAVSERRGLSGESPTQCRWGYLSLLVLTLSGCSGRIHRLTLTGE
FT                   KRADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLPKVGFSLSRVRSGSVRSYSRRNS
FT                   HECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGLLPEAPTQSGPPKPDPAGT
FT                   PKDNHVIHPSPTEMSAVKENQTAPQVSGDKTTPGEHRHSSERQPPTQDPSGKEKDQVLG
FT                   LGHLNDSYNFSFHIVISSRAEEGQYSLNFHNCHNSIPGQEQPFDLTVMIREKNPEGFLS
FT                   AAEIPLFKLYLIMSACFLAADIFWVSVLCKNTYSVFKIHWLMAALAFTKSVSLLFHSIN
FT                   YYFINSQGHPIEGLAVMHYITHLLKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVI
FT                   PLQVLANVAYIVIESREEGASDYGLWKEILFLVDLICCGAILFPVVWSIRHLQDASGTD
FT                   GKVAVNLARLKLFRHYYVMVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFV
FT                   LTGYKFQPAGDNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL"
FT   CDS             complement(join(944492..944564,945121..945245,
FT                   945354..945437,945572..945621,945895..945938,
FT                   946069..946199,946404..946521,946622..946695,
FT                   947049..947124,947228..947361,951932..952036,
FT                   952139..952311,953445..953566,954227..954309,
FT                   954493..954543,955962..956081,956709..956834))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_d"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172078.1
FT                   protein_id=mCP94997.1 isoform=CRA_d"
FT                   /protein_id="EDL38251.1"
FT                   /translation="MAVSERRGLSGESPTQCRWGYLSLLVLTLSGCSGRIHRLTLTGEK
FT                   RADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLPKVGFSLSRVRSGSVRSYSRRNSH
FT                   ECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGLLPEAPTQSGPPKPDPAGTP
FT                   KDNHEMSAVKENQTAPQVSGDKTTPGEHRHSSERQPPTQDPSGKEKDQVLGLGHLNDSY
FT                   NFSFHIVISSRAEEGQYSLNFHNCHNSIPGQEQPFDLTVMIREKNPEGFLSAAEIPLFK
FT                   LYLIMSACFLAADIFWVSVLCKNTYSVFKIHWLMAALAFTKSVSLLFHSINYYFINSQG
FT                   HPIEGLAVMHYITHLLKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANV
FT                   AYIVIESREEGASDYGLWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLA
FT                   RLKLFRHYYVMVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQP
FT                   AGDNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL"
FT   mRNA            complement(join(<952281..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956503..>956667))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172083"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172083.0
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(<952281..952311,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   956503..>956520))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_f"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172083.0
FT                   protein_id=mCP94993.0 isoform=CRA_f"
FT                   /protein_id="EDL38253.1"
FT                   /translation="TFREHLGEKRADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLP
FT                   KVGFSLSRVRSGSVRSYSRRNSHECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFI
FT                   SPGLLPEAPTQSGPPKPDPAGTPKDNHEMSAVKENQTA"
FT   mRNA            complement(join(<952307..952332,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   957305..>957644))
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, transcript
FT                   variant mCT172074"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172074.0
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(<952307..952332,953445..953566,
FT                   954227..954309,954493..954543,955962..956081,
FT                   957305..>957310))
FT                   /codon_start=1
FT                   /gene="Gpr108"
FT                   /locus_tag="mCG_140910"
FT                   /product="G protein-coupled receptor 108, isoform CRA_a"
FT                   /note="gene_id=mCG140910.0 transcript_id=mCT172074.0
FT                   protein_id=mCP94998.0 isoform=CRA_a"
FT                   /protein_id="EDL38248.1"
FT                   /translation="NKGEKRADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLPKVGF
FT                   SLSRVRSGSVRSYSRRNSHECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGL
FT                   LPEAPTQSGPPKPDPAGTPKDNHVIHPSPTEM"
FT   gene            <958647..972889
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /note="gene_id=mCG5573.2"
FT   mRNA            join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971546..971664,972192..972889)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT3945"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT3945.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971546..971664,972192..972614)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT170909"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT170909.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971546..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT3945.2
FT                   protein_id=mCP18166.2 isoform=CRA_d"
FT                   /protein_id="EDL38257.1"
FT                   /translation="RGEVGHTALGLSLRWRAAETRAGGGGVLGGKSSMDWGTELWDQFE
FT                   VLERHTQWGLDLLDKYVKFVKERAEVEQAYAKQLRSLVKKYLPKRPTKDDPEVKFSQQQ
FT                   SFVQLLQEVNDFAGQRELVAESLGIRVCLELAKYSQEMKQERKMHFQEGRRAQQQLENG
FT                   FKQLENSKRKFERDCREAEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNE
FT                   YAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKC
FT                   LEGMKVAAESVDAKNDSQVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRP
FT                   ELRAASSRSRAKRWPFGKKNKPRPPSLSLLGGHLPSTLSDGPSSPRSGRDPLAILSEIS
FT                   KSVKPRLASFRSFRGGRGTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQREALK
FT                   KMKDVYEKTPQMGDPASLEPRIAETLGNIERLKLEVQKYEAWLAEAESRVLSNRGDSLS
FT                   RHARPPDPPTTAPPDSSSSSTNSGSQDNKESSSEEPPSEGQDTPIYTEFDEDFEEPASP
FT                   IGQCVAIYHFEGSSEGTVSMSEGEDLSLMEEDKGDGWTRVRRKQGAEGYVPTSYLRVTL
FT                   N"
FT   CDS             join(<958647..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971546..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT170909.0
FT                   protein_id=mCP93827.0 isoform=CRA_a"
FT                   /protein_id="EDL38254.1"
FT                   /translation="RGEVGHTALGLSLRWRAAETRAGGGGVLGGKSSMDWGTELWDQFE
FT                   VLERHTQWGLDLLDKYVKFVKERAEVEQAYAKQLRSLVKKYLPKRPTKDDPEVKFSQQQ
FT                   SFVQLLQEVNDFAGQRELVAESLGIRVCLELAKYSQEMKQERKMHFQEGRRAQQQLENG
FT                   FKQLENSKRKFERDCREAEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNE
FT                   YAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKC
FT                   LEGMKVAAESVDAKNDSQVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRP
FT                   ELRAASSRSRAKRWPFGKKNKTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQRE
FT                   ALKKMKDVYEKTPQMGDPASLEPRIAETLGNIERLKLEVQKYEAWLAEAESRVLSNRGD
FT                   SLSRHARPPDPPTTAPPDSSSSSTNSGSQDNKESSSEEPPSEGQDTPIYTEFDEDFEEP
FT                   ASPIGQCVAIYHFEGSSEGTVSMSEGEDLSLMEEDKGDGWTRVRRKQGAEGYVPTSYLR
FT                   VTLN"
FT   mRNA            join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971549..971664,972192..972619)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT193675"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193675.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971549..971664,972192..972611)
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10,
FT                   transcript variant mCT193676"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193676.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966052..966219,966427..966536,970482..970614,
FT                   970832..970980,971549..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193675.0
FT                   protein_id=mCP114663.0 isoform=CRA_b"
FT                   /protein_id="EDL38255.1"
FT                   /translation="AETRAGGGGVLGGKSSMDWGTELWDQFEVLERHTQWGLDLLDKYV
FT                   KFVKERAEVEQAYAKQLRSLVKKYLPKRPTKDDPEVKFSQQQSFVQLLQEVNDFAGQRE
FT                   LVAESLGIRVCLELAKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCRE
FT                   AEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNEYAAQLQRFNRDQAHFYF
FT                   SQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKCLEGMKVAAESVDAKNDS
FT                   QVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRPELRAASSRSRAKRWPFG
FT                   KKNKPRPPSLSLLGGHLPSTLSDGPSSPRSGRDPLAILSEISKSVKPRLASFRSFRGGR
FT                   GTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQREALKKMKDVYEKTPQMGDPAS
FT                   LEPRIAETLGNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPTTAPPDSS
FT                   SSSTNSGSQDNKESSEEPPSEGQDTPIYTEFDEDFEEPASPIGQCVAIYHFEGSSEGTV
FT                   SMSEGEDLSLMEEDKGDGWTRVRRKQGAEGYVPTSYLRVTLN"
FT   CDS             join(<958698..958769,959940..960055,960153..960209,
FT                   962454..962601,962689..962751,963249..963353,
FT                   963452..963580,964210..964356,964465..964659,
FT                   966427..966536,970482..970614,970832..970980,
FT                   971549..971664,972192..972340)
FT                   /codon_start=1
FT                   /gene="Trip10"
FT                   /locus_tag="mCG_5573"
FT                   /product="thyroid hormone receptor interactor 10, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5573.2 transcript_id=mCT193676.0
FT                   protein_id=mCP114664.0 isoform=CRA_c"
FT                   /protein_id="EDL38256.1"
FT                   /translation="AETRAGGGGVLGGKSSMDWGTELWDQFEVLERHTQWGLDLLDKYV
FT                   KFVKERAEVEQAYAKQLRSLVKKYLPKRPTKDDPEVKFSQQQSFVQLLQEVNDFAGQRE
FT                   LVAESLGIRVCLELAKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCRE
FT                   AEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNEYAAQLQRFNRDQAHFYF
FT                   SQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKCLEGMKVAAESVDAKNDS
FT                   QVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRPELRAASSRSRAKRWPFG
FT                   KKNKTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQREALKKMKDVYEKTPQMGD
FT                   PASLEPRIAETLGNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPTTAPP
FT                   DSSSSSTNSGSQDNKESSEEPPSEGQDTPIYTEFDEDFEEPASPIGQCVAIYHFEGSSE
FT                   GTVSMSEGEDLSLMEEDKGDGWTRVRRKQGAEGYVPTSYLRVTLN"
FT   gene            989376..1038888
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /note="gene_id=mCG140673.0"
FT   mRNA            join(989376..989686,1006280..1006396,1006850..1006908,
FT                   1006998..1007066,1007347..1007455,1007544..1007639,
FT                   1009070..1009138,1009399..1009502,1010140..1010239,
FT                   1011479..1011574,1012159..1012227,1012372..1012458,
FT                   1012563..1012648,1013313..1013445,1014132..1014241,
FT                   1015122..1015223,1015578..1015675,1015757..1015779,
FT                   1015961..1016006,1016405..1016541,1017332..1017397,
FT                   1019750..1019781,1022073..1022189,1025533..1025620,
FT                   1028917..1029031,1035578..1035729,1038584..1038888)
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /product="vav 1 oncogene"
FT                   /note="gene_id=mCG140673.0 transcript_id=mCT170643.0
FT                   created on 19-JUL-2002"
FT   CDS             join(989483..989686,1006280..1006396,1006850..1006908,
FT                   1006998..1007066,1007347..1007455,1007544..1007639,
FT                   1009070..1009138,1009399..1009502,1010140..1010239,
FT                   1011479..1011574,1012159..1012227,1012372..1012458,
FT                   1012563..1012648,1013313..1013445,1014132..1014241,
FT                   1015122..1015223,1015578..1015675,1015757..1015779,
FT                   1015961..1016006,1016405..1016541,1017332..1017397,
FT                   1019750..1019781,1022073..1022189,1025533..1025620,
FT                   1028917..1029031,1035578..1035729,1038584..1038637)
FT                   /codon_start=1
FT                   /gene="Vav1"
FT                   /locus_tag="mCG_140673"
FT                   /product="vav 1 oncogene"
FT                   /note="gene_id=mCG140673.0 transcript_id=mCT170643.0
FT                   protein_id=mCP93561.0"
FT                   /db_xref="GOA:Q3U9E2"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR022613"
FT                   /db_xref="InterPro:IPR028530"
FT                   /db_xref="MGI:MGI:98923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9E2"
FT                   /protein_id="EDL38258.1"
FT                   /translation="MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQ
FT                   LLNNLLPQAINLREVNLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQD
FT                   FGKVIYTLSALSWTPIAQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCV
FT                   ENEEAEGDEIYEDLMRLESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMK
FT                   PLQRFLKPQDMETIFVNIEELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYG
FT                   RYCSQVESASKHLDQVATAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLL
FT                   QELVKHTQDATEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAN
FT                   YGRPKIDGELKITSVERRSKTDRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDS
FT                   SGERDNKKWSHMFLLIEDQGAQGYELFFKTRELKKKWMEQFEMAISNIYPENATANGHD
FT                   FQMFSFEETTSCKACQMLLRGTFYQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMK
FT                   KDKLHRRAQDKKRNELGLPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHN
FT                   WWEGRNTATNEVGWFPCNRVHPYVHGPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYL
FT                   VRQRVKDTAEFAISIKYNVEVKHIKIMTSEGLYRITEKKAFRGLLELVEFYQQNSLKDC
FT                   FKSLDTTLQFPYKEPERRAISKPPAGSTKYFGTAKARYDFCARDRSELSLKEGDIIKIL
FT                   NKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYC"
FT   gene            <1069706..1195235
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /note="gene_id=mCG5569.2"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT3954"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT3954.2 created on
FT                   13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172973"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172973.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1111859..1112005,
FT                   1116788..1116934,1118300..1118449,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172974"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172974.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(<1069706..1069762,1072678..1072740,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1195235)
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, transcript variant mCT172975"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172975.0 created
FT                   on 13-SEP-2002"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_c"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT3954.2
FT                   protein_id=mCP18131.2 isoform=CRA_c"
FT                   /protein_id="EDL38261.1"
FT                   /translation="SLNDCHSTMWGFWLLLFWGFSGMYRWGMTTLPTLGQTLGGVNECQ
FT                   DTTTCPAYATCTDTTDSYYCTCKRGFLSSNGQTNFQGPGVECQDVNECLQSDSPCGPNS
FT                   VCTNILGRAKCSCLRGFSSSTGKDWILGSLDNFLCADVDECLTIGICPKYSNCSNSVGS
FT                   YSCTCQPGFVLNGSICEDEDECVTRDVCPEHATCHNTLGSYYCTCNSGLESSGGGPMFQ
FT                   GLDESCEDVDECSRNSTLCGPTFICINTLGSYSCSCPAGFSLPTFQILGHPADGNCTDI
FT                   DECDDTCPLNSSCTNTIGSYFCTCHPGFASSNGQLNFKDLEVTCEDIDECTQDPLQCGL
FT                   NSVCTNVPGSYICGCLPDFQMDPEGSQGYGNFNCKRILFKCKEDLILQSEQIQQCQAVQ
FT                   GRDLGYASFCTLVNATFTILDNTCENKSAPVSLQSAATSVSLVLEQATTWFELSKEETS
FT                   TLGTILLETVESTMLAALLIPSGNASQMIQTEYLDIESKVINEECKENESINLAARGDK
FT                   MNVGCFIIKESVSTGAPGVAFVSFAHMESVLNERFFEDGQSFRKLRMNSRVVGGTVTGE
FT                   KKEDFSKPIIYTLQHIQPKQKSERPICVSWNTDVEDGRWTPSGCEIVEASETHTVCSCN
FT                   RMANLAIIMASGELTMEFSLYIISHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHL
FT                   CVCLFLAKILFLTGIDKTDNQTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVV
FT                   NYFSSRNIKMLHLCAFGYGLPVLVVIISASVQPRGYGMHNRCWLNTETGFIWSFLGPVC
FT                   MIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRLLTFKAIAQIFILGCSWVLGIFQI
FT                   GPLASIMAYLFTIINSLQGAFIFLIHCLLNRQVRDEYKKLLTRKTDLSSHSQTSGILLS
FT                   SMPSTSKMG"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1112455..1112610,1112696..1112815,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_d"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172973.0
FT                   protein_id=mCP95892.0 isoform=CRA_d"
FT                   /protein_id="EDL38262.1"
FT                   /translation="SLNDCHSTMWGFWLLLFWGFSGMYRWGMTTLPTLGQTLGGVNECQ
FT                   DTTTCPAYATCTDTTDSYYCTCKRGFLSSNGQTNFQGPGVECQDVNECLQSDSPCGPNS
FT                   VCTNILGRAKCSCLRGFSSSTGKDWILGSLDNFLCADVDECLTIGICPKYSNCSNSVGS
FT                   YSCTCQPGFVLNGSICEDIDECDDTCPLNSSCTNTIGSYFCTCHPGFASSNGQLNFKDL
FT                   EVTCEDIDECTQDPLQCGLNSVCTNVPGSYICGCLPDFQMDPEGSQGYGNFNCKRILFK
FT                   CKEDLILQSEQIQQCQAVQGRDLGYASFCTLVNATFTILDNTCENKSAPVSLQSAATSV
FT                   SLVLEQATTWFELSKEETSTLGTILLETVESTMLAALLIPSGNASQMIQTEYLDIESKV
FT                   INEECKENESINLAARGDKMNVGCFIIKESVSTGAPGVAFVSFAHMESVLNERFFEDGQ
FT                   SFRKLRMNSRVVGGTVTGEKKEDFSKPIIYTLQHIQPKQKSERPICVSWNTDVEDGRWT
FT                   PSGCEIVEASETHTVCSCNRMANLAIIMASGELTMEFSLYIISHVGTVISLVCLALAIA
FT                   TFLLCRAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTACAIIAGFLHYLFLACFF
FT                   WMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVLVVIISASVQPRGYGMHN
FT                   RCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRLLTFK
FT                   AIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFLIHCLLNRQVRDEYKKL
FT                   LTRKTDLSSHSQTSGILLSSMPSTSKMG"
FT   CDS             join(<1069708..1069762,1072678..1072740,1111859..1112005,
FT                   1116788..1116934,1118300..1118449,1120672..1120812,
FT                   1120899..1121045,1123627..1123715,1129276..1129359,
FT                   1130301..1130478,1150888..1151004,1153531..1153715,
FT                   1154642..1154812,1157463..1157657,1159499..1159734,
FT                   1170339..1170405,1187215..1187306,1190482..1190650,
FT                   1192630..1192734,1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_a"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172974.0
FT                   protein_id=mCP95893.0 isoform=CRA_a"
FT                   /protein_id="EDL38259.1"
FT                   /translation="SLNDCHSTMWGFWLLLFWGFSGMYRWGMTTLPTLGQTLGGVNECQ
FT                   DTTTCPAYATCTDTTDSYYCTCKRGFLSSNGQTNFQGPGVECQDEDECVTRDVCPEHAT
FT                   CHNTLGSYYCTCNSGLESSGGGPMFQGLDESCEDVDECSRNSTLCGPTFICINTLGSYS
FT                   CSCPAGFSLPTFQILGHPADGNCTDIDECDDTCPLNSSCTNTIGSYFCTCHPGFASSNG
FT                   QLNFKDLEVTCEDIDECTQDPLQCGLNSVCTNVPGSYICGCLPDFQMDPEGSQGYGNFN
FT                   CKRILFKCKEDLILQSEQIQQCQAVQGRDLGYASFCTLVNATFTILDNTCENKSAPVSL
FT                   QSAATSVSLVLEQATTWFELSKEETSTLGTILLETVESTMLAALLIPSGNASQMIQTEY
FT                   LDIESKVINEECKENESINLAARGDKMNVGCFIIKESVSTGAPGVAFVSFAHMESVLNE
FT                   RFFEDGQSFRKLRMNSRVVGGTVTGEKKEDFSKPIIYTLQHIQPKQKSERPICVSWNTD
FT                   VEDGRWTPSGCEIVEASETHTVCSCNRMANLAIIMASGELTMEFSLYIISHVGTVISLV
FT                   CLALAIATFLLCRAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTACAIIAGFLHY
FT                   LFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVLVVIISASVQP
FT                   RGYGMHNRCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKD
FT                   TRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFLIHCLLNRQV
FT                   RDEYKKLLTRKTDLSSHSQTSGILLSSMPSTSKMG"
FT   CDS             join(<1069708..1069762,1072678..1072740,1116788..1116934,
FT                   1118300..1118449,1120672..1120812,1120899..1121045,
FT                   1123627..1123715,1129276..1129359,1130301..1130478,
FT                   1150888..1151004,1153531..1153715,1154642..1154812,
FT                   1157463..1157657,1159499..1159734,1170339..1170405,
FT                   1187215..1187306,1190482..1190650,1192630..1192734,
FT                   1194825..1194830)
FT                   /codon_start=1
FT                   /gene="Emr1"
FT                   /locus_tag="mCG_5569"
FT                   /product="EGF-like module containing, mucin-like, hormone
FT                   receptor-like sequence 1, isoform CRA_b"
FT                   /note="gene_id=mCG5569.2 transcript_id=mCT172975.0
FT                   protein_id=mCP95894.0 isoform=CRA_b"
FT                   /protein_id="EDL38260.1"
FT                   /translation="SLNDCHSTMWGFWLLLFWGFSGMYRWGMTTLPTLGQTLGDEDECV
FT                   TRDVCPEHATCHNTLGSYYCTCNSGLESSGGGPMFQGLDESCEDVDECSRNSTLCGPTF
FT                   ICINTLGSYSCSCPAGFSLPTFQILGHPADGNCTDIDECDDTCPLNSSCTNTIGSYFCT
FT                   CHPGFASSNGQLNFKDLEVTCEDIDECTQDPLQCGLNSVCTNVPGSYICGCLPDFQMDP
FT                   EGSQGYGNFNCKRILFKCKEDLILQSEQIQQCQAVQGRDLGYASFCTLVNATFTILDNT
FT                   CENKSAPVSLQSAATSVSLVLEQATTWFELSKEETSTLGTILLETVESTMLAALLIPSG
FT                   NASQMIQTEYLDIESKVINEECKENESINLAARGDKMNVGCFIIKESVSTGAPGVAFVS
FT                   FAHMESVLNERFFEDGQSFRKLRMNSRVVGGTVTGEKKEDFSKPIIYTLQHIQPKQKSE
FT                   RPICVSWNTDVEDGRWTPSGCEIVEASETHTVCSCNRMANLAIIMASGELTMEFSLYII
FT                   SHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTA
FT                   CAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVL
FT                   VVIISASVQPRGYGMHNRCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCS
FT                   VSSEVSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIF
FT                   LIHCLLNRQVRDEYKKLLTRKTDLSSHSQTSGILLSSMPSTSKMG"
FT   gene            complement(<1220569..>1237741)
FT                   /locus_tag="mCG_5579"
FT                   /note="gene_id=mCG5579.1"
FT   mRNA            complement(join(<1220569..1221470,1233707..1233830,
FT                   1234133..1234360,1236253..1237059,1237450..>1237741))
FT                   /locus_tag="mCG_5579"
FT                   /product="mCG5579"
FT                   /note="gene_id=mCG5579.1 transcript_id=mCT3940.1 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(1220569..1221470,1233707..1233830,
FT                   1234133..1234360,1236253..1237059,1237450..>1237740))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5579"
FT                   /product="mCG5579"
FT                   /note="gene_id=mCG5579.1 transcript_id=mCT3940.1
FT                   protein_id=mCP18168.1"
FT                   /protein_id="EDL38263.1"
FT                   /translation="IHPNKYQYVIALNFAIEEINKNIHLLPNISLGYDMYSIVQYQATI
FT                   LEHSIRFLTGLKEAIPNYTCRKESKLIAVVTGTSWEFPSRISTILGLYKYPQLTFGPFD
FT                   PMLSDHVKFPFIYQMAPEDTSLALGMVSLMVHFSWTWVGLIITENEKGIKFLSDLKREM
FT                   KKNSVCAAFVQMLSLKYRYNWNDLLSTDPAIMGEMVKVFIVFADIDSTLVVIFKASGQV
FT                   DPWRVWVTTSQWDIASSVRHFILDSFHGTLIFSQHHPEISAFKDFIQTVNPSKYPDDIF
FT                   LSHIWKMYLNCPFSRVYCKTLKTCSSNGSLALLPWHRFDMDMSEESYHIYNAVYAVAHS
FT                   LHEMLQEHADVQPVKSRKRLVFSPCRLHPFLKNIQFNNPSGDKVDLSHTGKLETKYDIF
FT                   NFWNFPQGLGLKVKVGTFSSFLPRNKQFSLSDGMIEWGTKDKQTPLSVCSTSCAPGLMK
FT                   SPQEGKASCCFDCHPCLENEISNETDSIQCIKCPDDQYANTEQTHCIPKAVTFLAYEDP
FT                   LGMALACMALCFSALTALVLGVFVKHHETPIVKANNRTLSYILLISLILCFLCSLPFIG
FT                   LPNMATCILQQMSFGVVFTIAVSTVLAKTVTVVLAFRSTVPGRRMRWILVSPNLIIPIC
FT                   TLIQMVLCAIWLGASAPFVDINAHNERGHITIMCNKGSATAFYCVLGYLGFLAMGTLTV
FT                   AFWARNLPDIFNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKVMVAVEVFSILASSAGLL
FT                   GCIFVPKCYIILIRPKNGSFKGLRGTRVCK"
FT   gene            1437663..1438938
FT                   /pseudo
FT                   /locus_tag="mCG_50925"
FT                   /note="gene_id=mCG50925.2"
FT   mRNA            1437663..1438938
FT                   /pseudo
FT                   /locus_tag="mCG_50925"
FT                   /note="gene_id=mCG50925.2 transcript_id=mCT51108.2 created
FT                   on 14-OCT-2002"
FT   gene            complement(<1535072..>1535866)
FT                   /locus_tag="mCG_13804"
FT                   /note="gene_id=mCG13804.0"
FT   mRNA            complement(<1535072..>1535866)
FT                   /locus_tag="mCG_13804"
FT                   /product="mCG13804"
FT                   /note="gene_id=mCG13804.0 transcript_id=mCT17710.0 created
FT                   on 19-JUL-2002"
FT   CDS             complement(1535072..1535866)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13804"
FT                   /product="mCG13804"
FT                   /note="gene_id=mCG13804.0 transcript_id=mCT17710.0
FT                   protein_id=mCP18150.0"
FT                   /protein_id="EDL38264.1"
FT                   /translation="MPKGKKAKGKKVALAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDI
FT                   QPKRDLTRFVKWPRYIRLQRQRAILYKWLKVPPAINQFTQALDRQTATQLLKLAHKYRP
FT                   ETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVITHDVDP
FT                   IELVVFLPALCRKMPYCIIKGKARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRT
FT                   NYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG"
FT   gene            <1709045..>2101945
FT                   /locus_tag="mCG_13805"
FT                   /note="gene_id=mCG13805.2"
FT   mRNA            join(<1709045..1709192,1730011..1730214,1737550..1737734,
FT                   1751011..1751154,1787095..1787359,1797020..1797169,
FT                   1799489..1799660,1833515..1833621,1857086..1857205,
FT                   1893929..1894129,1980949..1981105,1988102..1988229,
FT                   1988425..1988595,1999710..1999928,2007891..2008130,
FT                   2024365..2024589,2053441..2053551,2089302..2089520,
FT                   2101853..>2101945)
FT                   /locus_tag="mCG_13805"
FT                   /product="mCG13805"
FT                   /note="gene_id=mCG13805.2 transcript_id=mCT17711.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(<1709045..1709192,1730011..1730214,1737550..1737734,
FT                   1751011..1751154,1787095..1787359,1797020..1797169,
FT                   1799489..1799660,1833515..1833621,1857086..1857205,
FT                   1893929..1894129,1980949..1981105,1988102..1988229,
FT                   1988425..1988595,1999710..1999928,2007891..2008130,
FT                   2024365..2024589,2053441..2053551,2089302..2089520,
FT                   2101853..>2101945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13805"
FT                   /product="mCG13805"
FT                   /note="gene_id=mCG13805.2 transcript_id=mCT17711.2
FT                   protein_id=mCP18152.2"
FT                   /protein_id="EDL38265.1"
FT                   /translation="RFVGNMNANSVVHHKLLNSVRARFVRFVPLEWNPNGKIGMRVEVY
FT                   GCSYRSDVADFDGWSSLLYRFNQKTMSTLKDVISLKFKSIQRDGVLFHGEGQRGDHITL
FT                   ELQNGRLALYLNLDDSKAQVSSTAPLATLGSLLDDQHWHSVLLERVGKQANFTVDKNTQ
FT                   HFQTKGETDALDIDYELSFGGIPVPSKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKH
FT                   QIYSVGNVTFSCSEPQTVPITFVNSRSSYLLLTGTPQIDGLSVSFQFRTWNEDGLLLST
FT                   ELSEGSGTLLLILEGGTLRLLIKKLARHGTEIFTGSGLNDGMWHSVSISARRNRVTLTL
FT                   DNDAASLPPDTSWLQIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDL
FT                   ISVQQGSLGSFSDLHIDLCSIKDRCLPNYCEHGGQCAQTWTNFYCNCSDTGYTGATCHD
FT                   SIYEQSCEVYRHRGKTAEFFYVDSDGSGPLGPLQVFCNITEDKIWMTVQHNNTGLTWVQ
FT                   GSNPEKPYAMTLNYGGSLEQLEALIDGSEHCEQEVTYYCKRSRLLNTPDGVPFTWWIGR
FT                   SNEKHPYWGGSLPGVQQCGCGLEESCLDIRHFCNCDADTDEWTNDTGYLSFKDHLPVTQ
FT                   IIITDTNRSKSEAAWRIGPLRCYGDRHFWNAVSFSTEASFLHFPTFRVEFSADIFFFFK
FT                   TTALSGVFLEILGIKDFLRLEMSSPSEVIFAIDVGNGPIDLLVQSPYPLNDNQWHYIRA
FT                   ERNLKETSLQVDNLPQSMREASEEGHFQFQLNSQLFVGGKSSRQKGFFGCIRSLHLNGQ
FT                   NIDLEERAKVTSGVRPGCPGHCSSYGRNCQNGGKCVEKHIGYSCDCTNSPYEGPFCQKE
FT                   ISALFDSDTSVTYMFQEPYSVTKNTNLSSSAIYTDTAPSKEIIMLSFMTAQAPTLLLYL
FT                   NFSSQNFLAILLSWNGSLQIHYQLSKEESHVFTINTENLANRRVHQVKMSRDETLGLDP
FT                   EVARANTLGFVGCLSSVQYNHITPLKAALRHASISPVTVQRTLTESSCVSMVDSDANAV
FT                   TTVYSSTDPFGERDEREPLTNAVPSDLAVIGGNVSSLL"
FT   gene            complement(2275101..2276040)
FT                   /pseudo
FT                   /locus_tag="mCG_1039311"
FT                   /note="gene_id=mCG1039311.0"
FT   mRNA            complement(2275101..2276040)
FT                   /pseudo
FT                   /locus_tag="mCG_1039311"
FT                   /note="gene_id=mCG1039311.0 transcript_id=mCT157015.1
FT                   created on 28-OCT-2002"
FT   gene            <2289733..2291730
FT                   /locus_tag="mCG_1039286"
FT                   /note="gene_id=mCG1039286.1"
FT   mRNA            <2289733..2291730
FT                   /locus_tag="mCG_1039286"
FT                   /product="mCG1039286"
FT                   /note="gene_id=mCG1039286.1 transcript_id=mCT156990.1
FT                   created on 28-OCT-2002"
FT   CDS             <2289734..2290918
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039286"
FT                   /product="mCG1039286"
FT                   /note="gene_id=mCG1039286.1 transcript_id=mCT156990.1
FT                   protein_id=mCP71250.1"
FT                   /protein_id="EDL38266.1"
FT                   /translation="VDRPKSQHIRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCM
FT                   RDKATQTPSCWAEEGAEKRSHQRSVSWGSADQLKEIAKLRQQLQRSKQSSRHSKEKDRQ
FT                   SPLHGNHITISHTQAIGSRSVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNG
FT                   KEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPRES
FT                   QDGSPCSTEDLLYDRDKDSGSSSPFPKYASSPKPNNSYMFKQEPPEGCERVKVFEEMAS
FT                   RQPISAPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLT
FT                   VEQLSSRVSFTSLSDDTSTADSLEPSAQQPSQQQQLLQDLQVEEQVSTQNYVMI"
FT   gene            complement(2376876..>2536332)
FT                   /locus_tag="mCG_145585"
FT                   /note="gene_id=mCG145585.0"
FT   mRNA            complement(join(2376876..2377714,2478643..2478717,
FT                   2522368..2522485,2536032..>2536332))
FT                   /locus_tag="mCG_145585"
FT                   /product="mCG145585"
FT                   /note="gene_id=mCG145585.0 transcript_id=mCT185009.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2377361..>2377588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145585"
FT                   /product="mCG145585"
FT                   /note="gene_id=mCG145585.0 transcript_id=mCT185009.0
FT                   protein_id=mCP106307.0"
FT                   /protein_id="EDL38267.1"
FT                   /translation="TYVPDPPLDKLPCFIPLDLVGQKTWRLETTFRNLIRKRSYDESSL
FT                   SFNVTGYSDSIMDCSNNQSNIENNSLHLEG"
FT   gene            complement(2579292..2691867)
FT                   /locus_tag="mCG_20355"
FT                   /note="gene_id=mCG20355.2"
FT   mRNA            complement(join(2579292..2579660,2581090..2581225,
FT                   2584388..2584574,2586343..2586385,2588491..2588648,
FT                   2623139..2623317,2632981..2633091,2650782..2650883,
FT                   2654878..2655045,2667854..2668045,2673484..2675805,
FT                   2687993..2688118,2691835..2691867))
FT                   /locus_tag="mCG_20355"
FT                   /product="mCG20355"
FT                   /note="gene_id=mCG20355.2 transcript_id=mCT20425.2 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(2579561..2579660,2581090..2581225,
FT                   2584388..2584574,2586343..2586385,2588491..2588648,
FT                   2623139..2623317,2632981..2633091,2650782..2650883,
FT                   2654878..2655045,2667854..2668045,2673484..2675805,
FT                   2687993..2688011))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20355"
FT                   /product="mCG20355"
FT                   /note="gene_id=mCG20355.2 transcript_id=mCT20425.2
FT                   protein_id=mCP15302.2"
FT                   /db_xref="GOA:Q8BGR1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1916489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGR1"
FT                   /protein_id="EDL38268.1"
FT                   /translation="MQKKRMGTSQTSGQVCPQNVKDLEEDIKGHTSETVFHQTRTLGKL
FT                   KENGDENITASINGKQNSSFLVKNEKQAPSDSTIHKSMENGYTPPAISPQLEEVLPVAM
FT                   FNDREKSLPGKITTEDFPNTVEVLKPAKGKFIREVKCGAFNVHVETTKSIFCKTGAQNL
FT                   TKRRCPTCHQHYSVQQVWRGSKSRGHFSKHRTVLAEEFKRRVPSTYRRGVSRSEVPSVN
FT                   ISIVGKEIMVEYISKKQNTFINICHPNSIGKLTKHRRGPLKHTTDEPCESASQPGINHP
FT                   ENQRLENQHQSSDAFHDAPCSVNAVQKENSDTIVVSLSSPPRREKEKPNTLPSAPDDSE
FT                   EGESATSPQKVLQITQDKPLEQHCFTADSCLPTSSETLRTTSLNNVDLSKMSLEDSRDV
FT                   DEERKNSSDVRENITPDSQVQPCTAGTNGPLSAVNSIIPIQDASGSEFSPLSFLTLQLL
FT                   GAKADNMGCRGEETLPGEGHESSNSLLFPVSEQAAKPSPLLSPSHRVSRCSEPVETTGN
FT                   TFSFSQYIGVEREQEKVHYRLINKASLHNDSSSNIQPLERKDPQSPAVTIASCSILVPK
FT                   SPLHGNIHSSVEWNQTEDHANHAERAGLSRMEVPVMASITNELEQSLATQNYKESTVDS
FT                   NSPMAIRNPRESTSYLENVGDDASQALPVVKNMCHRNFEDLTRENQNEICSQMDFLQNS
FT                   SESTSVGHTTEKLFLIDKTLASDDDSNSNRDHKTCGLNNFQQEPAECQRTTSRVYCEES
FT                   GNQRYPTEVSCHPVDILLSPQKQKALKDQNLEINNPRKLSQELALRGGRASDGSQEEAI
FT                   EQWARRRQQFKDGKRCSSAGGSSVISNFTEGSITSDDVHSVDFGFRVDIEEKGFYTENF
FT                   HSTAWVFRGDDGNPEDSPRCLSKKPRPVAVRERTVRLFKGTGDYPWGFRIQFSKPIVVT
FT                   EVDTNSAAEEAGLQIGDVVLSVNGTEVTSVEHAEAVHLAKKGLDILTMVVASDISRCPN
FT                   TPWPTCRGYLHKRTHSGFVKGWRKRWFVLKHDGFLLYYKHRKDEGKWPPLDMIKLEGAE
FT                   VDIDNSLGKPFVFNCMPQSGSRILCLCATSNQEMKRWLEAMQRAARPVHQNHVWEDVTV
FT                   HNSSLPPLAIKHPECLGLLHQLERSTDVWIQHYCILKDGCLYFYASIRSTQASGGLYLQ
FT                   GYSVSEQTHGFEQPVIELKPSSEEFKTFYFCAENKTENQRWIAALKTSIKKWLPLDQAI
FT                   QEFMSRPLEETRM"
FT   gene            2696786..2725454
FT                   /locus_tag="mCG_140970"
FT                   /note="gene_id=mCG140970.0"
FT   mRNA            join(2696786..2697047,2710481..2710605,2711596..2712032,
FT                   2712559..2712677)
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, transcript variant mCT172482"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172482.0
FT                   created on 27-AUG-2002"
FT   mRNA            join(2696816..2697047,2717856..2718037,2725025..2725454)
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, transcript variant mCT172483"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172483.0
FT                   created on 27-AUG-2002"
FT   CDS             join(2697018..2697047,2717856..2718037,2725025..2725205)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, isoform CRA_b"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172483.0
FT                   protein_id=mCP95401.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V0W3"
FT                   /db_xref="MGI:MGI:1922289"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0W3"
FT                   /protein_id="EDL38270.1"
FT                   /translation="MSCPFSSLIQALVHYHHGSTDGAGAVAESYILIHGTRQTLVLEWN
FT                   LEASKSTPTWPHLLILLILSKTSTTWIFLTLDTFSFKFDGAVIMPLTSSLERRRVMPLR
FT                   SDASGTLQVGWQDYFPGCEVMTFYRE"
FT   CDS             join(2697018..2697047,2710481..2710605,2711596..2711815)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140970"
FT                   /product="mCG140970, isoform CRA_a"
FT                   /note="gene_id=mCG140970.0 transcript_id=mCT172482.0
FT                   protein_id=mCP95402.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D578"
FT                   /db_xref="MGI:MGI:1922289"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D578"
FT                   /protein_id="EDL38269.1"
FT                   /translation="MSCPFSSLIQQHRVQYRGQTKQPNRPPLPLGLLPPGRVSLSSSQA
FT                   RLQGTPRNWTTSGCPFLAAYIKAVHPFSEVSLRRDGEWLSIPANFATFPSAAELWSSEI
FT                   ISFLGFLLTEDISSFKKKMR"
FT   gene            complement(2700157..2713862)
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /note="gene_id=mCG20356.2"
FT   mRNA            complement(join(2700157..2702830,2703868..2704067,
FT                   2707043..2707156,2708163..2708330,2710394..2710983,
FT                   2711582..2711793,2713757..2713862))
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 12"
FT                   /note="gene_id=mCG20356.2 transcript_id=mCT20426.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(2702720..2702830,2703868..2704067,
FT                   2707043..2707156,2708163..2708330,2710394..2710983,
FT                   2711582..2711787))
FT                   /codon_start=1
FT                   /gene="Nudt12"
FT                   /locus_tag="mCG_20356"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 12"
FT                   /note="gene_id=mCG20356.2 transcript_id=mCT20426.2
FT                   protein_id=mCP15297.1"
FT                   /protein_id="EDL38271.1"
FT                   /translation="MSSVKRNPKKEMISELHSSAAEGNVAKLAGILSHSPSLLNETSEN
FT                   GWTALMYAARNGHPDVVQFLLEKGCDRSLVNKARQTALDIAAFWGYRHIANLLANAKGG
FT                   KKPWFLTNEVDECENYFSRTLLDRRSDKRNNSDWLQAKESHPTTVYLLFSDLNPLVTLG
FT                   GNKESSQQPEVRLCQLNYPDVKGYLAQPEKITLVFLGVELEMRKGSPAQAGGVPEEEED
FT                   GLVAWFALGIEPGAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRY
FT                   KFCPTCGSATKIEEGGYKRVCVRETCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLG
FT                   RQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIG
FT                   CLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWVGM
FT                   NPNL"
FT   gene            3297854..3298349
FT                   /pseudo
FT                   /locus_tag="mCG_51517"
FT                   /note="gene_id=mCG51517.2"
FT   mRNA            3297854..3298349
FT                   /pseudo
FT                   /locus_tag="mCG_51517"
FT                   /note="gene_id=mCG51517.2 transcript_id=mCT51700.2 created
FT                   on 28-OCT-2002"
FT   gene            5096970..5097905
FT                   /pseudo
FT                   /locus_tag="mCG_48960"
FT                   /note="gene_id=mCG48960.2"
FT   mRNA            5096970..5097905
FT                   /pseudo
FT                   /locus_tag="mCG_48960"
FT                   /note="gene_id=mCG48960.2 transcript_id=mCT49143.1 created
FT                   on 28-OCT-2002"
FT   gene            complement(5479860..5480739)
FT                   /pseudo
FT                   /locus_tag="mCG_120651"
FT                   /note="gene_id=mCG120651.0"
FT   mRNA            complement(5479860..5480739)
FT                   /pseudo
FT                   /locus_tag="mCG_120651"
FT                   /note="gene_id=mCG120651.0 transcript_id=mCT121842.0
FT                   created on 19-JUL-2002"
FT   gene            5480763..5481092
FT                   /pseudo
FT                   /locus_tag="mCG_140671"
FT                   /note="gene_id=mCG140671.0"
FT   mRNA            5480763..5481092
FT                   /pseudo
FT                   /locus_tag="mCG_140671"
FT                   /note="gene_id=mCG140671.0 transcript_id=mCT170635.0
FT                   created on 19-JUL-2002"
FT   gene            complement(6306490..6579897)
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /note="gene_id=mCG50503.2"
FT   mRNA            complement(join(6306490..6306888,6312746..6312826,
FT                   6313267..6313332,6350271..>6350301))
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, transcript variant mCT170639"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT170639.0 created
FT                   on 12-SEP-2002"
FT   mRNA            complement(join(6306742..6306888,6313267..6313332,
FT                   6350271..6350563,6579759..6579897))
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, transcript variant mCT50686"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT50686.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(6306767..6306888,6313267..6313332,
FT                   6350271..6350563,6579759..6579883))
FT                   /codon_start=1
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, isoform CRA_b"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT50686.2
FT                   protein_id=mCP36250.2 isoform=CRA_b"
FT                   /protein_id="EDL38273.1"
FT                   /translation="MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQR
FT                   GDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNR
FT                   PHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTND
FT                   TVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL"
FT   CDS             complement(join(6306767..6306888,6312746..6312826,
FT                   6313267..6313332,6350271..>6350301))
FT                   /codon_start=1
FT                   /gene="Efna5"
FT                   /locus_tag="mCG_50503"
FT                   /product="ephrin A5, isoform CRA_a"
FT                   /note="gene_id=mCG50503.2 transcript_id=mCT170639.0
FT                   protein_id=mCP93557.0 isoform=CRA_a"
FT                   /protein_id="EDL38272.1"
FT                   /translation="FRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRV
FT                   FDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL"
FT   gene            <6432516..6586662
FT                   /locus_tag="mCG_145592"
FT                   /note="gene_id=mCG145592.0"
FT   mRNA            join(<6432516..6432530,6432875..6432882,6584106..6586662)
FT                   /locus_tag="mCG_145592"
FT                   /product="mCG145592"
FT                   /note="gene_id=mCG145592.0 transcript_id=mCT185016.0
FT                   created on 05-JUN-2003"
FT   CDS             <6585767..6586033
FT                   /codon_start=1
FT                   /locus_tag="mCG_145592"
FT                   /product="mCG145592"
FT                   /note="gene_id=mCG145592.0 transcript_id=mCT185016.0
FT                   protein_id=mCP106314.0"
FT                   /protein_id="EDL38274.1"
FT                   /translation="SEALSTLFFTLFHKRSFSEHLEIISLLPLLSSDSPMRGNIHFQPL
FT                   ILLTDYHIPTFNTNHPDLLSPSHVTLSVLGLPVVCFSILPFTL"
FT   gene            complement(6756740..7192074)
FT                   /locus_tag="mCG_1995"
FT                   /note="gene_id=mCG1995.3"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170837,7187033..7187290,7190086..7190208,
FT                   7192010..7192074))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT1123"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT1123.3 created on
FT                   16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170837,7180418..7180678))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT186586"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186586.0 created
FT                   on 16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924504..6924529,7056105..7056235,7084301..7084408,
FT                   7089746..7089872,7155357..7155464))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT172481"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT172481.1 created
FT                   on 16-JUL-2003"
FT   mRNA            complement(join(6756740..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7150880..7151010))
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, transcript variant mCT186585"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186585.0 created
FT                   on 16-JUL-2003"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_a"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT1123.3
FT                   protein_id=mCP6310.3 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9V9"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9V9"
FT                   /protein_id="EDL38275.1"
FT                   /translation="MIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGC
FT                   SVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVE
FT                   VIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKS
FT                   LRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7170706..7170768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_a"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186586.0
FT                   protein_id=mCP107820.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9V9"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9V9"
FT                   /protein_id="EDL38278.1"
FT                   /translation="MIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGC
FT                   SVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVE
FT                   VIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKS
FT                   LRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924453..6924529,7056105..7056235,7084301..7084408,
FT                   7150880..7150963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_c"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT186585.0
FT                   protein_id=mCP107821.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9QZN1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="MGI:MGI:1354704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN1"
FT                   /protein_id="EDL38277.1"
FT                   /translation="MDPFGFVLLDKEGMKYEKTQTKKPGKAKVTDQSVKAFAEHCPELQ
FT                   YVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWI
FT                   INDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATL
FT                   IAQSSKSLRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNM
FT                   SAATS"
FT   CDS             complement(join(6759558..6759698,6779681..6779823,
FT                   6924504..6924529,7056105..7056235,7084301..7084345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1995"
FT                   /product="mCG1995, isoform CRA_b"
FT                   /note="gene_id=mCG1995.3 transcript_id=mCT172481.1
FT                   protein_id=mCP95400.1 isoform=CRA_b"
FT                   /protein_id="EDL38276.1"
FT                   /translation="MGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNL
FT                   SSLNLCLNWIINDRCVEVIAKEALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKS
FT                   LRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS"
FT   gene            complement(7005067..>7012325)
FT                   /locus_tag="mCG_146122"
FT                   /note="gene_id=mCG146122.0"
FT   mRNA            complement(join(7005067..7005526,7007875..7008141,
FT                   7012218..>7012325))
FT                   /locus_tag="mCG_146122"
FT                   /product="mCG146122"
FT                   /note="gene_id=mCG146122.0 transcript_id=mCT186225.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(7005106..>7005267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146122"
FT                   /product="mCG146122"
FT                   /note="gene_id=mCG146122.0 transcript_id=mCT186225.0
FT                   protein_id=mCP107778.0"
FT                   /protein_id="EDL38279.1"
FT                   /translation="KKERQLCVSAKGQGFLSSSVGGFSNAGCSGHHGQCCSISSVTAHI
FT                   YCKGVSLY"
FT   gene            7046295..7047390
FT                   /pseudo
FT                   /locus_tag="mCG_48775"
FT                   /note="gene_id=mCG48775.2"
FT   mRNA            7046295..7047390
FT                   /pseudo
FT                   /locus_tag="mCG_48775"
FT                   /note="gene_id=mCG48775.2 transcript_id=mCT48958.2 created
FT                   on 28-OCT-2002"
FT   gene            <7051514..7052241
FT                   /locus_tag="mCG_141373"
FT                   /note="gene_id=mCG141373.0"
FT   mRNA            <7051514..7052241
FT                   /locus_tag="mCG_141373"
FT                   /product="mCG141373"
FT                   /note="gene_id=mCG141373.0 transcript_id=mCT174991.0
FT                   created on 28-OCT-2002"
FT   CDS             <7051515..7051664
FT                   /codon_start=1
FT                   /locus_tag="mCG_141373"
FT                   /product="mCG141373"
FT                   /note="gene_id=mCG141373.0 transcript_id=mCT174991.0
FT                   protein_id=mCP97910.0"
FT                   /protein_id="EDL38280.1"
FT                   /translation="NVGKQKQLKFIKPAFYRHNFVMLIRFFIYEYTKQHLKVLDQCFST
FT                   CAML"
FT   gene            7272237..7272815
FT                   /pseudo
FT                   /locus_tag="mCG_1997"
FT                   /note="gene_id=mCG1997.1"
FT   mRNA            7272237..7272815
FT                   /pseudo
FT                   /locus_tag="mCG_1997"
FT                   /note="gene_id=mCG1997.1 transcript_id=mCT1125.1 created on
FT                   14-OCT-2002"
FT   gene            complement(7328778..7329365)
FT                   /locus_tag="mCG_121622"
FT                   /note="gene_id=mCG121622.1"
FT   mRNA            complement(7328778..7329365)
FT                   /locus_tag="mCG_121622"
FT                   /product="mCG121622"
FT                   /note="gene_id=mCG121622.1 transcript_id=mCT122821.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(7329115..7329291)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121622"
FT                   /product="mCG121622"
FT                   /note="gene_id=mCG121622.1 transcript_id=mCT122821.1
FT                   protein_id=mCP71114.1"
FT                   /protein_id="EDL38281.1"
FT                   /translation="MSAIQNLHSFDPFADASKGGDLLPAGTEDCIYVRIQQRNGRKTLQ
FT                   LSKGSLMIMIKRN"
FT   gene            complement(7402922..7403931)
FT                   /pseudo
FT                   /locus_tag="mCG_4338"
FT                   /note="gene_id=mCG4338.2"
FT   mRNA            complement(7402922..7403931)
FT                   /pseudo
FT                   /locus_tag="mCG_4338"
FT                   /note="gene_id=mCG4338.2 transcript_id=mCT3322.2 created on
FT                   14-OCT-2002"
FT   gene            complement(7562326..7564038)
FT                   /locus_tag="mCG_148341"
FT                   /note="gene_id=mCG148341.0"
FT   mRNA            complement(7562326..7564038)
FT                   /locus_tag="mCG_148341"
FT                   /product="mCG148341"
FT                   /note="gene_id=mCG148341.0 transcript_id=mCT188604.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7563344..7563529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148341"
FT                   /product="mCG148341"
FT                   /note="gene_id=mCG148341.0 transcript_id=mCT188604.0
FT                   protein_id=mCP108820.0"
FT                   /protein_id="EDL38282.1"
FT                   /translation="MRMLCKESRESWERSPRKYLPLGKSRKRGPKLMCSSSEGCFPKRS
FT                   FANLVQNRSKVDLNRS"
FT   gene            7600669..7817775
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /note="gene_id=mCG4337.2"
FT   mRNA            join(7600669..7600750,7601310..7601429,7611013..7611135,
FT                   7618085..7618274,7650107..7650199,7658525..7658728,
FT                   7668637..7668678,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7817775)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT170904"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170904.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(7600692..7600750,7601310..7601429,7611013..7611135,
FT                   7618085..7618274,7650107..7650199,7658525..7658728,
FT                   7668637..7668678,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_a"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170904.0
FT                   protein_id=mCP93822.0 isoform=CRA_a"
FT                   /protein_id="EDL38283.1"
FT                   /translation="MSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQAN
FT                   EIMWNNLTADSLQVMLKTLAEELTQTQQMLLHKEAAVLELEKRIEESFETCEKKSDIVL
FT                   LLGQKQALEELKQSVQQLRCTEAKCAAQKALLEQKVQENDGKEPPPVVNYEEDARSVTS
FT                   MERKERLSKFESIRHSIAGIIKSPKSVLGSSTVCDVISVGERPLAEHDWYHGAIPRIEA
FT                   QELLKQQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQFVDNLYRFEGTGFSNIPDKKW
FT                   VLNHEDVSLGELLGKGNFGEVYKGTLKDKTPVAIKTCKEDLPQELKIKFLQEAKILKQY
FT                   DHPNIVKLIGVCTQRQPVYIIMELVPGGDFLTFLRKRKDELKLKQLVRFSLDVAAGMLY
FT                   LESKNCIHRDLAARNCLVGENNTLKISDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALN
FT                   YGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMSAPQNCPEEVFTI
FT                   MMKCWDYKPENRPKFNDLHKELTVIKKMIT"
FT   mRNA            join(7614766..7614862,7618085..7618274,7618377..7618551,
FT                   7634171..7634363,7650107..7650199,7658525..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816427)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT3321"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT3321.0 created on
FT                   23-JUL-2002"
FT   mRNA            join(<7614996..7615036,7618085..7618274,7618377..7618551,
FT                   7650107..7650199,7658522..7658663,7668637..>7668662)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT170903"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170903.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(<7618161..7618274,7650107..7650199,7658522..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816426)
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, transcript variant mCT193657"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT193657.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7618161..7618274,7650107..7650199,7658522..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_b"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT193657.0
FT                   protein_id=mCP114660.0 isoform=CRA_b"
FT                   /protein_id="EDL38284.1"
FT                   /translation="AKCAAQKALLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLS
FT                   KFESIRHSIAGIIKSPKSVLGSSTQVCDVISVGERPLAEHDWYHGAIPRIEAQELLKQQ
FT                   GDFLVRESHGKPGEYVLSVYSDGQRRHFIIQFVDNLYRFEGTGFSNIPQLIDHHFNTKQ
FT                   VITKKSGVVLLNPIPKDKKWVLNHEDVSLGELLGKGNFGEVYKGTLKDKTPVAIKTCKE
FT                   DLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVPGGDFLTFLRKRKD
FT                   ELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQEDGGV
FT                   YSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQ
FT                   VERGYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVIKKMIT"
FT   CDS             join(<7618507..7618551,7650107..7650199,7658522..7658663,
FT                   7668637..>7668662)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_d"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT170903.0
FT                   protein_id=mCP93821.0 isoform=CRA_d"
FT                   /protein_id="EDL38286.1"
FT                   /translation="KNRLKLFLFLGDSRKERKERLSKFESIRHSIAGIIKSPKSVLGSS
FT                   TQVCDVISVGERPLAEHDWYHGAIPRIEAQELLKQQGDFLVRESHGKPESVSIRGHR"
FT   CDS             join(7634235..7634363,7650107..7650199,7658525..7658728,
FT                   7668637..7668759,7706330..7706386,7712487..7712602,
FT                   7714610..7714704,7755816..7755939,7810670..7810824,
FT                   7814939..7815061,7816105..7816247)
FT                   /codon_start=1
FT                   /gene="Fert2"
FT                   /locus_tag="mCG_4337"
FT                   /product="fer (fms/fps related) protein kinase, testis
FT                   specific 2, isoform CRA_c"
FT                   /note="gene_id=mCG4337.2 transcript_id=mCT3321.0
FT                   protein_id=mCP6271.1 isoform=CRA_c"
FT                   /protein_id="EDL38285.1"
FT                   /translation="MDKSMECPHCEGVLEPESDPQFSKKCSIPLSPGPSSSEILRYKER
FT                   KERLSKFESIRHSIAGIIKSPKSVLGSSTVCDVISVGERPLAEHDWYHGAIPRIEAQEL
FT                   LKQQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQFVDNLYRFEGTGFSNIPQLIDHHF
FT                   NTKQVITKKSGVVLLNPIPKDKKWVLNHEDVSLGELLGKGNFGEVYKGTLKDKTPVAIK
FT                   TCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVPGGDFLTFLR
FT                   KRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE
FT                   DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQ
FT                   AREQVERGYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVIKKMIT"
FT   gene            complement(7726864..7727675)
FT                   /locus_tag="mCG_148332"
FT                   /note="gene_id=mCG148332.0"
FT   mRNA            complement(join(7726864..7727427,7727572..7727675))
FT                   /locus_tag="mCG_148332"
FT                   /product="mCG148332"
FT                   /note="gene_id=mCG148332.0 transcript_id=mCT188595.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7727163..7727303)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148332"
FT                   /product="mCG148332"
FT                   /note="gene_id=mCG148332.0 transcript_id=mCT188595.0
FT                   protein_id=mCP108810.0"
FT                   /protein_id="EDL38287.1"
FT                   /translation="MVRQPSLYYLKHTALGRQANCSHPTCRLQIFPSCVPFQSCSQQAS
FT                   A"
FT   gene            7869799..7870220
FT                   /pseudo
FT                   /locus_tag="mCG_4340"
FT                   /note="gene_id=mCG4340.2"
FT   mRNA            join(7869799..7870029,7870112..7870220)
FT                   /pseudo
FT                   /locus_tag="mCG_4340"
FT                   /note="gene_id=mCG4340.2 transcript_id=mCT3313.2 created on
FT                   14-OCT-2002"
FT   gene            complement(7919637..7946938)
FT                   /locus_tag="mCG_148345"
FT                   /note="gene_id=mCG148345.0"
FT   mRNA            complement(join(7919637..7920602,7946868..7946938))
FT                   /locus_tag="mCG_148345"
FT                   /product="mCG148345"
FT                   /note="gene_id=mCG148345.0 transcript_id=mCT188608.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7920176..7920427)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148345"
FT                   /product="mCG148345"
FT                   /note="gene_id=mCG148345.0 transcript_id=mCT188608.0
FT                   protein_id=mCP108822.0"
FT                   /protein_id="EDL38288.1"
FT                   /translation="MPLNLSSALAPESILHPESGVHPPPWLLPPWCLSPLPSHTVSQET
FT                   TSSARFCTVLVESEVQGRRQRQQMLLGLQGRQRCGNRH"
FT   gene            complement(7958240..8008972)
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /note="gene_id=mCG4341.2"
FT   mRNA            complement(join(7958240..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7985861..7986905,7988410..7988610,7990243..7990360,
FT                   8008924..8008972))
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, transcript
FT                   variant mCT173271"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT173271.0 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(7958240..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7974961..7975146,7985861..7986905,7988410..7988610,
FT                   7990243..7990360,8008924..8008972))
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, transcript
FT                   variant mCT3314"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT3314.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(7960654..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7985861..7986905,7988410..7988610,7990243..7990273))
FT                   /codon_start=1
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, isoform CRA_a"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT173271.0
FT                   protein_id=mCP96190.0 isoform=CRA_a"
FT                   /protein_id="EDL38289.1"
FT                   /translation="MSQYTEKEPSVMDQESSKAAWPKPAGGYQTITGRRYGRRHAYVSF
FT                   KPCMTRHERSLGRAGDDYEVLELDDVPKENTSGSSSLDQVHPALPNEPTVEKSETEIST
FT                   CGPALNQSTESSPSIATVCHSEEVRETLESNTNLHNRTETEHTPAVCNVSSVQNGIMLV
FT                   HTDSYDPDSKHDENGSLQLGAEAVEGGRHQKGLGRAVFELENGEAEIYADLSPSVPSLN
FT                   GEISEAFEELDSAPLEKSSTADAELVHQNGQEFQRSSEDGVVRKRRQDDTDQGRQTENS
FT                   TEDADCAPGHVEQNTSDRANHHGSSPEQVVRPKVRKVISSSQVDQEIGFNRHEAKQRSV
FT                   QRWREALEVEECSSDDPIIKCDDYDGDHDCMFLTPTYSRVTQRETERNRVTSENGATAS
FT                   GRQESRDNAFWNACGEYYQLFDKDEDREQTSLEEGEIPWLQYNEVNESSSDEGNEPANE
FT                   FAQPEAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGLGVAEAISYVDPQFLTYMALE
FT                   ERLAQAMETALAHLESLAVDVEVANPPASKESIDGLPETLVLEDHTAIGQEQCCPICCS
FT                   EYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIDASAAASSDPDPDAS
FT                   PANDNAEEAP"
FT   CDS             complement(join(7960654..7960779,7964238..7964359,
FT                   7964765..7964879,7967170..7967281,7970076..7970261,
FT                   7974961..7975146,7985861..7986905,7988410..7988610,
FT                   7990243..7990273))
FT                   /codon_start=1
FT                   /gene="Pja2"
FT                   /locus_tag="mCG_4341"
FT                   /product="praja 2, RING-H2 motif containing, isoform CRA_b"
FT                   /note="gene_id=mCG4341.2 transcript_id=mCT3314.2
FT                   protein_id=mCP6320.1 isoform=CRA_b"
FT                   /protein_id="EDL38290.1"
FT                   /translation="MSQYTEKEPSVMDQESSKAAWPKPAGGYQTITGRRYGRRHAYVSF
FT                   KPCMTRHERSLGRAGDDYEVLELDDVPKENTSGSSSLDQVHPALPNEPTVEKSETEIST
FT                   CGPALNQSTESSPSIATVCHSEEVRETLESNTNLHNRTETEHTPAVCNVSSVQNGIMLV
FT                   HTDSYDPDSKHDENGSLQLGAEAVEGGRHQKGLGRAVFELENGEAEIYADLSPSVPSLN
FT                   GEISEAFEELDSAPLEKSSTADAELVHQNGQEFQRSSEDGVVRKRRQDDTDQGRQTENS
FT                   TEDADCAPGHVEQNTSDRANHHGSSPEQVVRPKVRKVISSSQVDQEIGFNRHEAKQRSV
FT                   QRWREALEVEECSSDDPIIKCDDYDGDHDCMFLTPTYSRVTQRETERNRVTSENGATAS
FT                   GRQESRDNAFWNACGEYYQLFDKDEDSSECSDGEWSASLPHRFSGTEKDQSSSDDSWET
FT                   LPGKDENDPELQSDSSGPEEENQELSLQEGEQTSLEEGEIPWLQYNEVNESSSDEGNEP
FT                   ANEFAQPEAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGLGVAEAISYVDPQFLTYM
FT                   ALEERLAQAMETALAHLESLAVDVEVANPPASKESIDGLPETLVLEDHTAIGQEQCCPI
FT                   CCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIDASAAASSDPDP
FT                   DASPANDNAEEAP"
FT   gene            <8280143..8432951
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /note="gene_id=mCG121684.0"
FT   mRNA            join(<8280143..8280364,8303013..8303264,8303792..8303936,
FT                   8314969..8315140,8329733..8329860,8337302..8337475,
FT                   8345138..8345324,8347813..8347990,8350249..8350451,
FT                   8353466..8353648,8358113..8358227,8359457..8359527,
FT                   8388609..8388774,8390157..8390378,8391467..8391589,
FT                   8392503..8392617,8409102..8409235,8411621..8411762,
FT                   8412831..8412964,8418577..8418780,8428624..8428734,
FT                   8430254..8432951)
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /product="mannosidase 2, alpha 1"
FT                   /note="gene_id=mCG121684.0 transcript_id=mCT122895.0
FT                   created on 23-JUL-2002"
FT   CDS             join(<8280143..8280364,8303013..8303264,8303792..8303936,
FT                   8314969..8315140,8329733..8329860,8337302..8337475,
FT                   8345138..8345324,8347813..8347990,8350249..8350451,
FT                   8353466..8353648,8358113..8358227,8359457..8359527,
FT                   8388609..8388774,8390157..8390378,8391467..8391589,
FT                   8392503..8392617,8409102..8409235,8411621..8411762,
FT                   8412831..8412964,8418577..8418780,8428624..8428734,
FT                   8430254..8430412)
FT                   /codon_start=1
FT                   /gene="Man2a1"
FT                   /locus_tag="mCG_121684"
FT                   /product="mannosidase 2, alpha 1"
FT                   /note="gene_id=mCG121684.0 transcript_id=mCT122895.0
FT                   protein_id=mCP70896.0"
FT                   /protein_id="EDL38291.1"
FT                   /translation="SPRRSPAGVLSLLPPSGEDRVLAPSPSRKMKLSRQFTVFGSAIFC
FT                   VVIFSLYLMLDRGHLDYPRGPRQEGSFPQGQLSILQEKIDHLERLLAENNEIISNIRDS
FT                   VINLSESVEDGPRGSPGNASQGSIHLHSPQLALQADPRDCLFASQSGSQPRDVQMLDVY
FT                   DLIPFDNPDGGVWKQGFDIKYEADEWDHEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQY
FT                   IFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKSLLQNGQLEIVTGGWVMP
FT                   DEATPHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMAYLLKRAGFSHMLIQ
FT                   RVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCGPDPKICCQFD
FT                   FKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRTKVLLAPLGDDFRFS
FT                   EYTEWDLQCRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKAVAAEKKSSQSVFPAL
FT                   SGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQAQKYKINKFL
FT                   SSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSAFLLI
FT                   LKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQERHSVVS
FT                   IRVNSATVKVLSDSGKPVEVQVSAVWNDMRTISQAAYEVSFLAHIPPLGLKVFKILESQ
FT                   SSSSHLADYVLYNNDGLAENGIFHVKNMVDAGDAITIENPFLAIWFDRSGLMEKVRRKE
FT                   DSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRPPFVRVTRGRIYSDVTCF
FT                   LEHVTHKVRLYNIQGIEGQSMEVSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGYQ
FT                   IQPRRTMSKLPLQANVYPMCTMAYIQDAEHRLTLLSAQSLGASSMASGQIEVFMDRRLM
FT                   QDDNRGLGQGVHDNKITANLFRILLEKRSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPF
FT                   LPMVLSGQLPSPAFELLSEFPLLQSSLPCDIHLVNLRTIQSKMGKGYSDEAALILHRKG
FT                   FDCQFSSRGIGLPCSTTQGKMSVLKLFNKFAVESLVPSSLSLMHSPPDAQNMSEVSLSP
FT                   MEISTFRIRLRWT"
FT   gene            8444954..8445776
FT                   /locus_tag="mCG_148348"
FT                   /note="gene_id=mCG148348.0"
FT   mRNA            join(8444954..8445189,8445284..8445776)
FT                   /locus_tag="mCG_148348"
FT                   /product="mCG148348"
FT                   /note="gene_id=mCG148348.0 transcript_id=mCT188611.0
FT                   created on 13-JAN-2004"
FT   CDS             join(8445011..8445189,8445284)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148348"
FT                   /product="mCG148348"
FT                   /note="gene_id=mCG148348.0 transcript_id=mCT188611.0
FT                   protein_id=mCP108826.0"
FT                   /protein_id="EDL38292.1"
FT                   /translation="MIAILRPARAPSKSLSASIGVCNARELRVYLEGKQELFSRIHFHL
FT                   CMTTTMMTLFSIQL"
FT   gene            complement(8510248..>8513798)
FT                   /locus_tag="mCG_55846"
FT                   /note="gene_id=mCG55846.2"
FT   mRNA            complement(join(8510248..8510481,8511997..8512069,
FT                   8512151..8512339,8513663..>8513798))
FT                   /locus_tag="mCG_55846"
FT                   /product="mCG55846"
FT                   /note="gene_id=mCG55846.2 transcript_id=mCT56029.1 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(8510427..8510481,8511997..8512069,
FT                   8512151..8512339,8513663..>8513798))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55846"
FT                   /product="mCG55846"
FT                   /note="gene_id=mCG55846.2 transcript_id=mCT56029.1
FT                   protein_id=mCP28827.1"
FT                   /protein_id="EDL38293.1"
FT                   /translation="ERTESGTEKPPHRLSAQLLAHGTDGSSISCISRCNDLQTHSLLLS
FT                   DKPMSMTQIQRNHSLMDTLFKKHSHAEELHLWDTIKNGSNSRNFFKVTVYLQSQSNIST
FT                   KGCLGLWLRFTACHLLLDTLLQNQASPARSHGNRSLEQGPAKWLGG"
FT   gene            complement(8846945..8847330)
FT                   /pseudo
FT                   /locus_tag="mCG_1039320"
FT                   /note="gene_id=mCG1039320.1"
FT   mRNA            complement(8846945..8847330)
FT                   /pseudo
FT                   /locus_tag="mCG_1039320"
FT                   /note="gene_id=mCG1039320.1 transcript_id=mCT157024.1
FT                   created on 28-OCT-2002"
FT   gene            complement(<9061826..9206343)
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /note="gene_id=mCG15611.2"
FT   mRNA            complement(join(<9061826..9062059,9082132..9082310,
FT                   9109700..9109952,9115184..9115307,9129248..9129402,
FT                   9142000..9142157,9143751..9143850,9149761..9149918,
FT                   9151253..9151358,9151861..9151972,9165493..9165627,
FT                   9182552..9182658,9206270..9206343))
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /product="RIKEN cDNA E130009J12"
FT                   /note="gene_id=mCG15611.2 transcript_id=mCT18789.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(<9061826..9062059,9082132..9082310,
FT                   9109700..9109952,9115184..9115307,9129248..9129402,
FT                   9142000..9142157,9143751..9143850,9149761..9149918,
FT                   9151253..9151358,9151861..9151972,9165493..9165611))
FT                   /codon_start=1
FT                   /gene="E130009J12Rik"
FT                   /locus_tag="mCG_15611"
FT                   /product="RIKEN cDNA E130009J12"
FT                   /note="gene_id=mCG15611.2 transcript_id=mCT18789.2
FT                   protein_id=mCP6276.2"
FT                   /protein_id="EDL38294.1"
FT                   /translation="MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQKPKPSFSI
FT                   SKEFILRFNHTDNPAEEEELLEQARRLIVRSKRKLGLKTLGSGKHVHLPTAWAEVIYLA
FT                   QCKGEIQDEALNMLHASLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKL
FT                   VKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILK
FT                   TSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSCVQNNR
FT                   PQLTEVLEHLLFYKTQLQTKCWLDSALALMVLGEAAKLDMACLKTLMDLVTDFLENILS
FT                   AQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCACKSPQQGISL
FT                   TDKSEELPELDGASILTLLKYFSSRISDNCEKVIWIGYYGIVYNLVKMSWELQGEQDQD
FT                   GLRNMIWQTLQKIKDYEQDPRIRCALVIAQAELNGPSDPFCTKATPNSGEEVFSKYIGW
FT                   RIATTLSRLFFPSLDVAPPKTPVEVDLPRKHTIRERQPAKKRVLRFILK"
FT   gene            9106391..9108074
FT                   /pseudo
FT                   /locus_tag="mCG_1039289"
FT                   /note="gene_id=mCG1039289.1"
FT   mRNA            join(9106391..9106546,9107510..9108074)
FT                   /pseudo
FT                   /locus_tag="mCG_1039289"
FT                   /note="gene_id=mCG1039289.1 transcript_id=mCT156993.1
FT                   created on 25-OCT-2002"
FT   gene            complement(9244523..9277845)
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /note="gene_id=mCG15608.1"
FT   mRNA            complement(join(9244523..9245316,9247049..9247222,
FT                   9256760..9256840,9257909..9258012,9259371..9259523,
FT                   9277572..9277845))
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, transcript variant mCT18786"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT18786.2 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(9244871..9245316,9247049..9247222,
FT                   9251513..9251635,9256760..9256840,9257909..9258012,
FT                   9259371..>9259438))
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, transcript variant mCT171235"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT171235.0 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(9245158..9245316,9247049..9247222,
FT                   9256760..9256840,9257909..9258012,9259371..9259523,
FT                   9277572..9277647))
FT                   /codon_start=1
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, isoform CRA_a"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT18786.2
FT                   protein_id=mCP6327.2 isoform=CRA_a"
FT                   /protein_id="EDL38295.1"
FT                   /translation="MASASGAMAKHEQILVLDPPSDLKFSPFTDVVTTNLKLQNPSDRK
FT                   VCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPN
FT                   ISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHS
FT                   VSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDN
FT                   VTSPLPSLLVVIAAIFIGFFLGKFIL"
FT   CDS             complement(join(9245158..9245316,9247049..9247222,
FT                   9251513..9251635,9256760..9256840,9257909..9258012,
FT                   9259371..>9259437))
FT                   /codon_start=1
FT                   /gene="Vapa"
FT                   /locus_tag="mCG_15608"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein A, isoform CRA_b"
FT                   /note="gene_id=mCG15608.1 transcript_id=mCT171235.0
FT                   protein_id=mCP94153.0 isoform=CRA_b"
FT                   /protein_id="EDL38296.1"
FT                   /translation="PRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTI
FT                   FAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLGKTPPGIASTVASLSSVSSA
FT                   VATPASYHLKNDPRELKEVKQNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLME
FT                   ECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIA
FT                   AIFIGFFLGKFIL"
FT   gene            complement(9302112..9304354)
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /note="gene_id=mCG53767.1"
FT   mRNA            complement(join(9302112..9303627,9304153..9304354))
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /product="thioredoxin domain containing 2 (spermatozoa)"
FT                   /note="gene_id=mCG53767.1 transcript_id=mCT53950.1 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(9302126..9303627,9304153..9304282))
FT                   /codon_start=1
FT                   /gene="Txndc2"
FT                   /locus_tag="mCG_53767"
FT                   /product="thioredoxin domain containing 2 (spermatozoa)"
FT                   /note="gene_id=mCG53767.1 transcript_id=mCT53950.1
FT                   protein_id=mCP28769.1"
FT                   /protein_id="EDL38297.1"
FT                   /translation="MFKKDKQKNKDKGLDMNSVQAGAPEESDMTLNNGGKANERGSNEN
FT                   PLQALSKNEAFLVPEFLDTAQSKEKAIASKVSNTLHMSTEESEFPQQVSSTPMFSENTV
FT                   HPRHEVSPKPSSKNTQLKQENISKSSGYSKQTNYSNTPKSLAKTTHPKQGSTLKPATNS
FT                   THYREDDIPKSSEDIIQPKKGDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSED
FT                   IIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQPKKEDRPKSSEDSVPSKKGDRPKSSE
FT                   DSVQPKKEDRPKSSEDSVQSKEGEVHKPLKDSIQSKETKVPKSPQDSIQSKEDKTHRPL
FT                   KDSVQSKESEEPKSSHESIQSKEDKIHKPLKDSIPSKEGDIPKSPEDTIQSQEEITASE
FT                   EDTIQSQEGNTIKSSEEDVQLSESKLLGLGAEIETLEEGLVRVIKDKEEFEEVLKDAGE
FT                   KLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQF
FT                   YKNEEKVGEFSGALVGKLERSISELK"
FT   gene            complement(9316325..>9437247)
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /note="gene_id=mCG15609.1"
FT   mRNA            complement(join(9316325..9319100,9360816..9360922,
FT                   9362536..9362607,9382272..9382353,9386798..9386877,
FT                   9437073..>9437247))
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, transcript
FT                   variant mCT18788"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT18788.1 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9318276..9319100,9339320..>9339649))
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, transcript
FT                   variant mCT170892"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT170892.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(9318773..9319100,9360816..9360922,
FT                   9362536..9362607,9382272..9382353,9386798..9386877,
FT                   9437073..>9437138))
FT                   /codon_start=1
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT18788.1
FT                   protein_id=mCP6258.1 isoform=CRA_b"
FT                   /protein_id="EDL38299.1"
FT                   /translation="APAGPDPEHMMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNIS
FT                   PTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFH
FT                   TLKKWVKELKEHGPENIVMAIAGNKCDLSDIRPPDPTLGPSGKWKQRRDQAWESELASQ
FT                   PSVLLSQGHGIQSKKEGARALFVGVQCTHKDPTRGANYLPESEQLCTLGHLLQDAEQGR
FT                   FLQRNDRKLWKTHHHRNMAFSL"
FT   CDS             complement(join(9319003..9319100,9339320..>9339356))
FT                   /codon_start=1
FT                   /gene="Rab31"
FT                   /locus_tag="mCG_15609"
FT                   /product="RAB31, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG15609.1 transcript_id=mCT170892.0
FT                   protein_id=mCP93810.0 isoform=CRA_a"
FT                   /protein_id="EDL38298.1"
FT                   /translation="TATKLICHLALQGRQIPPLGPQENGNSGGIKLGNQSLQASRRCC"
FT   gene            9447242..9506338
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /note="gene_id=mCG9066.3"
FT   mRNA            join(9447242..9447351,9467857..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185518"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185518.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9447394..9447540,9467857..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185517"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185517.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9447449..9447688,9467908..9467992,9468557..9468663,
FT                   9475023..9475165,9475725..9475871,9477937..9478044,
FT                   9478167..9478232,9478785..9478943,9480484..9480611,
FT                   9488822..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT9112"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT9112.3 created on
FT                   10-JUN-2003"
FT   mRNA            join(9447449..9447688,9467908..9467992,9505321..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185514"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185514.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9467434..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185515"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185515.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185515.0
FT                   protein_id=mCP106775.0 isoform=CRA_c"
FT                   /protein_id="EDL38302.1"
FT                   /translation="MLTPLGRLDKYAASENVFNRQMVARSLLDTLREVCDDERDCIAVL
FT                   ERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKYLLPIVVRYLADQNNQV
FT                   RKTSQAALLALLEQELIERFDVETKVCPVLIDLTAPDSNDDVKTEAVAIMCKMAPMVGK
FT                   DITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNV
FT                   WGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFAN
FT                   PSSSGQCFKDESKNSEDSSAEDKDRMRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLE
FT                   GCAAKTPGHSAGDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTS
FT                   SPEATPLDQDMFNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNIT
FT                   MATRKELEEMIENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVC
FT                   VSELPDCNISHDTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVP
FT                   QALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQW
FT                   KVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDK
FT                   RREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVS
FT                   SVRWISYKLVSEMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIED
FT                   DCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQT
FT                   IMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185517.0
FT                   protein_id=mCP106773.0 isoform=CRA_c"
FT                   /protein_id="EDL38304.1"
FT                   /translation="MLTPLGRLDKYAASENVFNRQMVARSLLDTLREVCDDERDCIAVL
FT                   ERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKYLLPIVVRYLADQNNQV
FT                   RKTSQAALLALLEQELIERFDVETKVCPVLIDLTAPDSNDDVKTEAVAIMCKMAPMVGK
FT                   DITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNV
FT                   WGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFAN
FT                   PSSSGQCFKDESKNSEDSSAEDKDRMRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLE
FT                   GCAAKTPGHSAGDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTS
FT                   SPEATPLDQDMFNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNIT
FT                   MATRKELEEMIENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVC
FT                   VSELPDCNISHDTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVP
FT                   QALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQW
FT                   KVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDK
FT                   RREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVS
FT                   SVRWISYKLVSEMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIED
FT                   DCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQT
FT                   IMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185518.0
FT                   protein_id=mCP106772.0 isoform=CRA_c"
FT                   /protein_id="EDL38305.1"
FT                   /translation="MLTPLGRLDKYAASENVFNRQMVARSLLDTLREVCDDERDCIAVL
FT                   ERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKYLLPIVVRYLADQNNQV
FT                   RKTSQAALLALLEQELIERFDVETKVCPVLIDLTAPDSNDDVKTEAVAIMCKMAPMVGK
FT                   DITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNV
FT                   WGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFAN
FT                   PSSSGQCFKDESKNSEDSSAEDKDRMRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLE
FT                   GCAAKTPGHSAGDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTS
FT                   SPEATPLDQDMFNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNIT
FT                   MATRKELEEMIENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVC
FT                   VSELPDCNISHDTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVP
FT                   QALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQW
FT                   KVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDK
FT                   RREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVS
FT                   SVRWISYKLVSEMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIED
FT                   DCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQT
FT                   IMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY"
FT   CDS             join(9467934..9467992,9468557..9468663,9475023..9475165,
FT                   9475725..9475871,9477937..9478044,9478167..9478232,
FT                   9478785..9478943,9480484..9480611,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT9112.3
FT                   protein_id=mCP6294.3 isoform=CRA_c"
FT                   /protein_id="EDL38306.1"
FT                   /translation="MLTPLGRLDKYAASENVFNRQMVARSLLDTLREVCDDERDCIAVL
FT                   ERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKYLLPIVVRYLADQNNQV
FT                   RKTSQAALLALLEQELIERFDVETKVCPVLIDLTAPDSNDDVKTEAVAIMCKMAPMVGK
FT                   DITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNV
FT                   WGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFAN
FT                   PSSSGQCFKDESKNSEDSSAEDKDRMRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLE
FT                   GCAAKTPGHSAGDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTS
FT                   SPEATPLDQDMFNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNIT
FT                   MATRKELEEMIENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVC
FT                   VSELPDCNISHDTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVP
FT                   QALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQW
FT                   KVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDK
FT                   RREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVS
FT                   SVRWISYKLVSEMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIED
FT                   DCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQT
FT                   IMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY"
FT   CDS             join(9467934..9467992,9505321..9505414)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185514.0
FT                   protein_id=mCP106771.0 isoform=CRA_b"
FT                   /protein_id="EDL38301.1"
FT                   /translation="MLTPLGRLDKYAASENVFNRQSWPCRWTETVMSSTLQAFTPPVPN
FT                   SLKMQ"
FT   mRNA            join(9481561..9481588,9488822..9489351,9493936..9494108,
FT                   9495558..9495653,9497507..9497692,9499599..9499760,
FT                   9500600..9500700,9502100..9502220,9502306..9502440,
FT                   9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185513"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185513.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9484706..9484730,9484877..9484958,9488822..9489351,
FT                   9493936..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506266)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT172489"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT172489.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9488823..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185513.0
FT                   protein_id=mCP106774.0 isoform=CRA_a"
FT                   /protein_id="EDL38300.1"
FT                   /translation="MRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLEGCAAKTPGHSA
FT                   GDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTSSPEATPLDQDM
FT                   FNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNITMATRKELEEMI
FT                   ENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVCVSELPDCNISH
FT                   DTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVPQALLDQYLSMT
FT                   DPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIH
FT                   ELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEF
FT                   LVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVS
FT                   EMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIEDDCLPMDQFAVH
FT                   LMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQTIMALQMDRDSD
FT                   VKYFASIHPSSTKLSEDAMSTASSTY"
FT   CDS             join(9488823..9489351,9493936..9494108,9495558..9495653,
FT                   9497507..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT172489.0
FT                   protein_id=mCP95408.0 isoform=CRA_a"
FT                   /protein_id="EDL38307.1"
FT                   /translation="MRDNDVVEEEHRRPEDAPSDLSAPHSSARLESLEGCAAKTPGHSA
FT                   GDVPAPVDSSLLCTLSSESPQEAASNDENGRKPDTNSKSASRPDAGTSSPEATPLDQDM
FT                   FNSFHFWRTPLPKIDLDKELQQDPEERLSPERTGDVPAAPLPGPPNITMATRKELEEMI
FT                   ENLEPHMDDPDVKAQVDVLSAALRASSLDAHEETSGVEQRSELQDEVCVSELPDCNISH
FT                   DTCVPLISAAEENAEATPDYVHGGADVSPGDGFSPDEDRRPKVQDVVPQALLDQYLSMT
FT                   DPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIH
FT                   ELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEF
FT                   LVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVS
FT                   EMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIEDDCLPMDQFAVH
FT                   LMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQEAVEQTIMALQMDRDSD
FT                   VKYFASIHPSSTKLSEDAMSTASSTY"
FT   mRNA            join(9493509..9494108,9495558..9495653,9497507..9497692,
FT                   9499599..9499760,9500600..9500700,9502100..9502220,
FT                   9502306..9502440,9503235..9503376,9505274..9506338)
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   transcript variant mCT185516"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185516.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9497546..9497692,9499599..9499760,9500600..9500700,
FT                   9502100..9502220,9502306..9502440,9503235..9503376,
FT                   9505274..9505437)
FT                   /codon_start=1
FT                   /gene="Ppp4r1"
FT                   /locus_tag="mCG_9066"
FT                   /product="protein phosphatase 4, regulatory subunit 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG9066.3 transcript_id=mCT185516.0
FT                   protein_id=mCP106776.0 isoform=CRA_d"
FT                   /protein_id="EDL38303.1"
FT                   /translation="MTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLA
FT                   SDMQWKVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKL
FT                   LHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLC
FT                   ADKVSSVRWISYKLVSEMVKKLHTATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQ
FT                   TVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYFLASASCHQE
FT                   AVEQTIMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY"
FT   gene            complement(9513657..9551107)
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /note="gene_id=mCG9065.3"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9551080..9551107))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170917"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170917.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9550880..9550974))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170916"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170916.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513657..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9549915..9550095))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT170915"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170915.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(9513675..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533073,9550372..9550519))
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, transcript variant
FT                   mCT9111"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT9111.1 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170915.1
FT                   protein_id=mCP93833.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38308.1"
FT                   /translation="MTECFLPPSSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTG
FT                   EPSPPHDVLHEPPDTVSDDDKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVK
FT                   RSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQW
FT                   KEKKKKKKPIQEPEVPQMDAPSVKPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEK
FT                   HGMKCEGVYRVSGIKSKVDELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTK
FT                   ELMPRFEEACGKTTEMEKVQEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQ
FT                   NISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIK
FT                   EEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQE
FT                   IASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRL
FT                   RAEIAEIQSRQQHGRSETEEYSSDSESESEDEEELQLILEDLQRQNEELEIKNNHLNQA
FT                   VHEEREAIIELRVQLRLLQMQRAKSEQQPQEEEEPERRGGTGPPPCDGVLEVRVAKEQA
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170916.1
FT                   protein_id=mCP93835.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38309.1"
FT                   /translation="MTECFLPPSSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTG
FT                   EPSPPHDVLHEPPDTVSDDDKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVK
FT                   RSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQW
FT                   KEKKKKKKPIQEPEVPQMDAPSVKPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEK
FT                   HGMKCEGVYRVSGIKSKVDELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTK
FT                   ELMPRFEEACGKTTEMEKVQEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQ
FT                   NISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIK
FT                   EEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQE
FT                   IASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRL
FT                   RAEIAEIQSRQQHGRSETEEYSSDSESESEDEEELQLILEDLQRQNEELEIKNNHLNQA
FT                   VHEEREAIIELRVQLRLLQMQRAKSEQQPQEEEEPERRGGTGPPPCDGVLEVRVAKEQA
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT170917.1
FT                   protein_id=mCP93834.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38310.1"
FT                   /translation="MTECFLPPSSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTG
FT                   EPSPPHDVLHEPPDTVSDDDKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVK
FT                   RSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQW
FT                   KEKKKKKKPIQEPEVPQMDAPSVKPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEK
FT                   HGMKCEGVYRVSGIKSKVDELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTK
FT                   ELMPRFEEACGKTTEMEKVQEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQ
FT                   NISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIK
FT                   EEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQE
FT                   IASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRL
FT                   RAEIAEIQSRQQHGRSETEEYSSDSESESEDEEELQLILEDLQRQNEELEIKNNHLNQA
FT                   VHEEREAIIELRVQLRLLQMQRAKSEQQPQEEEEPERRGGTGPPPCDGVLEVRVAKEQA
FT                   KASPSKDRKETPI"
FT   CDS             complement(join(9515186..9515431,9517356..9517479,
FT                   9517926..9518047,9519328..9519435,9522917..9523048,
FT                   9524216..9524377,9526499..9526848,9529523..9529981,
FT                   9532775..9533018))
FT                   /codon_start=1
FT                   /gene="Ralbp1"
FT                   /locus_tag="mCG_9065"
FT                   /product="ralA binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG9065.3 transcript_id=mCT9111.1
FT                   protein_id=mCP6290.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6H6B3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:108466"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6B3"
FT                   /protein_id="EDL38311.1"
FT                   /translation="MTECFLPPSSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTG
FT                   EPSPPHDVLHEPPDTVSDDDKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVK
FT                   RSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQW
FT                   KEKKKKKKPIQEPEVPQMDAPSVKPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEK
FT                   HGMKCEGVYRVSGIKSKVDELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTK
FT                   ELMPRFEEACGKTTEMEKVQEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQ
FT                   NISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIK
FT                   EEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQE
FT                   IASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRL
FT                   RAEIAEIQSRQQHGRSETEEYSSDSESESEDEEELQLILEDLQRQNEELEIKNNHLNQA
FT                   VHEEREAIIELRVQLRLLQMQRAKSEQQPQEEEEPERRGGTGPPPCDGVLEVRVAKEQA
FT                   KASPSKDRKETPI"
FT   gene            9552113..9554716
FT                   /locus_tag="mCG_148340"
FT                   /note="gene_id=mCG148340.0"
FT   mRNA            join(9552113..9552300,9553846..9554716)
FT                   /locus_tag="mCG_148340"
FT                   /product="mCG148340"
FT                   /note="gene_id=mCG148340.0 transcript_id=mCT188603.0
FT                   created on 13-JAN-2004"
FT   CDS             9554112..9554267
FT                   /codon_start=1
FT                   /locus_tag="mCG_148340"
FT                   /product="mCG148340"
FT                   /note="gene_id=mCG148340.0 transcript_id=mCT188603.0
FT                   protein_id=mCP108819.0"
FT                   /protein_id="EDL38312.1"
FT                   /translation="MSSQKISQVIHPHKLSQLLISLQSACKSSSKGLARLNDRSHKDWK
FT                   DTETGQ"
FT   gene            complement(9591855..9621024)
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /note="gene_id=mCG9067.2"
FT   mRNA            complement(join(9591855..9592920,9596139..9596348,
FT                   9599431..9599697,9607691..9607790,9618543..9618699,
FT                   9620954..9621005))
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   transcript variant mCT170918"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT170918.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9592948..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618699,9620954..9621024))
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   transcript variant mCT9114"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT9114.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(9596167..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618662))
FT                   /codon_start=1
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT170918.0
FT                   protein_id=mCP93836.0 isoform=CRA_a"
FT                   /protein_id="EDL38313.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
FT   CDS             complement(join(9596167..9596348,9599431..9599697,
FT                   9607691..9607790,9618543..9618662))
FT                   /codon_start=1
FT                   /gene="Twsg1"
FT                   /locus_tag="mCG_9067"
FT                   /product="twisted gastrulation homolog 1 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9067.2 transcript_id=mCT9114.1
FT                   protein_id=mCP6298.2 isoform=CRA_a"
FT                   /protein_id="EDL38314.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
FT   gene            complement(9636482..9746720)
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /note="gene_id=mCG9056.2"
FT   mRNA            complement(join(9636482..9640301,9642261..9642356,
FT                   9645986..9646129,9649467..9649565,9652801..9657458,
FT                   9693845..9693992,9697016..9697158,9701135..9701335,
FT                   9707257..9707403,9712162..9712230,9719416..9719563,
FT                   9722584..>9722670))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT170913"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170913.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(9637977..9638138,9640114..9640301,
FT                   9641491..9641667,9642261..9642337))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT170914"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170914.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(9640116..9640301,9642261..9642356,
FT                   9645986..9646129,9649467..9649565,9652801..9657458,
FT                   9693845..9693992,9697016..9697158,9701135..9701335,
FT                   9707257..9707403,9712162..9712230,9719416..9719563,
FT                   9722584..9722670))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170913.0
FT                   protein_id=mCP93831.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E893"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1914357"
FT                   /db_xref="UniProtKB/TrEMBL:G5E893"
FT                   /protein_id="EDL38315.1"
FT                   /translation="MPKSGFTKPVQSENSDSDSSMVERPYGRKSKDKIASYSKTSKIDR
FT                   GDMGKEMREKPSMKRKLPFTVSPSRNEERDSDTDSDPGHTSENWGERLISSYRTYSEKE
FT                   GPEKKKTKKEAGTKKSTPVSILFGYPLSERKQMALLMQMTARDNSPDSTPSHPSQATPA
FT                   QKKTPSSSSRQKDKINKRNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFAGWTPL
FT                   HEACNVGYYDVAKILIAAGADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGNPFQAN
FT                   KHGERPVDVAETEELELLLKREVPLSGDDESYTDSEEAQSVNPSSVDENIDSETEKDSF
FT                   VCGSKILPSKAPLPSALDEYEFKDDDEEEISKMIDDRHILRKEQRRENESEAERSGLFA
FT                   KQEKTFYSKSFKTKKQKPSRVLCSSTESSDEEGLQNRKISTACSVAESSHPDMQAKKEY
FT                   EYKQKGKVKRKLKNQNKNKENQELKQEKEGKENSRIATLTVNTALDCSEKYREEGNFRK
FT                   SFSPKDDTSLHLFHISTGKSPKHSCGLSEKQTPLKQEHTKACISPGSSEMSLQPDLTRY
FT                   DNAEPESSNVKSYKHKEKNKQQKDFHIEFGEKSNAKIKDEDHNPAFENSDCTLKKMDKE
FT                   GKTLKKHKLKHKEKDKEKHKKEVEGEKEKYKNKDNAKELQRSIEFDREFWKENFFKSDE
FT                   TEDLFLTMEHESIIEKKTKMEKNMKDDRSAKEKHVSKERNFKEEREKTKKENEKSLREE
FT                   KVKDPKEEKDSVSTEKEAECCSVGVSVSQEAAGLHSSEKEMDAEKQERHTKEREKSDRR
FT                   FQTKEKELDRNERKFSEKEKKIKHEHKSEREKLDFSDCTDRVREKDKLYSHQTERCHKD
FT                   SEKLKNTVRKTDDRERNREKADRKHDREKPERERYLAENKEKHLEKRKQSDSSEYSKSE
FT                   KVRTKDRDREGEKKEKLRDKESVNVTNLKHLQEERKSSTGDSSGKTQHEKALSLKERAR
FT                   DEPLKTPDGKEKDKKDIDRYKERDKRKDKAQLNTLIRLKSETEKLKPKLSPASKDTRPK
FT                   EKRLVNDDLMQTSFERMLSLKDLEIEQWHRKHKEKIKQKEKERLRNRTCLELKVKDKEK
FT                   TKHAPTESKSKELTRSRSSELTDVYSKEKQSKDVGSNRSQSVDNRNVLNLGKPSYISES
FT                   GSNRSPRSEGERLGLSSRSVSMLSVASSEDSCHTVTTPRPLVEYDSDFMLEGSESQLSF
FT                   SQSPFLPNAKSPALYERELEGLTELPDRLKPPYTNRLPVCHLRSSSVEDVKLITNEVRP
FT                   AVEIRRCSMPSVICEPIKHFQVSEESSQGNLAVPRETCLSPKPEVSSAVPERGLSHVSD
FT                   LHPNCTGSPTRSANSSYISSDVNVIKSATLVGTLIDSSMHLEPSNQVGVIPSKSWETPV
FT                   DKLESLSTNDFICPDSNISDQDSSAQSFYNSENKMLREQNTDCLPPHQPELPGNSCAQD
FT                   PASFLSSPQPCSFSNQPLAGADSVPKPVSLSYVVSQEPGVLQQKSAAQMASSVLDSDNN
FT                   FPEDVENTFVLADIQKTNSFLPAYSESTVQEALPSFEKANTLLVLPSEKDFNGSDTAQP
FT                   NTHYAFSKLTYKSSNSQEIEKGPDDTQIISHEKENKLQSLVLTQLSKCDSDLYEMNAGL
FT                   PKGNLNEQDNPKHGLDSEKYSLSTEDEESQQSTLSSVENHSQQSAQPEMHKYDQLSKVE
FT                   LEENAEDDKTENQTPQRVTRNKASTVVNPSKPMLAGCALVAEKDNESSPRGRIRLTEED
FT                   DPQIHHPRKRKVSRVPQPVQVSPSLLQAKEKTQQSLAAIVDSLKLDEIEPYSSERANPY
FT                   FEYLHIRKKIEEKRKLLCSVIPQAPQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSL
FT                   SDPLKELFRQQEVVRMKLRLQHSIEREKLIVSNEQEVLRVHYRAARTLANQTLPFSACT
FT                   VLLDAEVYNVPLDSQSDDSKTSVRDRFNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAA
FT                   ALNAVQRLEWQLKLQELDPATYKSLSIYEIQEFYVPLVDVNDDFELTPI"
FT   CDS             complement(join(9640116..9640301,9641491..9641562))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_b"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT170914.0
FT                   protein_id=mCP93832.0 isoform=CRA_b"
FT                   /protein_id="EDL38316.1"
FT                   /translation="MPQDLHTKMQVRNLYLPTSRLGSLTCLLMRQQHEAAALNAVQRLE
FT                   WQLKLQELDPATYKSLSIYEIQEFYVPLVDVNDDFELTPI"
FT   mRNA            complement(join(<9657004..9657458,9693845..9693992,
FT                   9697016..9697158,9701135..9701335,9707257..9707403,
FT                   9712162..9712230,9719416..9719563,9722584..9722721,
FT                   9746514..>9746547))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT193695"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT193695.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<9657004..9657458,9693845..9693992,
FT                   9697016..9697158,9701135..9701335,9707257..9707403,
FT                   9712162..9712230,9719416..9719563,9722584..>9722685))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_c"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT193695.0
FT                   protein_id=mCP114667.0 isoform=CRA_c"
FT                   /protein_id="EDL38317.1"
FT                   /translation="LNSYKMPKSGFTKPVQSENSDSDSSMVERPYGRKSKDKIASYSKT
FT                   SKIDRGDMGKEMREKPSMKRKLPFTVSPSRNEERDSDTDSDPGHTSENWGERLISSYRT
FT                   YSEKEGPEKKKTKKEAGTKKSTPVSILFGYPLSERKQMALLMQMTARDNSPDSTPSHPS
FT                   QATPAQKKTPSSSSRQKDKINKRNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFA
FT                   GWTPLHEACNVGYYDVAKILIAAGADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGN
FT                   PFQANKHGERPVDVAETEELELLLKREVPLSGDDESYTDSEEAQSVNPSSVDENIDSET
FT                   EKDSFVCGSKILPSKAPLPSALDEYEFKDDDEEEISKMIDDRHILRKEQRRENESEAER
FT                   SGLFAKQEKTFYSKSFKTKKQKPSRVLCSSTESSDEEGLQNRKISTACSVAESSHPDMQ
FT                   AKKEYEYKQKGKV"
FT   mRNA            complement(join(9706562..9707403,9719416..9719563,
FT                   9722584..9722721,9746514..9746720))
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, transcript variant
FT                   mCT9102"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT9102.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(9707249..9707403,9719416..9719563,
FT                   9722584..9722670))
FT                   /codon_start=1
FT                   /gene="Ankrd12"
FT                   /locus_tag="mCG_9056"
FT                   /product="ankyrin repeat domain 12, isoform CRA_d"
FT                   /note="gene_id=mCG9056.2 transcript_id=mCT9102.1
FT                   protein_id=mCP6303.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9CQQ3"
FT                   /db_xref="MGI:MGI:1914357"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQQ3"
FT                   /protein_id="EDL38318.1"
FT                   /translation="MPKSGFTKPVQSENSDSDSSMVERPYGRKSKDKIASYSKTSKIDR
FT                   GDMGKEMREKPSMKRKLPFTVSPSRNEERDSDTEKEGPEKKKTKKEAGTKKSTPVSILF
FT                   GYPLSERKQMALLMQMTARDNSPGD"
FT   gene            <9746800..9747598
FT                   /locus_tag="mCG_1039377"
FT                   /note="gene_id=mCG1039377.1"
FT   mRNA            <9746800..9747598
FT                   /locus_tag="mCG_1039377"
FT                   /product="mCG1039377"
FT                   /note="gene_id=mCG1039377.1 transcript_id=mCT157081.1
FT                   created on 31-OCT-2002"
FT   CDS             <9746802..9747131
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039377"
FT                   /product="mCG1039377"
FT                   /note="gene_id=mCG1039377.1 transcript_id=mCT157081.1
FT                   protein_id=mCP70863.1"
FT                   /protein_id="EDL38319.1"
FT                   /translation="GSPEERSARRRVAFLGSEAERVEGAGSPGAAWESEQPSSRRPGSS
FT                   SRAVTTTGDVQKAAWVLAPGGGNAHIFAGFELGRQNQPETGRVLLAVVVRAGGHRSTVG
FT                   QVRVA"
FT   gene            complement(9748841..>9771070)
FT                   /locus_tag="mCG_9061"
FT                   /note="gene_id=mCG9061.1"
FT   mRNA            complement(join(9748841..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9761498..9761563,9770959..>9771070))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT9106"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT9106.1 created on
FT                   28-AUG-2002"
FT   mRNA            complement(join(9749071..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9759065..9759127,9761498..9761563,9770959..>9771054))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193671"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193671.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9749124..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_d"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT9106.1
FT                   protein_id=mCP6323.1 isoform=CRA_d"
FT                   /protein_id="EDL38323.1"
FT                   /translation="SGRGRSIAYPAMFSLALRARATGLAAQWGRHARNLHKTAVHNGAG
FT                   GALFVRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEV
FT                   ATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEV
FT                   ECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTS
FT                   LTEPPKGPGFGVQAGL"
FT   CDS             complement(join(9749124..9749217,9750441..9750517,
FT                   9753032..9753141,9757037..9757205,9758866..9758982,
FT                   9759065..9759127,9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_c"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193671.0
FT                   protein_id=mCP114670.0 isoform=CRA_c"
FT                   /protein_id="EDL38322.1"
FT                   /translation="SGRGRSIAYPAMFSLALRARATGLAAQWGRHARNLHKTAVHNGAG
FT                   GALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLP
FT                   ISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQ
FT                   RKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGK
FT                   VPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL"
FT   mRNA            complement(join(9750441..9750514,9753028..9753141,
FT                   9757037..9757205,9758866..9758982,9759065..9759127,
FT                   9761498..9761563,9770959..>9771043))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193670"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193670.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9750492..9750514,9753028..9753141,
FT                   9757037..9757205,9758866..9758982,9759065..9759127,
FT                   9761498..9761563,9770959..>9771042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_b"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193670.0
FT                   protein_id=mCP114669.0 isoform=CRA_b"
FT                   /protein_id="EDL38321.1"
FT                   /translation="SGRGRSIAYPAMFSLALRARATGLAAQWGRHARNLHKTAVHNGAG
FT                   GALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLP
FT                   ISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQ
FT                   RKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYVRSDTQGY"
FT   mRNA            complement(join(<9753096..9753141,9757037..9757205,
FT                   9758866..9758982,9759065..9759127,9761498..9761563,
FT                   9770522..9770618,9770959..>9771041))
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, transcript variant mCT193669"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193669.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<9753096..9753141,9757037..9757205,
FT                   9758866..9758982,9759065..9759127,9761498..9761563,
FT                   9770522..>9770527))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9061"
FT                   /product="mCG9061, isoform CRA_a"
FT                   /note="gene_id=mCG9061.1 transcript_id=mCT193669.0
FT                   protein_id=mCP114668.0 isoform=CRA_a"
FT                   /protein_id="EDL38320.1"
FT                   /translation="IKGRHARNLHKTAVHNGAGGALFVHRDTPENNPDTPFDFTPENYK
FT                   RIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
FT                   MYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTL"
FT   gene            <9781027..9789926
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /note="gene_id=mCG9062.2"
FT   mRNA            join(<9781027..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9787539..9787697,9788287..9788355,
FT                   9788473..9789926)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT9108"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT9108.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<9781027..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9787539..9787697,9788287..9788355,
FT                   9788473..9788612)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_c"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT9108.2
FT                   protein_id=mCP6262.2 isoform=CRA_c"
FT                   /protein_id="EDL38326.1"
FT                   /translation="GSRRAELTVVDARTWECGSPGGGDAHVRTPPWGIMTPVKTQCSLA
FT                   GQLYAVPLIQPDLRREEAIQQVADALQYLQNISGDIFSRISRRVELSRRQLQAISERVS
FT                   LAQAKIEKIKGSKKAIKVFSSAKYPAPEHLQEYGSIFTGALDPGLQRRPRYRIQSKHRP
FT                   LDERALQEKLKYFPVCVNTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTENLYKKYVF
FT                   LDPLAGAVTKTHTMLGTEEEKLFDAPLSISKREQLERQAPENYFYVPDLGQVPEIDVPS
FT                   YLPDLPGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPLQPASVQGAPKEVVDP
FT                   SSGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQGGDLMSDLFNKLV
FT                   MRRKGISGKGPSTGTSEGPGGAFSRMSDSIPPLPPPQQPAGDEDEEDWES"
FT   mRNA            join(<9781107..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786919,9787539..9787697,
FT                   9788287..9788355,9788473..9788931)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT193672"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193672.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9781108..9781123,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786854)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_a"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193672.0
FT                   protein_id=mCP114671.0 isoform=CRA_a"
FT                   /protein_id="EDL38324.1"
FT                   /translation="RTPPWGIMTPVKTQCSLAGQLYAVPLIQPDLRREEAIQQVADALQ
FT                   YLQNISGDIFSRISRRVELSRRQLQAISERVSLAQAKIEKIKGSKKAIKVFSSAKYPAP
FT                   EHLQEYGSIFTGALDPGLQRRPRYRIQSKHRPLDERALQEKLKYFPVCVNTKSEPEDEA
FT                   EEGLGGLPSNISSISSLLLFNTTENLYKKYVFLDPLAGAVTKTHTMLGTEEEKLFDAPL
FT                   SISKREQLERQAPENYFYVPDLGQVPEIDVPSYLPDLPGVADDLMYSADLGPGIAPSAP
FT                   GAIPELPAFHTEVAEPLQPELENEVLLAATAPASSPTAATSPSSHSIGQYPTATDVP"
FT   mRNA            join(<9781124..9781205,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786919,9787539..9787697,
FT                   9788287..9788355,9788473..9788862)
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, transcript variant
FT                   mCT193673"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193673.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9781124..9781205,9783337..9783490,9785146..9785257,
FT                   9785429..9785575,9785735..9785871,9786104..9786236,
FT                   9786448..9786649,9786739..9786854)
FT                   /codon_start=1
FT                   /gene="ORF19"
FT                   /locus_tag="mCG_9062"
FT                   /product="open reading frame 19, isoform CRA_b"
FT                   /note="gene_id=mCG9062.2 transcript_id=mCT193673.0
FT                   protein_id=mCP114672.0 isoform=CRA_b"
FT                   /protein_id="EDL38325.1"
FT                   /translation="VSVQGGRGADWERRTGRRPRPCRPPAGGIMTPVKTQCSLAGQLYA
FT                   VPLIQPDLRREEAIQQVADALQYLQNISGDIFSRISRRVELSRRQLQAISERVSLAQAK
FT                   IEKIKGSKKAIKVFSSAKYPAPEHLQEYGSIFTGALDPGLQRRPRYRIQSKHRPLDERA
FT                   LQEKLKYFPVCVNTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTENLYKKYVFLDPLA
FT                   GAVTKTHTMLGTEEEKLFDAPLSISKREQLERQAPENYFYVPDLGQVPEIDVPSYLPDL
FT                   PGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPLQPELENEVLLAATAPASSPT
FT                   AATSPSSHSIGQYPTATDVP"
FT   gene            <9793063..9821591
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /note="gene_id=mCG124126.1"
FT   mRNA            join(<9793063..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807512..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813074..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818525,9818639..9818739,9819387..9819471,
FT                   9819750..9819828,9819993..9820147,9820222..9821591)
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), transcript
FT                   variant mCT125364"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT125364.1
FT                   created on 16-SEP-2002"
FT   mRNA            join(<9793064..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807516..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813043..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818739,9819387..9819471,9819750..9819828,
FT                   9819993..9820147,9820222..9820808)
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), transcript
FT                   variant mCT193689"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT193689.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9793065..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807512..9807664,9808453..9808499,9808823..9808902,
FT                   9809614..9809658,9809776..9809843,9812612..9812650,
FT                   9812850..9812970,9813074..9813196,9813602..9813714,
FT                   9817094..9817166,9817418..9817521,9818080..9818229,
FT                   9818457..9818525,9818639..9818739,9819387..9819471,
FT                   9819750..9819828,9819993..9820147,9820222..9820257)
FT                   /codon_start=1
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT125364.1
FT                   protein_id=mCP71307.1 isoform=CRA_a"
FT                   /protein_id="EDL38327.1"
FT                   /translation="SRGGQARLPASVRRSCGGDRVRCCVGEALRPKAERAMADENQEIG
FT                   GIHFPFPFPPYPIQKDFMAELYKVLEGGKIGIFESPTGTGKSLSLICGALSWLRDFEKK
FT                   KLQAEALLLAPGSGPPSSEKNSLLTSSSCQEPTDTPRPAGEPDWVTEFVQKKEERDLVE
FT                   RLREEQVRRRKREERLKEVCQDGRLRFAAKRTKHEEEETEALLRLSREMLDAGTGPEQL
FT                   EQLECGEEHLVLAEYESDEERRGSRVDEAEDDLEEEHITKIYYCSRTHSQLAQFVREVL
FT                   KSPFGKETRLVSLGSRQTLCVNEDVKNLGSVQLMNDRCVDMQRSKREKNGTGEDKPKRK
FT                   RQKIQTSCPFYNHEQMELLRDEILLEVKDMEQLVALGKEARACPYYGSRFAIPAAQLVV
FT                   LPYPMLLHAATRQAAGIRLQGQVVIIDEAHNLIDTITNIHSTEVNGSQLCQAHSQLLQY
FT                   MERYRKRLKAKNLMYIKQILYLLEKFVAVLGGNVKQNPTTQSLSQTGSELKSINDFLFQ
FT                   SQVDNINLFKVQRYLEKSMLSRKLFGFTECFGVVLPSLSDSQENRGLAGFQQFLKSLQS
FT                   GPTEDSPEEGQAVALRPASPLMHIEAFLAALTTANQDGRVIVNRQGSVGQSSLKFLLLN
FT                   PAVHFAQVVKECRAVVIAGGTMQPMSDFREQLLACSGVEAGRVVEFSCGHVIPPDNILP
FT                   LIICSGPSNQQLEFTYQRRELPQMVEETGRILCNLCNVVPGGVVCFLPSYEYLRQVHAH
FT                   WDKTGLLTRLSVRKKIFQEPKRASQVEQVLMAYSKCIMSCSHSEGHLTGALLLSVVGGK
FT                   MSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLNQTLPRTQGQPLPGTVLIENLC
FT                   MKAINQSIGRAIRHQRDFASIVLLDHRYARPSILAKLPAWIRDRVEVKATFGPAFAAVR
FT                   KFHREKSHPSLV"
FT   CDS             join(<9793065..9793168,9795598..9795745,9799282..9799527,
FT                   9799885..9799971,9800105..9800259,9802642..9802687,
FT                   9803510..9803617,9805247..9805334,9805714..9805919,
FT                   9807516..9807617)
FT                   /codon_start=1
FT                   /gene="Ddx11"
FT                   /locus_tag="mCG_124126"
FT                   /product="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
FT                   (CHL1-like helicase homolog, S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG124126.1 transcript_id=mCT193689.0
FT                   protein_id=mCP114635.0 isoform=CRA_b"
FT                   /protein_id="EDL38328.1"
FT                   /translation="SRGGQARLPASVRRSCGGDRVRCCVGEALRPKAERAMADENQEIG
FT                   GIHFPFPFPPYPIQKDFMAELYKVLEGGKIGIFESPTGTGKSLSLICGALSWLRDFEKK
FT                   KLQAEALLLAPGSGPPSSEKNSLLTSSSCQEPTDTPRPAGEPDWVTEFVQKKEERDLVE
FT                   RLREEQVRRRKREERLKEVCQDGRLRFAAKRTKHEEEETEALLRLSREMLDAGTGPEQL
FT                   EQLECGEEHLVLAEYESDEERRGSRVDEAEDDLEEEHITKIYYCSRTHSQLAQFVREVL
FT                   KSPFGKETRLVSLGSRQTLCVNEDVKNLGSVQLMNDRCVDMQRSKREKNGTGEDKPKRK
FT                   RQKIQTSCPFYNHEQMELLRDEILLEVKDMEQLVALGKEARACPYYGSRFAIPAAQWCY
FT                   PTQCCCMQLPDRLRESGYKVRWSLLTRLTT"
FT   gene            9862791..9869261
FT                   /locus_tag="mCG_148327"
FT                   /note="gene_id=mCG148327.0"
FT   mRNA            join(9862791..9865779,9868799..9869261)
FT                   /locus_tag="mCG_148327"
FT                   /product="mCG148327"
FT                   /note="gene_id=mCG148327.0 transcript_id=mCT188590.0
FT                   created on 13-JAN-2004"
FT   CDS             9865006..9865509
FT                   /codon_start=1
FT                   /locus_tag="mCG_148327"
FT                   /product="mCG148327"
FT                   /note="gene_id=mCG148327.0 transcript_id=mCT188590.0
FT                   protein_id=mCP108806.0"
FT                   /protein_id="EDL38329.1"
FT                   /translation="MAFIKSWHESLGTWEYPAKFYPLCTVSAFLSFWELNPHDSLCEVL
FT                   ILWSAHISSFQSLSAVSGCQEAVGWVMAKVLKTLSFSSHDTASSHFSLADCCVFPQGCC
FT                   SLICPLWNGGPREARTGSPQACLSIGLVLPGRSLVEGCSGSLTAPFLDERLVTAQPFML
FT                   FSFC"
FT   gene            complement(9980069..9980928)
FT                   /locus_tag="mCG_141370"
FT                   /note="gene_id=mCG141370.0"
FT   mRNA            complement(join(9980069..9980509,9980730..9980928))
FT                   /locus_tag="mCG_141370"
FT                   /product="mCG141370"
FT                   /note="gene_id=mCG141370.0 transcript_id=mCT174986.0
FT                   created on 28-OCT-2002"
FT   CDS             complement(join(9980385..9980509,9980730..9980889))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141370"
FT                   /product="mCG141370"
FT                   /note="gene_id=mCG141370.0 transcript_id=mCT174986.0
FT                   protein_id=mCP97905.0"
FT                   /protein_id="EDL38330.1"
FT                   /translation="MSAIFNFQSLLTVILLPIYTCAYIRFLAPSILDRNKTGLLGIFWK
FT                   CAQIGERKKSLCRHMLYSDGFQHPLHTVALETTSMCLLSDCKQGLASRK"
FT   gene            complement(9998870..>10110544)
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /note="gene_id=mCG120621.1"
FT   mRNA            complement(join(9998870..10000038,10002368..10002424,
FT                   10004690..10006229,10008219..10008250,10010108..10010386,
FT                   10015984..10016238,10019881..10020048,10028375..10028633,
FT                   10030389..10030555,10039945..10040103,10040543..10040649,
FT                   10041235..10042543,10047958..10048017,10098221..10098379,
FT                   10100309..10100533,10110115..>10110544))
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /product="RIKEN cDNA 1110012J17"
FT                   /note="gene_id=mCG120621.1 transcript_id=mCT121802.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(join(10002386..10002424,10004690..10006229,
FT                   10008219..10008250,10010108..10010386,10015984..10016238,
FT                   10019881..10020048,10028375..10028633,10030389..10030555,
FT                   10039945..10040103,10040543..10040649,10041235..10042543,
FT                   10047958..10048017,10098221..10098379,10100309..10100533,
FT                   10110115..>10110543))
FT                   /codon_start=1
FT                   /gene="1110012J17Rik"
FT                   /locus_tag="mCG_120621"
FT                   /product="RIKEN cDNA 1110012J17"
FT                   /note="gene_id=mCG120621.1 transcript_id=mCT121802.1
FT                   protein_id=mCP71124.1"
FT                   /protein_id="EDL38331.1"
FT                   /translation="SSDLSDCASEPLSDEQRLLPAASSDAESGTGSSDREPIRGAPTPS
FT                   SGSRGPPPGSPEPPILLAAPPVASACLGGRSSPGGASTGSPGPGSQEDVGGRAPPERTI
FT                   LGTSKEPSLGEQPRLLVVAEEEELLREMEELRSENDYLKDELDELRAEMEEMRDSYLEE
FT                   DGYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVDGELIRSLEQDLKVAKD
FT                   VSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQNEVERLRESSLKRRGSRE
FT                   MYKEKKLVNQDDSADLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVD
FT                   SPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEMEDIRVQHE
FT                   REGTGRDHVPSTPTSPFGDSMESSTELRRHLQFVEEEAELLRRSISEIEDHNRQLTHEL
FT                   SKFKFEPHQESGWLGDGVSKGPAASVPLQEELKSARLQIDELSGKVLKLQCENRLLLSN
FT                   AQRGDLAAHLGLRAPSPRDSDAESDAGKKESDGEEGRLPQPKREGPVGGESDSEDMFEK
FT                   TSGFGSGKPSEASEPCPAELLRVREDTECLVTIKLEAQRLERTVERLISDTDGFIHDSG
FT                   LRGNGLASPGVQGGGGEGNSPSEPHLLETINVRMKAFRKELQAFLEQMSRIVDGLSPLS
FT                   HLTESSSFLSTVTSVSRDSPIGTLGKGVGPRLADNPGWGRGASSEEAGFEGKPPAAAAT
FT                   RSCRPPSPPRSKLREQLEWQLNQDRGDEREGLRLRATRELHRRADGDSGSHHGLGGQSC
FT                   FNLEMEEDHLYALRWKELEMHSLALQNTLHKRTWSDEKNLLQQELRSLKQNIFLFYVKL
FT                   SWSVEPKSIVEVKIIMPPGFQSEHPENVPGLAELGVQGVHQTDGIDQEDADQGCSLPMG
FT                   EHAPHSLVQISEHGSRLQSSDGGPLNKQVVENQQLFRALKALLEDFRSELREDEHARLR
FT                   LQQQYASDKAAWDVEWAVLKCRLEQLEEKTEKSLGELDSSAEGKGALKKEREVHQKLLA
FT                   DSHSLVMDLRWQIHHREKNWNREKVELLERLDSERQEWGRQKEELLWRVEQLQKEKSPR
FT                   RSGSFLCSRREDDTRPYPHQGSLHSSRPVSMWPCEDADSIPFEDRPLSKLKESDRCSAS
FT                   ENLYLDALSLDDDPGDPPPLRNCLAEEEESRKGNLQRAVSVSCMSEFQRLMDVSPFLPE
FT                   KGLPSAGSKEDVTPPLSPDDLKYIEEFHSNDWDYASPRAEADRPPDPWADRTEMGRVGH
FT                   EATTEPCPDPSWYLTTSVTMTTDTMTSPEHCQKQPLRTHVLTEQSGVHVLHSPPAIRRV
FT                   DSIASGGEGRSRADPEGPFPMSRARGNLADAKGGHPEPVLNRWPCTPPRHPRDCVEGSL
FT                   RPLDRPICPSLGFASPLNSLDMSKNMSDDMKEVAFSVRNAICAGPAEPHVRDMACQTNG
FT                   SRTAGTQTIQTISVGLQTEALRASGVTSSPHKCLTPKAGGGTTPVSSPSRSLRSRQVAP
FT                   AIEKVQAKFERTCCSPKYGSPKLQRKPLSKADQPNSRTSPGIPQKGFSESAWARSTTTR
FT                   ESPVHTTINDGLSSLFNIIDHSPIGVRAGSRSRSAEPRQELGPGQETGTSSRGRSPSPL
FT                   GVGSETFREEGGESTPVRQDLSAPPGYTLTENVARILNKKLLEHALKEERKQASHGSSG
FT                   LTSDSHTGEPVPAEPGSMENQTVLLTAPWGL"
FT   gene            complement(10155897..>10180988)
FT                   /locus_tag="mCG_9059"
FT                   /note="gene_id=mCG9059.1"
FT   mRNA            complement(join(10155897..10157188,10158729..10158833,
FT                   10159404..10159493,10161695..10161833,10167418..10167479,
FT                   10180857..>10180988))
FT                   /locus_tag="mCG_9059"
FT                   /product="mCG9059"
FT                   /note="gene_id=mCG9059.1 transcript_id=mCT9105.1 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(10157075..10157188,10158729..10158833,
FT                   10159404..10159493,10161695..10161833,10167418..10167479,
FT                   10180857..>10180988))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9059"
FT                   /product="mCG9059"
FT                   /note="gene_id=mCG9059.1 transcript_id=mCT9105.1
FT                   protein_id=mCP6311.1"
FT                   /protein_id="EDL38332.1"
FT                   /translation="FPSSTPGGGGGGGSAERVEGARGPGARGRRPEREPYACMDPSAAG
FT                   VDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPK
FT                   WMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVD
FT                   EIFLKLVDDILKKMPLDVLRNELSNSILSLQPEPEIPPELPPPRPHVRCC"
FT   gene            complement(<10213138..10252494)
FT                   /locus_tag="mCG_9060"
FT                   /note="gene_id=mCG9060.1"
FT   mRNA            complement(join(<10213138..10214150,10217433..10217906,
FT                   10251021..10251155,10252319..10252494))
FT                   /locus_tag="mCG_9060"
FT                   /product="mCG9060"
FT                   /note="gene_id=mCG9060.1 transcript_id=mCT9107.0 created on
FT                   18-APR-2003"
FT   CDS             complement(join(10213138..10214150,10217433..10217906,
FT                   10251021..10251155,10252319..10252406))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9060"
FT                   /product="mCG9060"
FT                   /note="gene_id=mCG9060.1 transcript_id=mCT9107.0
FT                   protein_id=mCP6312.1"
FT                   /db_xref="GOA:Q9CU24"
FT                   /db_xref="InterPro:IPR025946"
FT                   /db_xref="MGI:MGI:1921806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CU24"
FT                   /protein_id="EDL38333.1"
FT                   /translation="MEQTWDSYISSLNQNSLPRQVEVTQGRYSGSLENLSFSKGDIITV
FT                   VDLEPVFVRAELKDGDQVLDVVTIPLRYEGNFQLMADPVSFETVADLTRSVRLPQSPVA
FT                   PRSPPRFQNSIPISADNLPMKLRKGETLSLIGFQESRGRRLLQCKVLRKKPPLTVLLPM
FT                   DCRGHFLECQDDRFYSIDTIVRWKMLAGRKRTVRVQARHHPKLLGPLVPEHFRGHLVLY
FT                   PCFSVTANLLGETRVSIPSDLDISVTEIARLDRKPRTTMRQIYSMEESKFPVRVKIMNV
FT                   VQSESKEYPKPLKRGQLLTILKTEEVKKFVASEISQGKKGKCFLVPYTYQGLVLRRGRY
FT                   FYAVSDVAAAMKHGELCFQASQDYTSYLGSFASFRANECFLALKKSVVSAEIHGELHRV
FT                   EVLKCLNIATKAHVKLPLFAVGKFLELFDGARPGTLQELCQVTRLPCHVRVTSPDPSMT
FT                   VDPLYGTKELRIENVIIEQCLIAKDEPTLEDIISSADMYREWPETTFEIPIEKISCEVL
FT                   VVEERSWIADVRKERCRPLQSIQEVTKESLAFSNCLVIRRPPPPVPKPRSLF"
FT   gene            complement(10322347..>10851241)
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /note="gene_id=mCG120620.0"
FT   mRNA            complement(join(10322347..10322485,10332793..10332928,
FT                   10338155..10338318,10340398..10340523,10343035..10343166,
FT                   10344128..10344301,10345210..10345359,10348220..10348355,
FT                   10348529..10348683,10353122..10353238,10380472..10380569,
FT                   10416766..10416853,10464076..10464263,10469078..10469152,
FT                   10472436..10472587,10545661..10545793,10575732..10575768,
FT                   10576731..10577004,10597182..10597284,10600868..10601069,
FT                   10609808..10609917,10613550..10613858,10700291..10700584,
FT                   10704180..10704354,10720999..10721114,10733548..10733626,
FT                   10753307..10753578,10851113..>10851241))
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   transcript variant mCT121801"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT121801.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(<10348257..10348355,10348529..10348683,
FT                   10353122..10353238,10380472..10380569,10399376..>10399412))
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   transcript variant mCT170877"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT170877.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(<10348257..10348355,10348529..10348683,
FT                   10353122..10353238,10380472..10380569,10399376..>10399412))
FT                   /codon_start=1
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT170877.0
FT                   protein_id=mCP93795.0 isoform=CRA_b"
FT                   /protein_id="EDL38335.1"
FT                   /translation="GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGR
FT                   VKCCKYWPDDTEIYKDIKVTLIDTELLAEYVIRTFAVEKRGIHEIREIRQFHFTGWPDH
FT                   GVPYHATGLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDI
FT                   YNCVR"
FT   CDS             complement(join(10380568..10380569,10416766..10416853,
FT                   10464076..10464263,10469078..10469152,10472436..10472587,
FT                   10545661..10545793,10575732..10575768,10576731..10577004,
FT                   10597182..10597284,10600868..10601069,10609808..10609917,
FT                   10613550..10613858,10700291..10700584,10704180..10704354,
FT                   10720999..10721114,10733548..10733626,10753307..10753578,
FT                   10851113..>10851239))
FT                   /codon_start=1
FT                   /gene="Ptprm"
FT                   /locus_tag="mCG_120620"
FT                   /product="protein tyrosine phosphatase, receptor type, M,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG120620.0 transcript_id=mCT121801.1
FT                   protein_id=mCP71093.1 isoform=CRA_a"
FT                   /protein_id="EDL38334.1"
FT                   /translation="VGGCLFDEPYSTCGYSQADEDDFNWEQVNTLTKPTSDPWMPSGSF
FT                   MLVNTSGKPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKVNNGPLGN
FT                   PIWNISGDPTRTWHRAELAISTFWPNFYQVIFEVVTSGHQGYLAIDEVKVLGHPCTRTP
FT                   HFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASF
FT                   NVVNTTKRDAGKYRCMICTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNA
FT                   NSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGT
FT                   GSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYGYQ
FT                   VGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELTVQTDEDL
FT                   PGAVPTESIQGSAFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
FT                   KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYEFETPLNQ
FT                   TDNTVTVMLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQ
FT                   YYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYYQAASRANGETKIDCV
FT                   RVATKGAVTPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKET
FT                   MSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMGTHNLNGRSVSSPSSFTMKTNTLSTS
FT                   VPNSYYPDETHTMASDTSSLAQPHTYKKREAADVPYQTGQLHPAIRVADLLQHITQMKC
FT                   AEGYGFKEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIA"
FT   gene            complement(10502125..10505962)
FT                   /locus_tag="mCG_148329"
FT                   /note="gene_id=mCG148329.0"
FT   mRNA            complement(10502125..10505962)
FT                   /locus_tag="mCG_148329"
FT                   /product="mCG148329"
FT                   /note="gene_id=mCG148329.0 transcript_id=mCT188592.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10502605..10502889)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148329"
FT                   /product="mCG148329"
FT                   /note="gene_id=mCG148329.0 transcript_id=mCT188592.0
FT                   protein_id=mCP108811.0"
FT                   /protein_id="EDL38336.1"
FT                   /translation="MTNSLQEWRVKAFPQALGFSHSGSSWPHPHRVYSGIGTGREGCSS
FT                   IGTASLEHYPEAPVAVVSWSYHGPCMRPCPKFPMRKNLLLSAILFRSWQ"
FT   gene            10668771..10677682
FT                   /locus_tag="mCG_148343"
FT                   /note="gene_id=mCG148343.0"
FT   mRNA            join(10668771..10669087,10674881..10677682)
FT                   /locus_tag="mCG_148343"
FT                   /product="mCG148343"
FT                   /note="gene_id=mCG148343.0 transcript_id=mCT188606.0
FT                   created on 13-JAN-2004"
FT   CDS             10675063..10675401
FT                   /codon_start=1
FT                   /locus_tag="mCG_148343"
FT                   /product="mCG148343"
FT                   /note="gene_id=mCG148343.0 transcript_id=mCT188606.0
FT                   protein_id=mCP108823.0"
FT                   /db_xref="MGI:MGI:3641639"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRN3"
FT                   /protein_id="EDL38337.1"
FT                   /translation="MVCKETASRGQAQLHTYQISSKTLHLKMPLCPQYKVDQRLFSYLD
FT                   YGRQLVLCYTKTSYHISGLYIKKRSPVLPEKEHTVSFPNMSGERQIYYLLWTYSKIPIR
FT                   NYKLSCAN"
FT   gene            <11355045..11481249
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /note="gene_id=mCG120096.0"
FT   mRNA            join(<11355045..11355174,11374686..11374856,
FT                   11375154..11375266,11395705..11395947,11396942..11397121,
FT                   11400233..11400322,11401483..11401600,11403254..11403432,
FT                   11404058..11404163,11404956..11405116,11406252..11406392,
FT                   11408846..11409019,11410627..11410728,11411023..11411234,
FT                   11411996..11412107,11414911..11415021,11419667..11419794,
FT                   11422030..11422116,11422889..11423100,11425212..11425318,
FT                   11425644..11425824,11426559..11426695,11427523..11427699,
FT                   11429039..11429182,11431223..11431402,11432248..11432433,
FT                   11432965..11433092,11434272..11434392,11435409..11435546,
FT                   11437436..11437557,11438916..11439002,11439266..11439459,
FT                   11440407..11440549,11442501..11442590,11443558..11443669,
FT                   11444505..11444667,11449426..11449633,11449817..11449933,
FT                   11450052..11450215,11452786..11452921,11453791..11453884,
FT                   11455288..11455404,11457118..11457300,11457574..11457728,
FT                   11459350..11459493,11461487..11461620,11462997..11463147,
FT                   11463959..11464083,11466375..11466525,11467808..11467952,
FT                   11468437..11468578,11468667..11468781,11468927..11469097,
FT                   11470036..11470187,11470926..11471111,11472453..11472588,
FT                   11473778..11473890,11474455..11474644,11475603..11475761,
FT                   11476127..11476280,11477184..11477317,11480118..11480340,
FT                   11480889..11481249)
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /product="laminin, alpha 1"
FT                   /note="gene_id=mCG120096.0 transcript_id=mCT121277.1
FT                   created on 24-JUL-2002"
FT   CDS             join(<11355045..11355174,11374686..11374856,
FT                   11375154..11375266,11395705..11395947,11396942..11397121,
FT                   11400233..11400322,11401483..11401600,11403254..11403432,
FT                   11404058..11404163,11404956..11405116,11406252..11406392,
FT                   11408846..11409019,11410627..11410728,11411023..11411234,
FT                   11411996..11412107,11414911..11415021,11419667..11419794,
FT                   11422030..11422116,11422889..11423100,11425212..11425318,
FT                   11425644..11425824,11426559..11426695,11427523..11427699,
FT                   11429039..11429182,11431223..11431402,11432248..11432433,
FT                   11432965..11433092,11434272..11434392,11435409..11435546,
FT                   11437436..11437557,11438916..11439002,11439266..11439459,
FT                   11440407..11440549,11442501..11442590,11443558..11443669,
FT                   11444505..11444667,11449426..11449633,11449817..11449933,
FT                   11450052..11450215,11452786..11452921,11453791..11453884,
FT                   11455288..11455404,11457118..11457300,11457574..11457728,
FT                   11459350..11459493,11461487..11461620,11462997..11463147,
FT                   11463959..11464083,11466375..11466525,11467808..11467952,
FT                   11468437..11468578,11468667..11468781,11468927..11469097,
FT                   11470036..11470187,11470926..11471111,11472453..11472588,
FT                   11473778..11473890,11474455..11474644,11475603..11475761,
FT                   11476127..11476280,11477184..11477317,11480118..11480340,
FT                   11480889..11481049)
FT                   /codon_start=1
FT                   /gene="Lama1"
FT                   /locus_tag="mCG_120096"
FT                   /product="laminin, alpha 1"
FT                   /note="gene_id=mCG120096.0 transcript_id=mCT121277.1
FT                   protein_id=mCP70876.1"
FT                   /protein_id="EDL38338.1"
FT                   /translation="STGETFPRSAGSGGDNMRGSGTGAALLVLLASVLWVTVRSQQRGL
FT                   FPAILNLATNAHISANATCGEKGPEMFCKLVEHVPGRPVRHAQCRVCDGNSTNPRERHP
FT                   ISHAIDGTNNWWQSPSIQNGREYHWVTVTLDLRQVFQVAYIIIKAANAPRPGNWILERS
FT                   VDGVKFKPWQYYAVSDTECLTRYKITPRRGPPTYRADNEVICTSYYSKLVPLEHGEIHT
FT                   SLINGRPSADDPSPQLLEFTSARYIRLRLQRIRTLNADLMTLSHRDLRDLDPIVTRRYY
FT                   YSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCEHNTCGESCDRCCPGYHQQPWRPGT
FT                   ISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAGQYSGGGVCVNCSQNTTGINCETC
FT                   IDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDDRHADLANGKWPGQCPCRKGYAG
FT                   DKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLCKKNVEGKNCDRCKPGFYNLKE
FT                   RNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVLGGHRQIS
FT                   INNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIII
FT                   KGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFNTRREIDRDQLMTVLANVTHLLI
FT                   RANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQGYTGTSCEACLPGYYRV
FT                   DGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQ
FT                   PCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVP
FT                   CNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHEN
FT                   GSLSGVCHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEGSVSDNCTEE
FT                   GQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGECLCPPHTQGLKC
FT                   EECEEAYWGLDPEQGCQCPCKKGFGGQSCHQCSLGYRSFPDCVPCGCDLRGTLPDTCDL
FT                   EQGLCSCSEDSGTCSCKENVVGPQCSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELE
FT                   GYVRTLITLASDQPLLHVVSQSNLKGTIEGVHFQPPDTLLDAEAVRQHIYAEPFYWRLP
FT                   KQFQGDQLLAYGGKLQYSVAFYSTLGTGTSNYEPQVLIKGGRARKHVIYMDAPAPENGV
FT                   RQDYEVQMKEEFWKYFNSVSEKHVTHSDFMSVLSNIDYILIKASYGQGLQQSRIANISM
FT                   EVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYREKLPESGGRGPRPLLAP
FT                   CVPCNCNNHSDVCDPELGKCLSCRDHTSGDHCELCASGYYGKVTGLPGDCTPCTCPHHP
FT                   PFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSAGYHGNPRAAGGSCQTCDCNPQGSV
FT                   HSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDCVSCDDDCVGPLLNDLDSVGDAVL
FT                   SLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKIRAEIQLEGIAEQTENLQKELTR
FT                   VLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITEKVATLNQTARKDFQPPVSALQ
FT                   SMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRIQKRFQKPQEKLKALKEANSL
FT                   LSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQEKKLRVQEEQNVTSELIAK
FT                   GREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVDDLVMQMSKRRARDLVHRA
FT                   EQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLTEEAEMLAADAHKTANKT
FT                   DLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELKNLTSQFQESMDNIMKQ
FT                   ANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALSLRVFNTSEDLSRVNA
FT                   TVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEENLSRNLSEIKLLIS
FT                   RARKQAASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDNLLFYLGSSSSSDF
FT                   LAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMGSLSVKEASAAEN
FT                   PPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGKSIGL
FT                   WNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILFSTFSPNGLLF
FT                   YLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQRNRKQGLLA
FT                   VFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRSYVGCIKNL
FT                   EISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLATFATKNSS
FT                   GILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAPTGSYSD
FT                   GQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKATPMLKM
FT                   RTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEPPTLP
FT                   QPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLIYYV
FT                   AHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMTVD
FT                   GQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLDK
FT                   DRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
FT                   SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVL
FT                   TVDGNAVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQ
FT                   VQSLDLSRAFDLQGVFPHSCPGPEP"
FT   gene            complement(11503680..>11666612)
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /note="gene_id=mCG120097.1"
FT   mRNA            complement(join(11503680..11504387,11508007..11508071,
FT                   11511865..11511937,11518972..11519101,11519750..11519947,
FT                   11522869..11522951,11526045..11526207,11530563..11530640,
FT                   11533301..11533392,11533495..11533660,11534635..11534777,
FT                   11537186..11537270,11543635..11543724,11546918..11547007,
FT                   11558284..11558501,11563595..11563818,11666449..>11666612))
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /product="Rho GTPase activating protein 28"
FT                   /note="gene_id=mCG120097.1 transcript_id=mCT121278.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(join(11504305..11504387,11508007..11508071,
FT                   11511865..11511937,11518972..11519101,11519750..11519947,
FT                   11522869..11522951,11526045..11526207,11530563..11530640,
FT                   11533301..11533392,11533495..11533660,11534635..11534777,
FT                   11537186..11537270,11543635..11543724,11546918..11547007,
FT                   11558284..11558501,11563595..11563818,11666449..>11666612))
FT                   /codon_start=1
FT                   /gene="Arhgap28"
FT                   /locus_tag="mCG_120097"
FT                   /product="Rho GTPase activating protein 28"
FT                   /note="gene_id=mCG120097.1 transcript_id=mCT121278.1
FT                   protein_id=mCP71279.1"
FT                   /protein_id="EDL38339.1"
FT                   /translation="GLGLCSGLARGHAPLRMEVEDSGGVVLTAYHSHARSQPQGAEPRC
FT                   ASRASHPLSRKSIPRCRRINRMLSNESLHPPSFSRSNSQASVDSSASMEEFLREIESIK
FT                   ESSVGASQEQPPTAAAAAAEVKPVDEGELEAEWLQDVGLSTLISGNEEEDGKALLSTLT
FT                   RTQAAAVKKRYNTYTQTLRKKNKQPVRDVRDIFGVSESPPSDSCEHATQLDGTKEEKDL
FT                   PGVTKTSRPLPDDASLSSTTLSNGAQDEEGGFVALQSGSVSILEAIPDIAVHTNGSADA
FT                   EQSVQSTLSDDDYHGKNVPAEAEELSFEVSYSEMVTEMPDRNKWKKSDIKKEDYVLTKF
FT                   IIQKTRFGLTETGDLSVEDMKKIRHLSLIELTAFFDAFGIQLKRNKTERVRGRDNGIFG
FT                   VPLTVLLDNDRKKDPAVKVPLVLQKFFQKVEESGLESEGIFRLSGCTAKVKQYREELDA
FT                   RFNADKFKWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFISLMERGPDIKVQFQALH
FT                   LMVMALPDANRDTAQALMAFFNKVIANESKNRMNLWNISTVMAPNLFFSRSKHSDCEEL
FT                   LLANTATHIIRLMLKYQKILWKVRRMNEATMLLKKQLPSMKKLLRRKTLDREVRASAGQ
FT                   THSRARVSMAIQLNSQTKAKDILAKFQYENSHGSSEHIKMQNQRLYEVGGNIGQHCLDP
FT                   DAYILDVYHINPHAEWVIKP"
FT   gene            complement(12032472..12033042)
FT                   /pseudo
FT                   /locus_tag="mCG_1039326"
FT                   /note="gene_id=mCG1039326.1"
FT   mRNA            complement(12032472..12033042)
FT                   /pseudo
FT                   /locus_tag="mCG_1039326"
FT                   /note="gene_id=mCG1039326.1 transcript_id=mCT157030.1
FT                   created on 28-OCT-2002"
FT   gene            <12086859..12290195
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /note="gene_id=mCG119974.1"
FT   mRNA            join(<12086859..12086924,12119227..12119331,
FT                   12120733..12120868,12123295..12123386,12124986..12125141,
FT                   12150371..12150493,12219089..12219203,12246372..12246474,
FT                   12289480..12290195)
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /product="RIKEN cDNA D930040M24"
FT                   /note="gene_id=mCG119974.1 transcript_id=mCT121153.1
FT                   created on 16-SEP-2002"
FT   CDS             join(<12086859..12086924,12119227..12119331,
FT                   12120733..12120868,12123295..12123386,12124986..12125141,
FT                   12150371..12150493,12219089..12219203,12246372..12246474,
FT                   12289480..12289657)
FT                   /codon_start=1
FT                   /gene="D930040M24Rik"
FT                   /locus_tag="mCG_119974"
FT                   /product="RIKEN cDNA D930040M24"
FT                   /note="gene_id=mCG119974.1 transcript_id=mCT121153.1
FT                   protein_id=mCP71043.1"
FT                   /protein_id="EDL38340.1"
FT                   /translation="WSWEQYLREGNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDAR
FT                   RPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDY
FT                   RKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEAVDRRNPCLMCVATI
FT                   ADIVEDRVRVHFDSLDDSFDYWVMLQRTPHGFLPNMKLEAVDKRNPQLIRVATIADVDD
FT                   YRVKIHFDGWDHKYDYWVDADSQDIHPIGWCDVTGHPLEVPYGSKHVKILPGQPACPTP
FT                   GCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRLREQTQANLELDPSHSKSENP
FT                   CNLNVNGKCENANSQCR"
FT   gene            <12422828..12436246
FT                   /locus_tag="mCG_5390"
FT                   /note="gene_id=mCG5390.1"
FT   mRNA            join(<12422828..12422997,12432133..12432195,
FT                   12435676..12436246)
FT                   /locus_tag="mCG_5390"
FT                   /product="mCG5390"
FT                   /note="gene_id=mCG5390.1 transcript_id=mCT4800.1 created on
FT                   16-SEP-2002"
FT   CDS             join(<12422830..12422997,12432133..12432195,
FT                   12435676..12435837)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5390"
FT                   /product="mCG5390"
FT                   /note="gene_id=mCG5390.1 transcript_id=mCT4800.1
FT                   protein_id=mCP6307.0"
FT                   /protein_id="EDL38341.1"
FT                   /translation="YSAAQVQQMLHQPLSMTSTSAHPFRDIPLSREQHCKLLPGVADIQ
FT                   ASQVARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPAL
FT                   KIYNSILMFRNSQDVTEDASSQEDKR"
FT   gene            <12498473..>12502110
FT                   /locus_tag="mCG_18208"
FT                   /note="gene_id=mCG18208.2"
FT   mRNA            join(<12498473..12498502,12501311..>12502110)
FT                   /locus_tag="mCG_18208"
FT                   /product="mCG18208"
FT                   /note="gene_id=mCG18208.2 transcript_id=mCT21396.2 created
FT                   on 16-SEP-2002"
FT   CDS             <12501333..>12502110
FT                   /codon_start=1
FT                   /locus_tag="mCG_18208"
FT                   /product="mCG18208"
FT                   /note="gene_id=mCG18208.2 transcript_id=mCT21396.2
FT                   protein_id=mCP6270.2"
FT                   /protein_id="EDL38342.1"
FT                   /translation="WAAGAPPTQASAAAALRASLAFHQFTMIATGGLLRISARKQDPLR
FT                   PPSQVPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMAVVGYWPKA
FT                   NAANRGGSKQLLPVGSSHRIGAISNSSNGNKNPAKSHSGTPGGANSSSVGGPWSPPPAR
FT                   SAATSSSSSSSSSSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLH
FT                   ENRDKKTKIINLRDLYSTVIDVHSLRAKDLAAAAAAA"
FT   gene            <12713984..12757933
FT                   /locus_tag="mCG_145588"
FT                   /note="gene_id=mCG145588.0"
FT   mRNA            join(<12713984..12714046,12755929..12756692,
FT                   12756743..12757933)
FT                   /locus_tag="mCG_145588"
FT                   /product="mCG145588"
FT                   /note="gene_id=mCG145588.0 transcript_id=mCT185012.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<12756652..12756692,12756743..12757175)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145588"
FT                   /product="mCG145588"
FT                   /note="gene_id=mCG145588.0 transcript_id=mCT185012.0
FT                   protein_id=mCP106311.0"
FT                   /protein_id="EDL38343.1"
FT                   /translation="KSFRLFRTAIHTHIHTACMHTCIYAHTLTHMHTHMHTYTCTQAHI
FT                   LTCTYSHAHTCTQYKHIHSQMHTNIHMHMPHTHAHTHTHTHTHTHTPAYLIHLHRVGTN
FT                   LCLVTPICFPFICLVLAILESPESPVSLNQVCVFLAQLCSLCGSEGLTFFTPC"
FT   gene            <12811096..12942071
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /note="gene_id=mCG119973.1"
FT   mRNA            join(<12811096..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12924941)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT193697"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT193697.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<12811096..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922889)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT193697.0
FT                   protein_id=mCP114629.0 isoform=CRA_d"
FT                   /protein_id="EDL38347.1"
FT                   /translation="AASSRAESPAHRRAGRQRQPGPHAAARPAFPPPPEQSTMTTESGS
FT                   DSESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQQPALEQFPEAAAHSTPV
FT                   KREIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKRPKSMQCKVTLL
FT                   DGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIR
FT                   SGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQS
FT                   ELGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLS
FT                   MYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRP
FT                   GEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRT
FT                   QAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGASVSENHEIYMKDSVSAAEVGTGQY
FT                   ATTKGISQTNLITTVTPEKKAEEERVEEEDRRKKAEEATPVTALRHEGKTDSERTDTAA
FT                   DGETSATEVRIKSKHGQKVPSTYALGVTPTEKKCWLWAETRFCCCCCYHFF"
FT   mRNA            join(<12811098..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922757,12925975..12926010,
FT                   12926797..12926988,12935967..12936089,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12939694..12939810,12940933..12942071)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT121152"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT121152.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12811099..12811198,12861234..12861451,
FT                   12863561..12863758,12890417..12890521,12891819..12891861,
FT                   12895660..12895735,12899604..12899822,12900698..12900785,
FT                   12905460..12905612,12909435..12909532,12911073..12911248,
FT                   12914185..12914405,12922704..12922757,12925975..12926010,
FT                   12926797..12926988,12935967..12936089,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12939694..12939804)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT121152.0
FT                   protein_id=mCP71014.0 isoform=CRA_e"
FT                   /protein_id="EDL38348.1"
FT                   /translation="ASSRAESPAHRRAGRQRQPGPHAAARPAFPPPPEQSTMTTESGSD
FT                   SESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQQPALEQFPEAAAHSTPVK
FT                   REIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKRPKSMQCKVTLLD
FT                   GSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRS
FT                   GAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSE
FT                   LGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSM
FT                   YGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPG
FT                   EFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQ
FT                   AQTRRASALIDRPAPYFERSSSKRYTMSRSLDGASVSENHEIYMKDSVSAAEVGTGQYA
FT                   TTKGISQTNLITTVTPEKKAEEERVEEEDRRKKAEEATPVTALRHEGKTDSERTDTAAD
FT                   GETSATESDQEEDAEIKAQDLDKTQDELMKHQTNISELKRTFLETSTETALTNEWEKRL
FT                   STSPVRLAARQEDAPMIEPLVPEETKQSSGEKLMDGSEILSLLESARKPTEFIGGVSST
FT                   TQSWVQKLETKTEPVEAEVESTPHPQPLSTEKVLQETILVEERHVMSVHASGDASHTAR
FT                   DEVDAAESTPTDRRHTGKGKEGSSVTEAAKEQRGEEVDQSAPEQEQPATVSHEEEQAST
FT                   IRTSEGLEQKSHFESSTVRVESTSVGSISPGGAKLEISTKEVPVVHTETKTITYESSQV
FT                   DPGADLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQ
FT                   ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED"
FT   mRNA            join(<12861257..12861451,12863561..12863758,
FT                   12890417..12890521,12891819..12891861,12895660..12895735,
FT                   12899604..12899822,12900698..12900785,12905460..12905612,
FT                   12909435..12909532,12911073..12911248,12914239..12914405,
FT                   12922704..12922757,12926797..12926988,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12940933..12941197)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170866"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170866.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12861257..12861451,12863561..12863758,
FT                   12890417..12890521,12891819..12891861,12895660..12895735,
FT                   12899604..12899822,12900698..12900785,12905460..12905612,
FT                   12909435..12909532,12911073..12911248,12914239..12914405,
FT                   12922704..12922757,12926797..12926988,12936621..12936998,
FT                   12937984..12938115,12938795..12938893,12939339..12939419,
FT                   12940933..12940938)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170866.0
FT                   protein_id=mCP93785.0 isoform=CRA_a"
FT                   /protein_id="EDL38344.1"
FT                   /translation="SGSDSESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQ
FT                   QPALEQFPEAAAHSTPVKREIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSP
FT                   LKIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAE
FT                   NQKNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRL
FT                   PCSFVTLALLGSYTVQSELGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGM
FT                   TPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPK
FT                   VLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAP
FT                   PKKFLTLGSKFRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYA
FT                   TTKGISQTNLITTVTPEKKAEEERVEEEDRRKKAEEATPVTALRHEGKTDSERTDTAAD
FT                   GETSATEDLDKTQDELMKHQTNISELKRTFLETSTETALTNEWEKRLSTSPVRLAARQE
FT                   DAPMIEPLVPEEKLETKTEPVEAEVESTPHPQPLSTEKVLQETILVEERHVMSVHASGD
FT                   ASHTARDEVDAAESTPTDRRHTGKGKEGSSVTEAAKEQRGEEVDQSAPEQEQPATVSHE
FT                   EEQASTIRTSEGLEQKSHFESSTVRVESTSVGSISPGGAKLEISTKEVPVVHTETKTIT
FT                   YESSQVDPGADLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDA
FT                   DIDHDQE"
FT   mRNA            join(<12863561..12863758,12890417..12890521,
FT                   12899604..12899681)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170868"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170868.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12863561..12863758,12890417..12890521,
FT                   12899604..12899633)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170868.0
FT                   protein_id=mCP93784.0 isoform=CRA_c"
FT                   /protein_id="EDL38346.1"
FT                   /translation="IGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKR
FT                   PKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKVLP
FT                   LLAAAR"
FT   mRNA            join(<12914384..12914405,12922704..12922757,
FT                   12926797..12926988,12933126..12933328)
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, transcript
FT                   variant mCT170867"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170867.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<12914385..12914405,12922704..12922757,
FT                   12926797..12926988,12933126..12933233)
FT                   /codon_start=1
FT                   /gene="Epb4.1l3"
FT                   /locus_tag="mCG_119973"
FT                   /product="erythrocyte protein band 4.1-like 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG119973.1 transcript_id=mCT170867.0
FT                   protein_id=mCP93786.0 isoform=CRA_b"
FT                   /protein_id="EDL38345.1"
FT                   /translation="ALRHEGKTDSERTDTAADGETSATEDLDKTQDELMKHQTNISELK
FT                   RTFLETSTETALTNEWEKRLSTSPVRLAARQEDAPMIEPLVPEETKEEREISEKVVFLQ
FT                   QGSSPFLESQVKGKKHVVFA"
FT   gene            complement(12927455..>12929303)
FT                   /locus_tag="mCG_145583"
FT                   /note="gene_id=mCG145583.0"
FT   mRNA            complement(join(12927455..12927999,12928219..12928288,
FT                   12929153..>12929303))
FT                   /locus_tag="mCG_145583"
FT                   /product="mCG145583"
FT                   /note="gene_id=mCG145583.0 transcript_id=mCT185007.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(12927933..12927999,12928219..12928288,
FT                   12929153..>12929303))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145583"
FT                   /product="mCG145583"
FT                   /note="gene_id=mCG145583.0 transcript_id=mCT185007.0
FT                   protein_id=mCP106305.0"
FT                   /protein_id="EDL38349.1"
FT                   /translation="EGEKEKMEEGEDSEEEEEEKQSRSTWSGETASSKGSHRWKRWSSS
FT                   GRSAQWTRPPHLALESILENQIPFLRIAHSSLFRWTGFVVNTVMTGYWPW"
FT   gene            <12967858..12994907
FT                   /locus_tag="mCG_145586"
FT                   /note="gene_id=mCG145586.0"
FT   mRNA            join(<12967858..12967893,12970558..12970781,
FT                   12993767..12994907)
FT                   /locus_tag="mCG_145586"
FT                   /product="mCG145586"
FT                   /note="gene_id=mCG145586.0 transcript_id=mCT185010.0
FT                   created on 05-JUN-2003"
FT   CDS             <12994016..12994321
FT                   /codon_start=1
FT                   /locus_tag="mCG_145586"
FT                   /product="mCG145586"
FT                   /note="gene_id=mCG145586.0 transcript_id=mCT185010.0
FT                   protein_id=mCP106308.0"
FT                   /protein_id="EDL38350.1"
FT                   /translation="RHALAHLAFICFKIGDYNNIHFIPPSQYCFGCSGSFVIKEQCIWG
FT                   RIFFLATKKLNFYRSCGEWIDFGQCAIFLTVNRESSNPQTEYALPFMSVFKLLLID"
FT   gene            13033444..13041008
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /note="gene_id=mCG18206.1"
FT   mRNA            join(13033444..13033530,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT170894"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170894.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(13033626..13033672,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT170893"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170893.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(13034104..13034487,13035681..13035764,
FT                   13037572..13041008)
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, transcript variant
FT                   mCT21394"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT21394.1 created
FT                   on 24-JUL-2002"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170893.0
FT                   protein_id=mCP93812.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38351.1"
FT                   /translation="MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDV
FT                   KFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKED
FT                   VNLMMSSGQILGIRFLDKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDV
FT                   EEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVES
FT                   METPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQA
FT                   CGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGK
FT                   SFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFA
FT                   KASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT170894.0
FT                   protein_id=mCP93811.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38352.1"
FT                   /translation="MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDV
FT                   KFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKED
FT                   VNLMMSSGQILGIRFLDKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDV
FT                   EEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVES
FT                   METPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQA
FT                   CGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGK
FT                   SFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFA
FT                   KASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS"
FT   CDS             join(13035762..13035764,13037572..13038918)
FT                   /codon_start=1
FT                   /gene="Zfp161"
FT                   /locus_tag="mCG_18206"
FT                   /product="zinc finger protein 161, isoform CRA_a"
FT                   /note="gene_id=mCG18206.1 transcript_id=mCT21394.1
FT                   protein_id=mCP6331.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544H8"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1195345"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H8"
FT                   /protein_id="EDL38353.1"
FT                   /translation="MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDV
FT                   KFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKED
FT                   VNLMMSSGQILGIRFLDKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDV
FT                   EEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVES
FT                   METPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQA
FT                   CGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGK
FT                   SFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFA
FT                   KASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS"
FT   gene            complement(13067784..13089717)
FT                   /locus_tag="mCG_59952"
FT                   /note="gene_id=mCG59952.2"
FT   mRNA            complement(join(13067784..13068524,13074809..13074915,
FT                   13089563..13089717))
FT                   /locus_tag="mCG_59952"
FT                   /product="mCG59952"
FT                   /note="gene_id=mCG59952.2 transcript_id=mCT60135.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13068509..13068524,13074809..13074915,
FT                   13089563..13089715))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59952"
FT                   /product="mCG59952"
FT                   /note="gene_id=mCG59952.2 transcript_id=mCT60135.2
FT                   protein_id=mCP28768.2"
FT                   /protein_id="EDL38354.1"
FT                   /translation="MHRSAGGRRRGNPAQLLLGPRASLAIHRRRSRALLPLPPKQEGRK
FT                   GKPDRKGAGCQYKVCLPLCPPIRNAPRDNVRRPAIFCASGNGRKEK"
FT   gene            13089770..13139633
FT                   /locus_tag="mCG_66639"
FT                   /note="gene_id=mCG66639.2"
FT   mRNA            join(13089770..13089927,13137556..13139633)
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, transcript variant mCT66822"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT66822.2 created
FT                   on 21-APR-2003"
FT   CDS             join(13089912..13089927,13137556..13137749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, isoform CRA_b"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT66822.2
FT                   protein_id=mCP28805.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWD5"
FT                   /db_xref="MGI:MGI:2444600"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWD5"
FT                   /protein_id="EDL38356.1"
FT                   /translation="MVFAPGEKSGKELEEVKLQNTSKQIVQNAILQAMRQVSQESLRRE
FT                   GRPGDSRAWGQLGGCELTKKHEKK"
FT   mRNA            join(<13090219..13090543,13137556..13139633)
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, transcript variant mCT182040"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT182040.0 created
FT                   on 21-APR-2003"
FT   CDS             join(<13090543..13090543,13137556..13137749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66639"
FT                   /product="mCG66639, isoform CRA_a"
FT                   /note="gene_id=mCG66639.2 transcript_id=mCT182040.0
FT                   protein_id=mCP104962.0 isoform=CRA_a"
FT                   /protein_id="EDL38355.1"
FT                   /translation="GEKSGKELEEVKLQNTSKQIVQNAILQAMRQVSQESLRREGRPGD
FT                   SRAWGQLGGCELTKKHEKK"
FT   gene            complement(13124012..13126285)
FT                   /locus_tag="mCG_148326"
FT                   /note="gene_id=mCG148326.0"
FT   mRNA            complement(join(13124012..13124115,13125565..13126285))
FT                   /locus_tag="mCG_148326"
FT                   /product="mCG148326"
FT                   /note="gene_id=mCG148326.0 transcript_id=mCT188589.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13125671..13126054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148326"
FT                   /product="mCG148326"
FT                   /note="gene_id=mCG148326.0 transcript_id=mCT188589.0
FT                   protein_id=mCP108805.0"
FT                   /protein_id="EDL38357.1"
FT                   /translation="MDGGARFGWAKKPDTEWPRSGATGHNWNRNLGGLCSQTAPPHLRS
FT                   RSLCRPLPAAAGVAEATKTPLHPNPKPRAELRVLTPVSDLPNPLKLLQGPCLLAHLLKK
FT                   WTYRSCLEFGSKPETSCSKILIT"
FT   gene            complement(13409620..13418730)
FT                   /locus_tag="mCG_148325"
FT                   /note="gene_id=mCG148325.0"
FT   mRNA            complement(join(13409620..13412113,13418443..13418730))
FT                   /locus_tag="mCG_148325"
FT                   /product="mCG148325"
FT                   /note="gene_id=mCG148325.0 transcript_id=mCT188588.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13409693..13409875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148325"
FT                   /product="mCG148325"
FT                   /note="gene_id=mCG148325.0 transcript_id=mCT188588.0
FT                   protein_id=mCP108804.0"
FT                   /protein_id="EDL38358.1"
FT                   /translation="MYFIVFIVHFLIYICLYMYIFPPYFYPLTSCIISQLFKSVTLFLK
FT                   TVCVCVAQFLPPSCL"
FT   gene            complement(13537102..>13567192)
FT                   /locus_tag="mCG_145007"
FT                   /note="gene_id=mCG145007.0"
FT   mRNA            complement(join(13537102..13538264,13540466..13540586,
FT                   13567026..>13567192))
FT                   /locus_tag="mCG_145007"
FT                   /product="mCG145007"
FT                   /note="gene_id=mCG145007.0 transcript_id=mCT184431.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(13538061..13538264,13540466..>13540567))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145007"
FT                   /product="mCG145007"
FT                   /note="gene_id=mCG145007.0 transcript_id=mCT184431.0
FT                   protein_id=mCP106299.0"
FT                   /protein_id="EDL38359.1"
FT                   /translation="RPSCISATYVQGGPGPALYVLRLVVQTLRAPRVQTAWTGGLEETP
FT                   EGNHHPSHKDFSPDHHRSAKLWTASGNRALEMPDKTKISSSGLHSGIPKCPLANEN"
FT   gene            complement(13568547..13569030)
FT                   /pseudo
FT                   /locus_tag="mCG_1039328"
FT                   /note="gene_id=mCG1039328.1"
FT   mRNA            complement(13568547..13569030)
FT                   /pseudo
FT                   /locus_tag="mCG_1039328"
FT                   /note="gene_id=mCG1039328.1 transcript_id=mCT157032.1
FT                   created on 05-NOV-2002"
FT   gene            13612936..13724464
FT                   /locus_tag="mCG_148335"
FT                   /note="gene_id=mCG148335.0"
FT   mRNA            join(13612936..13613238,13721707..13724464)
FT                   /locus_tag="mCG_148335"
FT                   /product="mCG148335"
FT                   /note="gene_id=mCG148335.0 transcript_id=mCT188598.0
FT                   created on 13-JAN-2004"
FT   CDS             13722122..13722322
FT                   /codon_start=1
FT                   /locus_tag="mCG_148335"
FT                   /product="mCG148335"
FT                   /note="gene_id=mCG148335.0 transcript_id=mCT188598.0
FT                   protein_id=mCP108815.0"
FT                   /protein_id="EDL38360.1"
FT                   /translation="MKPLIAIVCADFTSVKSMAVKWESNFSKIGCDENVCIIITYMQIL
FT                   PYLGFPPRFASIYNSLPNFFL"
FT   gene            complement(14010421..14011387)
FT                   /pseudo
FT                   /locus_tag="mCG_12490"
FT                   /note="gene_id=mCG12490.2"
FT   mRNA            complement(14010421..14011387)
FT                   /pseudo
FT                   /locus_tag="mCG_12490"
FT                   /note="gene_id=mCG12490.2 transcript_id=mCT13189.2 created
FT                   on 25-OCT-2002"
FT   gene            <14146156..14444479
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /note="gene_id=mCG12492.2"
FT   mRNA            join(<14146156..14147130,14223403..14223617,
FT                   14287005..14287182,14292237..14292477,14383879..14384165,
FT                   14388719..14388810,14409540..14409961,14432250..14432341,
FT                   14438247..14438399,14441095..14444479)
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /product="discs, large (Drosophila) homolog-associated
FT                   protein 1"
FT                   /note="gene_id=mCG12492.2 transcript_id=mCT13191.2 created
FT                   on 10-SEP-2002"
FT   CDS             join(14146156..14147130,14223403..14223617,
FT                   14287005..14287182,14292237..14292477,14383879..14384165,
FT                   14388719..14388810,14409540..14409961,14432250..14432341,
FT                   14438247..14438399,14441095..14441304)
FT                   /codon_start=1
FT                   /gene="Dlgap1"
FT                   /locus_tag="mCG_12492"
FT                   /product="discs, large (Drosophila) homolog-associated
FT                   protein 1"
FT                   /note="gene_id=mCG12492.2 transcript_id=mCT13191.2
FT                   protein_id=mCP6305.2"
FT                   /protein_id="EDL38361.1"
FT                   /translation="MKGLSGSRSHHHGITCEAACDSLSHHSDHKPYLLSPVDHHPADHP
FT                   YYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDESALVPRTLATKANRLPTNLL
FT                   DQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSV
FT                   NGGKASPDESQTLRYGKRSKSKERRSESKARSNASNASPTSPSWWSSDDNLDGDMCLYH
FT                   TPSGVMTMGRCPDRSASQYFMEAYNTISEQAVKASRSNNDIKCSTCANLPVTLDAPLLK
FT                   KSAWSSTLTVSRAREVYQKASVNMDQAMVKSEACQQERSCQYLQVPQDEWSGYTPRGKD
FT                   DEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKIS
FT                   NEHSPKLQIRSHSYLRAVSEVSINRSLDSLDPAGLLTSPKFRSRNESYMRAMSTISQVS
FT                   EMEVNGQFESVCESVFSELESQAVEALDLPLPGCFRMRSHSYVRAIEKGCSQDDECVSL
FT                   RSSSPPRTTTTVRTIQSSTAQSSTESAQDAYMDGQGQRGDMISQSGLSNSTESLDSMKA
FT                   LTAAIEAANAQIHGPASQHMGSNAAAVTTTTTIATVTTEDRKKDFKKNRCLSIGIQVDD
FT                   AEEPEKMAESKTSNKFQSVGVQVEEEKCFRRFTRSNSVTTAVQADLDFHDNLENSLESI
FT                   EDNSCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSI
FT                   TEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCKLMEREERENNLPEDILGKIRTAV
FT                   GSAQLLMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQL
FT                   KANNWKQMDPLDKKERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAAS
FT                   VRQNSATESAESIEIYIPEAQTRL"
FT   gene            complement(14421355..>14429127)
FT                   /locus_tag="mCG_145589"
FT                   /note="gene_id=mCG145589.0"
FT   mRNA            complement(join(14421355..14424193,14428083..14428219,
FT                   14428946..>14429127))
FT                   /locus_tag="mCG_145589"
FT                   /product="mCG145589"
FT                   /note="gene_id=mCG145589.0 transcript_id=mCT185013.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(14422650..>14422889)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145589"
FT                   /product="mCG145589"
FT                   /note="gene_id=mCG145589.0 transcript_id=mCT185013.0
FT                   protein_id=mCP106312.0"
FT                   /protein_id="EDL38362.1"
FT                   /translation="REPMRGYWKTAVFWRSQYLEMTTKNSSSTGSWSLEDRVRATKGRA
FT                   GEVTQALGGAQKMVSRSQTLDSQSLILLLIVTVP"
FT   gene            complement(14467337..14474860)
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /note="gene_id=mCG12491.1"
FT   mRNA            complement(join(14467337..14468397,14469297..14469523,
FT                   14474434..14474860))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170887"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170887.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(14467338..14468397,14469297..14469523,
FT                   14473996..14474335))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT13190"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT13190.1 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(14467338..14468397,14469297..14469523,
FT                   14472772..14472814))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170886"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170886.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14474434..14474548))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_c"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170887.0
FT                   protein_id=mCP93806.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3UWC5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1194497"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC5"
FT                   /protein_id="EDL38365.1"
FT                   /translation="MEMVLSPRAGRHDPASGFRQRVEGRVISAPRPRVVELEGLVAASG
FT                   SDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALL
FT                   SQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIK
FT                   NFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLC
FT                   QPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFS
FT                   GFQLLVDVALKRAAEMELQAKLTA"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14473996..14474011))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_b"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT13190.1
FT                   protein_id=mCP6302.1 isoform=CRA_b"
FT                   /protein_id="EDL38364.1"
FT                   /translation="MKSKKGLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKE
FT                   SVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKD
FT                   PNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSP
FT                   GSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKS
FT                   GPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"
FT   CDS             complement(join(14467822..14468397,14469297..14469523,
FT                   14472772..14472784))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_a"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170886.0
FT                   protein_id=mCP93804.0 isoform=CRA_a"
FT                   /protein_id="EDL38363.1"
FT                   /translation="MKTPGLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKES
FT                   VQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDP
FT                   NQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPG
FT                   SILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSG
FT                   PSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"
FT   mRNA            complement(join(<14468172..14468397,14469297..14469902))
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, transcript variant
FT                   mCT170888"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170888.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<14468172..14468397,14469297..14469479))
FT                   /codon_start=1
FT                   /gene="Tgif"
FT                   /locus_tag="mCG_12491"
FT                   /product="TG interacting factor, isoform CRA_d"
FT                   /note="gene_id=mCG12491.1 transcript_id=mCT170888.0
FT                   protein_id=mCP93805.0 isoform=CRA_d"
FT                   /protein_id="EDL38366.1"
FT                   /translation="MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSE
FT                   QEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIE
FT                   AAMGIKNFMPTLEESPFHSCVVGPNPTLGRPV"
FT   gene            14486072..14488415
FT                   /locus_tag="mCG_145012"
FT                   /note="gene_id=mCG145012.0"
FT   mRNA            14486072..14488415
FT                   /locus_tag="mCG_145012"
FT                   /product="mCG145012"
FT                   /note="gene_id=mCG145012.0 transcript_id=mCT184436.0
FT                   created on 24-JUN-2003"
FT   CDS             14487931..14488143
FT                   /codon_start=1
FT                   /locus_tag="mCG_145012"
FT                   /product="mCG145012"
FT                   /note="gene_id=mCG145012.0 transcript_id=mCT184436.0
FT                   protein_id=mCP106304.0"
FT                   /protein_id="EDL38367.1"
FT                   /translation="MEASPLWMHHSLRATPRALPYWVFFAGFIMYSQKQNYNDLVTGVT
FT                   AFSLRFLNENPSPPTPLGSAEQWGL"
FT   gene            14501616..14502120
FT                   /pseudo
FT                   /locus_tag="mCG_5394"
FT                   /note="gene_id=mCG5394.1"
FT   mRNA            14501616..14502120
FT                   /pseudo
FT                   /locus_tag="mCG_5394"
FT                   /note="gene_id=mCG5394.1 transcript_id=mCT4304.1 created on
FT                   14-OCT-2002"
FT   gene            complement(14510486..14513619)
FT                   /locus_tag="mCG_1039528"
FT                   /note="gene_id=mCG1039528.0"
FT   mRNA            complement(join(14510486..14511318,14513121..14513243,
FT                   14513344..14513489,14513601..14513619))
FT                   /locus_tag="mCG_1039528"
FT                   /product="mCG1039528"
FT                   /note="gene_id=mCG1039528.0 transcript_id=mCT157232.0
FT                   created on 28-MAY-2003"
FT   CDS             complement(join(14511036..14511318,14513121..14513203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039528"
FT                   /product="mCG1039528"
FT                   /note="gene_id=mCG1039528.0 transcript_id=mCT157232.0
FT                   protein_id=mCP71296.1"
FT                   /protein_id="EDL38368.1"
FT                   /translation="MRKPRHRTINCVGQDSYCWPHAWSAQEMKKKKSNIQIFPGVWQRS
FT                   EVLGAEGWITLCSKWILSGTNEIDGLEGEVMVTIPDNLGLILRTHIVKIENQLPESSMY
FT                   CVVQAHPARSQALGLER"
FT   gene            14549796..14550338
FT                   /pseudo
FT                   /locus_tag="mCG_48720"
FT                   /note="gene_id=mCG48720.1"
FT   mRNA            14549796..14550338
FT                   /pseudo
FT                   /locus_tag="mCG_48720"
FT                   /note="gene_id=mCG48720.1 transcript_id=mCT48903.1 created
FT                   on 28-OCT-2002"
FT   gene            complement(14587353..14589970)
FT                   /locus_tag="mCG_148328"
FT                   /note="gene_id=mCG148328.0"
FT   mRNA            complement(join(14587353..14588680,14589802..14589970))
FT                   /locus_tag="mCG_148328"
FT                   /product="mCG148328"
FT                   /note="gene_id=mCG148328.0 transcript_id=mCT188591.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14588000..14588371)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148328"
FT                   /product="mCG148328"
FT                   /note="gene_id=mCG148328.0 transcript_id=mCT188591.0
FT                   protein_id=mCP108807.0"
FT                   /protein_id="EDL38369.1"
FT                   /translation="MARLEPWAWWCQNRSCLFQEHWDATKVTPLQEVRFQEPLSCYSGW
FT                   DSSNSLNPNEIGSGLASLWLLGSSFIVSLYLFFLFRKRLVNFCFIYMYKGLVCITVCVP
FT                   CVCSTHRGQEWVSDPLDLE"
FT   gene            14588845..14589666
FT                   /pseudo
FT                   /locus_tag="mCG_50754"
FT                   /note="gene_id=mCG50754.1"
FT   mRNA            14588845..14589666
FT                   /pseudo
FT                   /locus_tag="mCG_50754"
FT                   /note="gene_id=mCG50754.1 transcript_id=mCT50937.1 created
FT                   on 28-OCT-2002"
FT   gene            complement(14604885..14622530)
FT                   /locus_tag="mCG_5403"
FT                   /note="gene_id=mCG5403.1"
FT   mRNA            complement(join(14604885..14606228,14607191..14607352,
FT                   14608780..14608978,14622207..14622530))
FT                   /locus_tag="mCG_5403"
FT                   /product="mCG5403"
FT                   /note="gene_id=mCG5403.1 transcript_id=mCT4297.1 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(14606056..14606228,14607191..14607352,
FT                   14608780..14608963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5403"
FT                   /product="mCG5403"
FT                   /note="gene_id=mCG5403.1 transcript_id=mCT4297.1
FT                   protein_id=mCP6274.1"
FT                   /protein_id="EDL38370.1"
FT                   /translation="MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNR
FT                   DGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIR
FT                   NAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRIL
FT                   KHGAKDKDD"
FT   gene            complement(14625408..14634191)
FT                   /locus_tag="mCG_5400"
FT                   /note="gene_id=mCG5400.2"
FT   mRNA            complement(join(14625408..14626538,14627862..14628023,
FT                   14628449..14628647,14633774..14634191))
FT                   /locus_tag="mCG_5400"
FT                   /product="mCG5400"
FT                   /note="gene_id=mCG5400.2 transcript_id=mCT4294.1 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(14626366..14626538,14627862..14628023,
FT                   14628449..14628632))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5400"
FT                   /product="mCG5400"
FT                   /note="gene_id=mCG5400.2 transcript_id=mCT4294.1
FT                   protein_id=mCP6321.1"
FT                   /db_xref="GOA:Q6ZWQ9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1914518"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWQ9"
FT                   /protein_id="EDL38371.1"
FT                   /translation="MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNR
FT                   DGFIDKEDLHDMLASMGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIR
FT                   NAFACFDEEAIGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRIL
FT                   KHGAKDKDD"
FT   gene            14650154..14756240
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /note="gene_id=mCG5398.1"
FT   mRNA            join(14650154..14650284,14653510..14653859,
FT                   14665716..14665965,14666658..14666815,14673982..14674074,
FT                   14675040..14675128,14675233..14675292,14677228..14677392,
FT                   14682118..14682279,14690648..14690789,14694003..14694202,
FT                   14696868..14696924,14701669..14701793,14706951..14707134,
FT                   14707458..14707632,14710089..14710210,14711518..14711811,
FT                   14713576..14713772,14717208..14717334,14719587..14719771,
FT                   14721866..14721980,14729285..14729441,14730325..14730431,
FT                   14730555..14730599,14734820..14734956,14735558..14735702,
FT                   14737675..14737734,14738000..14738067,14739088..14739201,
FT                   14740056..14740143,14741160..14741198,14741293..14741398,
FT                   14746643..14746806,14750037..14750073,14750511..14750533,
FT                   14751942..14751997,14755461..14756240)
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /product="myomesin 1"
FT                   /note="gene_id=mCG5398.1 transcript_id=mCT4303.2 created on
FT                   24-JUL-2002"
FT   CDS             join(14653537..14653859,14665716..14665965,
FT                   14666658..14666815,14673982..14674074,14675040..14675128,
FT                   14675233..14675292,14677228..14677392,14682118..14682279,
FT                   14690648..14690789,14694003..14694202,14696868..14696924,
FT                   14701669..14701793,14706951..14707134,14707458..14707632,
FT                   14710089..14710210,14711518..14711811,14713576..14713772,
FT                   14717208..14717334,14719587..14719771,14721866..14721980,
FT                   14729285..14729441,14730325..14730431,14730555..14730599,
FT                   14734820..14734956,14735558..14735702,14737675..14737734,
FT                   14738000..14738067,14739088..14739201,14740056..14740143,
FT                   14741160..14741198,14741293..14741398,14746643..14746806,
FT                   14750037..14750073,14750511..14750533,14751942..14751997,
FT                   14755461..14755754)
FT                   /codon_start=1
FT                   /gene="Myom1"
FT                   /locus_tag="mCG_5398"
FT                   /product="myomesin 1"
FT                   /note="gene_id=mCG5398.1 transcript_id=mCT4303.2
FT                   protein_id=mCP6286.2"
FT                   /protein_id="EDL38372.1"
FT                   /translation="MSLPFYQRSHQHYDLSYRNKDLRTTMSHYQQEKKRSAVYTHGSTA
FT                   YSSRSLAARRQESEAFSQASATSYQQQASQAYSLGASSSSRHSQGSEVSRKTASAYDYG
FT                   YSHGQVHISGIRDSEEERIKEAAAYIAQKTLLASEEAIAASKQSTASKQSATSKRTTST
FT                   LQREETFEKKSRNIAIREKAEELSLKKTLEETQTYHGKLNEDHLLHAPEFIIKPRSHTV
FT                   WEKENVKLHCSVAGWPEPRLTWYKNQVPINVHANPGKYIIESRYGMHTLEISKCDFEDT
FT                   AQYRASAMNVQGELSAYASVVVKRYKGEVDESLLRGGVSMPLSFAVTPYGYASKFEIHF
FT                   DDKFDVSFGREGETMSLGCRVVITPEIKHFQPEVQWYRNGAPVSPSKWVQPHWSGDRAT
FT                   LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVVSLDANKDY
FT                   IIISWKQPAVDGGSPILGYFIDKCEVGTDTWSQCNDTPVKFARFPVTGLIEGRSYIFRV
FT                   RAVNKTGIGLPSRVSEPVAALDPAEKARLKSHPSAPWTGQIIVTEEEPTEGVIPGPPTD
FT                   LSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCDVGAENWQRVNTELPVKSPRFALFDL
FT                   VEGKSYRFRVRCSNSAGVGEPSETTEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE
FT                   SRDAKELVGYYIEASVVGSGKWEPCNNNPVKGSRFTCHGLTTAQSYIFRVRAVNAAGLS
FT                   EYSQDSEAIEVKAAIGGGVSPDVWPQLSDTPGGLTDSRGGMNGASPPTSQKDALLGSNP
FT                   NKPSPPSSPSSRGQKEVSTVSESVQEPLSSPPQEAAPEEEQSQSEPPKKKKDPVAVPSA
FT                   PYDITCLESFRDSMVLGWKQPDTTGGAEITGYYVNYREVVGEVPGKWREANIKAVSDAA
FT                   YKISNLKENTLYQFQVSAMNIAGLGAPSTVSECFKCEEWTIAVPGPPHSVKLSEVRKNS
FT                   LVLQWKPPVYSGRTPVTGYFVDLKEASAKDDQWRGLNEAAIVNKYLRVQGLKEGTSYVF
FT                   RVRAVNQAGVGKPSDLAGPVVAETRPGTKEVVVSVDDDGVISLNFECDQMTPKSEFVWS
FT                   KDYVPTEDSPRLEVENKGDKTKMTFKDLGTDDLGTYSCDVTDTEGIASSYLIDEEEMKR
FT                   LLALSQEHKFPTVPTKSELAVEILEKGQVRFWMQAEKLSGNAKVSYIFNEKEIFEGPKY
FT                   KMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDVYKKLQKEAEFQR
FT                   QEWIRKQGPHFAEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKD
FT                   GICTLLITEFSKKDAGFYEVILKDDRGKDKSRLKLVDEAFQDLMTEVCKKIALSATDLK
FT                   IQSTAEGIRLYSFVCYYLDDLKVNWSHNGTGIKYTDRVKSGVTGEQIWLQINEPTPNDK
FT                   GKYVMELFDGKTGHQKTVDLSGQAFDEAFAEFQRLKQAAIAEKNRARVLGGLPDVVTIQ
FT                   EGKALNLTCNVWGDPPPEVSWLKNEKPLTSDDHCSLKFEAGKTAFFTISGVSTADSGKY
FT                   GLVVKNKYGSETSDFTVSVFIPEEELRKGAMEPPKGNQKSK"
FT   gene            <14773823..14811160
FT                   /locus_tag="mCG_145008"
FT                   /note="gene_id=mCG145008.0"
FT   mRNA            join(<14773823..14773849,14803499..14803572,
FT                   14808211..14808377,14809884..14811160)
FT                   /locus_tag="mCG_145008"
FT                   /product="mCG145008"
FT                   /note="gene_id=mCG145008.0 transcript_id=mCT184432.0
FT                   created on 05-JUN-2003"
FT   CDS             <14810555..14810857
FT                   /codon_start=1
FT                   /locus_tag="mCG_145008"
FT                   /product="mCG145008"
FT                   /note="gene_id=mCG145008.0 transcript_id=mCT184432.0
FT                   protein_id=mCP106300.0"
FT                   /protein_id="EDL38373.1"
FT                   /translation="PYSKMASITQMESGWPITSPNQYIYHRNPAPKDQESCGRRGGRPI
FT                   VRDRGNRKFAMRFLSQKCQGSYTHEASTWLFQDLNKNHTNRHINMEWRILRGPHP"
FT   gene            <14813135..14878934
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /note="gene_id=mCG5402.2"
FT   mRNA            join(<14813135..14813237,14844172..14844372,
FT                   14851247..14851342,14854137..14854438,14858369..14858476,
FT                   14859333..14859456,14860246..14860582,14862902..14863001,
FT                   14866478..14866665,14867702..14867795,14868178..14868247,
FT                   14869906..14869995,14870738..14870820,14871720..14871864,
FT                   14872382..14872530,14873019..14873105,14873866..14874018,
FT                   14874213..14874327,14875511..14875614,14875944..14878934)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT4296"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT4296.2 created on
FT                   24-JUL-2002"
FT   CDS             join(<14813136..14813237,14844172..14844372,
FT                   14851247..14851342,14854137..14854438,14858369..14858476,
FT                   14859333..14859456,14860246..14860582,14862902..14863001,
FT                   14866478..14866665,14867702..14867795,14868178..14868247,
FT                   14869906..14869995,14870738..14870820,14871720..14871864,
FT                   14872382..14872530,14873019..14873105,14873866..14874018,
FT                   14874213..14874327,14875511..14875614,14875944..14876088)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_d"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT4296.2
FT                   protein_id=mCP6330.1 isoform=CRA_d"
FT                   /protein_id="EDL38377.1"
FT                   /translation="PGLARCSYSLRPLACPPPPSPSPPPPAGRGPGLDSQTMNYVGQLA
FT                   GQVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGKLGVLRSKEKVIDI
FT                   EINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQFFKHIETPLVKSS
FT                   GNERPAQSSDVSHTLESEAVFTQSSVKKKKRRRKKCKQDNRKEEQAASPVAEDVGDVGV
FT                   SSDDEKRAQAARGSSNASLKEEDYKEPSLFHSGDNYPLSDGDWSPLETTYPQAVCPKSD
FT                   SELEVKPSESLLRSEPHMEWTWGGFPESTKVTKRERYDYHPRTATITPSENTHFRVIPS
FT                   EDSLIREVEKDATVEDTTCTIVKPKPRALCKQLSDAASTELPESPLEAPQISSLLDADP
FT                   VPSPSAEAPSEPKPAAKDSPTKKKGVHKRSQHQGPDDIYLDDLKALEPEVAALYFPKSD
FT                   TDPGSRQWPESDTFSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEI
FT                   SKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKAT
FT                   VESWVKDKMPKKSGRWWFWRKKESMIKQLPETKEGKSEVPPANDLPSNAEEPTSARPAE
FT                   NDTSSDEGSQELEESIKVDPITVETLSHCGTASYKKSLRLSSDQIAKLKLHDGPNDVVF
FT                   SITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTITKSDALGQILPQLGKDWTHQGIARL
FT                   YHSINENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSLFSAFHREV
FT                   IEKKPEKFKIECLNDIKNLFAPSRQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGE
FT                   LIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPDLDLDDLA
FT                   "
FT   mRNA            join(<14833846..14834073,14844172..14844372,
FT                   14851247..14851342,14854137..>14854314)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170907"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170907.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14833933..14834073,14844172..14844372,
FT                   14851247..14851342,14854137..>14854314)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_c"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170907.0
FT                   protein_id=mCP93824.0 isoform=CRA_c"
FT                   /protein_id="EDL38376.1"
FT                   /translation="VESCLSSLFSLKMLYLEDNSEDEKTVQESSLSKPASVYHGKAPPG
FT                   ILSQTMNYVGQLAGQVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGK
FT                   LGVLRSKEKVIDIEINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQ
FT                   FFKHIETPLVKSSGNERPAQSSDVSHTLESEAVFTQSSVKKK"
FT   mRNA            join(<14854329..14854438,14858369..14858476,
FT                   14858880..14858930,14859333..14859456,14860246..14860568)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170906"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170906.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14854329..14854438,14858369..14858476,
FT                   14858880..14858922)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_b"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170906.0
FT                   protein_id=mCP93825.0 isoform=CRA_b"
FT                   /protein_id="EDL38375.1"
FT                   /translation="KCKQDNRKEEQAASPVAEDVGDVGVSSDDEKRAQAARGSSNASLK
FT                   EEDYKEPSLFHSGDNYPLSDGDWSPLETSHGRGRQISSLGR"
FT   mRNA            join(<14859394..14859456,14860246..14860582,
FT                   14861140..14861366)
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, transcript variant mCT170905"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170905.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<14859394..14859456,14860246..14860582,
FT                   14861140..14861360)
FT                   /codon_start=1
FT                   /gene="Lpin2"
FT                   /locus_tag="mCG_5402"
FT                   /product="lipin 2, isoform CRA_a"
FT                   /note="gene_id=mCG5402.2 transcript_id=mCT170905.0
FT                   protein_id=mCP93823.0 isoform=CRA_a"
FT                   /protein_id="EDL38374.1"
FT                   /translation="SLLRSEPHMEWTWGGFPESTKVTKRERYDYHPRTATITPSENTHF
FT                   RVIPSEDSLIREVEKDATVEDTTCTIVKPKPRALCKQLSDAASTELPESPLEAPQISSL
FT                   LDADPVPSPSAEAPSEPKPAAKDSPTKKKGLVWLKNNCLLGDRCISGYDHGCVSRGPTW
FT                   QLMTDSSARGPNALFWPLWAPGTQPYIRQNMHIPKMNRNKNTF"
FT   gene            complement(14863132..14864189)
FT                   /locus_tag="mCG_1039530"
FT                   /note="gene_id=mCG1039530.1"
FT   mRNA            complement(join(14863132..14863375,14863702..14863907,
FT                   14864033..14864189))
FT                   /locus_tag="mCG_1039530"
FT                   /product="mCG1039530"
FT                   /note="gene_id=mCG1039530.1 transcript_id=mCT157234.1
FT                   created on 28-MAY-2003"
FT   CDS             complement(14863755..14863871)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039530"
FT                   /product="mCG1039530"
FT                   /note="gene_id=mCG1039530.1 transcript_id=mCT157234.1
FT                   protein_id=mCP70887.1"
FT                   /protein_id="EDL38378.1"
FT                   /translation="MLKNFKYIYVNLIFPFQVKMKYVFPITYLKNIIVYKAQ"
FT   gene            complement(14881290..>14943057)
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /note="gene_id=mCG5401.2"
FT   mRNA            complement(join(14881290..14882209,14884243..14884371,
FT                   14885094..14885126,14885438..14885806,14905299..14907212,
FT                   14912297..14912472,14942220..14942342,14942789..>14943057))
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /product="elastin microfibril interfacer 2"
FT                   /note="gene_id=mCG5401.2 transcript_id=mCT4295.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(14881872..14882209,14884243..14884371,
FT                   14885094..14885126,14885438..14885806,14905299..14907212,
FT                   14912297..14912472,14942220..14942342,14942789..>14943057))
FT                   /codon_start=1
FT                   /gene="Emilin2"
FT                   /locus_tag="mCG_5401"
FT                   /product="elastin microfibril interfacer 2"
FT                   /note="gene_id=mCG5401.2 transcript_id=mCT4295.2
FT                   protein_id=mCP6268.2"
FT                   /protein_id="EDL38379.1"
FT                   /translation="VIEGPRSGQCGGVGTKSQRGRRAPEPAAGSRGPAACSLVGLKMCQ
FT                   ETPPRPRAPSRWTPALLALLALGGAGLCHASSQPGYHARPSARNKNWCAYIVNKNVSCT
FT                   VQEGSESFIQAQYNCPWNQMPCPSALVYRVNFRPRFVTRYKIVTQLEWRCCPGFRGPDC
FT                   QEGPKDHMKTPRPPPARPKNNLKKATDTDPSQVSQPKKTLPPTNAVEPGQTADAKQGPP
FT                   EFQQSKVQVLEEKVVRLTRMVLDLQSTVVGLKENLKHTIQDDGRKEPDSWLGPLHPQPT
FT                   PDSPLAGDAEPSQLPGIPTSKESGMKDIKSELAEVKDTLKTKSDKLEELDGKVKGYEGQ
FT                   LKQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNTCEYKLVGLQ
FT                   QQCDDYGSSYLGVIELIGEKEASLKKDIADLRAQLQDPVAQPSCCNGQKSSDFGPQIKA
FT                   LDQKIERVAEATRMLNGRLDNEFDRLSVPEPDADFDARWTELDARINVTEKNAEEHCFY
FT                   IEETLRGAINGEVDDLRKLLNEKIHSLEDRLGIVLQAANSSDVELTPMGPALPEQPGAE
FT                   NEQVLMELSRLKDKVQVVEDFCLQSLPHGIDGALPSGEDLTHVSLSLLESLNDTMHRQF
FT                   QETSHSIQKLQEDVNALHSQLNHSECTGTYLQNGVSDSRTGDSMEASGFTKTGEQERTV
FT                   GTVPSPGTPVAPCCGQLEERWQKLQNQMLAELDTCKESAHGVQSGVSAIEGRVFQLEQT
FT                   CRRLDTISGSLQRIKEGLGKHVGSLWNCIRQMNGTLKSHSRDISGLKNSVQQFYSHVFQ
FT                   ISTDLQDLVKFQPSATEEPSEATEGPSGKTPLESTRPSEEAPTEPPRLTPLPEDPAGPP
FT                   QTGQRPVLPQRPLQPPPLPAWPGRTGLPFLPGSSGVIMETGEAGPPGRMGVSGRGLPRG
FT                   VDGQMGQGPIHSSEGYAGAPGYPKSPPVATPGVPLPALVSFSAGLTQKPFPSDGGVVLF
FT                   NKVLVNDGDVYNPNTGIFTAPYDGRYLITATLTPERDTYVEAVLSVSNASVAQLHTAGY
FT                   RREFLEYHRPPGAVHTCGGPGAFHLIVHLKAGDGVNVVVTGGRLAHTDFDEMYSTFSGV
FT                   FLYPFLSHL"
FT   gene            <14947539..14971863
FT                   /locus_tag="mCG_146120"
FT                   /note="gene_id=mCG146120.0"
FT   mRNA            join(<14947539..14947713,14953608..14953674,
FT                   14971593..14971863)
FT                   /locus_tag="mCG_146120"
FT                   /product="mCG146120"
FT                   /note="gene_id=mCG146120.0 transcript_id=mCT186223.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<14953632..14953674,14971593..14971741)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146120"
FT                   /product="mCG146120"
FT                   /note="gene_id=mCG146120.0 transcript_id=mCT186223.0
FT                   protein_id=mCP107776.0"
FT                   /protein_id="EDL38380.1"
FT                   /translation="PVRETSAHLKTPVPGTSLGLELMDQEVTPGSLDSVEAPVHTPTRK
FT                   DVGAPAAASYIQVTQVDL"
FT   gene            complement(14976602..>15023196)
FT                   /locus_tag="mCG_122296"
FT                   /note="gene_id=mCG122296.1"
FT   mRNA            complement(join(14976602..14977479,14980999..14981113,
FT                   14981703..14981861,14985512..14985683,14990268..14990338,
FT                   14990479..14990588,14992201..14992391,14993996..14994118,
FT                   14995176..14995261,14997250..14997369,14997507..14997633,
FT                   15001975..15002127,15002391..15002522,15003076..15003163,
FT                   15009186..15009250,15010368..15010483,15011762..15011919,
FT                   15012349..15012428,15013504..15013629,15018934..15019101,
FT                   15021532..15021650,15022188..15022276,15023113..>15023196))
FT                   /locus_tag="mCG_122296"
FT                   /product="mCG122296"
FT                   /note="gene_id=mCG122296.1 transcript_id=mCT123513.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(14977452..14977479,14980999..14981113,
FT                   14981703..14981861,14985512..14985683,14990268..14990338,
FT                   14990479..14990588,14992201..14992391,14993996..14994118,
FT                   14995176..14995261,14997250..14997369,14997507..14997633,
FT                   15001975..15002127,15002391..15002522,15003076..15003163,
FT                   15009186..15009250,15010368..15010483,15011762..15011919,
FT                   15012349..15012428,15013504..15013629,15018934..15019101,
FT                   15021532..15021650,15022188..15022276,15023113..>15023195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122296"
FT                   /product="mCG122296"
FT                   /note="gene_id=mCG122296.1 transcript_id=mCT123513.1
FT                   protein_id=mCP71320.1"
FT                   /protein_id="EDL38381.1"
FT                   /translation="PTSVKDVRYCHVSFQDDHVCLESAFTVRPLPDDPKHLKCELKGGK
FT                   TVQMGQELQGEIVVIIADQYGNQISSFSPDSLSTLSITGDGLDSSNLKITLEANSQSVS
FT                   VQGIRFTPGPPGPKDLCFTWREFSDFLRVQLVSGPPTKLLLMDWPELKESIPVINGRQL
FT                   ENPLIVQLCDQWDNPALVPNVKICLIKASSLRLLPSNQQHKTDDKGRANLGVFTVCAPR
FT                   GEHTVQVKGVYNKSTIEGPTIKLTILPDPEKPIRLNVKYDQDASFIAGDIFTDFMVSVI
FT                   SESGSVIKNINPTRISMKMWKLSSGMSRPPANAETFSCNKIKGNDKEDGCFYFREKTIP
FT                   NKVGAYCIQFDFMIDKTNILSSQQVIVDVLPNQPMKLVPDSQPATPAVSNVRSIASRTL
FT                   VKDLRLSITDNYGNHTGMDLVGTVVATIKGFNEEDTDTPLFIGKVRTLEFPFVKGSAEI
FT                   TTLVLAENSPGRDSTEYFIIFEPRLSTVSGTLESYSLPFMFYNDVKKQQQMAALTKEKD
FT                   ELSKSITMYRSLFDANKQLVDEMKCQAEEAKLKETQLRNELKAYNIDIPATQQTTHIEA
FT                   LLEKKITEQNELKKRPRRLCTLPNYTKRSGDILGKIAHLAQIEDDRAAMVISWHLASDM
FT                   DCVVTLTTDAARAIYDETQGRQQVLPLDSIYRKTLPDWKRPLPHFRNGKLHFKPFGNPV
FT                   FARDLLTFPDNIEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLLTRDGDRI
FT                   RSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCVVLGKQIDLIQQYRTALYRLSSVNEDL
FT                   DNQLQYLHTPDMKKKKQELDEQEKSLKRIEQKLGMTPVRRCNESLCHSPKIEVTECPIP
FT                   TKRMRRESTRQNRRPKGDVPN"
FT   gene            complement(15029350..>15059941)
FT                   /locus_tag="mCG_120552"
FT                   /note="gene_id=mCG120552.1"
FT   mRNA            complement(join(15029350..15029487,15030964..15030996,
FT                   15033895..15033967,15037949..15038045,15042552..15042696,
FT                   15046026..15046145,15046592..15046669,15057815..15057928,
FT                   15058100..15058182,15059093..15059199,15059828..>15059941))
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, transcript variant mCT121742"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT121742.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(15029441..15029487,15030964..15030996,
FT                   15033895..15033967,15037949..15038045,15042552..15042696,
FT                   15046026..15046145,15046592..15046669,15057815..15057928,
FT                   15058100..15058182,15059093..15059199,15059828..>15059941))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, isoform CRA_a"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT121742.1
FT                   protein_id=mCP70884.1 isoform=CRA_a"
FT                   /protein_id="EDL38382.1"
FT                   /translation="VKTIKTLPLCYGSIVRFFLHGDHDGEVYATGGEVQIAMEPQALYD
FT                   EIKTVPIAKLDRTVAEKTIRKYVEDEMARLPDRLSVTWPEGDELLPNEVRPAGTPIGAL
FT                   RIEILNKKGEAMQKLPGTSHGGSKKLLVELKVILHTSSGNKEIISHISQHGGKWPYWFK
FT                   KMENIQKLGNYTLKLQVVLNESNADTYAGRSLPSKVIKFSVKEGKPEKFSFGLLDSPFR
FT                   VGVPFNIPLELQDEFGHTTQLLSDIEPVLEASGLSLHYEGITKGPNCVIQGVVAKGPVN
FT                   SCQGKNFNLKVILPGLKEDSQILKIRLLPGPPHQLKVKPDFSRCSKPTSLYCGLQ"
FT   mRNA            complement(join(<15030931..15030996,15033895..15033967,
FT                   15037949..15038045,15042552..15042696,15046026..15046145,
FT                   15046592..15046669,15057815..>15057935))
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, transcript variant mCT193665"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT193665.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(<15030931..15030996,15033895..15033967,
FT                   15037949..15038045,15042552..15042696,15046026..15046145,
FT                   15046592..15046669,15057815..>15057935))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120552"
FT                   /product="mCG120552, isoform CRA_b"
FT                   /note="gene_id=mCG120552.1 transcript_id=mCT193665.0
FT                   protein_id=mCP114632.0 isoform=CRA_b"
FT                   /protein_id="EDL38383.1"
FT                   /translation="LTGALRIEILNKKGEAMQKLPGTSHGGSKKLLVELKVILHTSSGN
FT                   KEIISHISQHGGKWPYWFKKMENIQKLGNYTLKLQVVLNESNADTYAGRSLPSKVIKFS
FT                   VKEGKPEKFSFGLLDSPFRVGVPFNIPLELQDEFGHTTQLLSDIEPVLEASGLSLHYEG
FT                   ITKGPNCVIQGVVAKGPVNSCQGKNFNLKVILPGLKEDSQILKIRLLPGPPHQLKVKPD
FT                   SEVLVIENGTA"
FT   gene            complement(<15061118..>15106807)
FT                   /locus_tag="mCG_120558"
FT                   /note="gene_id=mCG120558.1"
FT   mRNA            complement(join(<15061118..15061312,15062866..15063049,
FT                   15068343..15068463,15072529..15072739,15073501..15073591,
FT                   15075451..15075617,15080082..15080201,15080301..15080415,
FT                   15087171..15087301,15087984..15088066,15095288..15095449,
FT                   15097075..15097150,15106471..>15106807))
FT                   /locus_tag="mCG_120558"
FT                   /product="mCG120558"
FT                   /note="gene_id=mCG120558.1 transcript_id=mCT121748.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(<15061118..15061312,15062866..15063049,
FT                   15068343..15068463,15072529..15072739,15073501..15073591,
FT                   15075451..15075617,15080082..15080201,15080301..15080415,
FT                   15087171..15087301,15087984..15088066,15095288..15095449,
FT                   15097075..15097150,15106471..>15106806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120558"
FT                   /product="mCG120558"
FT                   /note="gene_id=mCG120558.1 transcript_id=mCT121748.1
FT                   protein_id=mCP71261.1"
FT                   /protein_id="EDL38384.1"
FT                   /translation="VTSRPLPTVGAARPAEARSRGGWSRGHARGRCLREARPRAAGPSL
FT                   FFSLNMAAEGASDPAGLSEGSGRDGAVDGCRTVYLFDRRGKDSELGDRALQVSEHADYA
FT                   GFRASVCQTIGISSEEKFVITTTSRKEITCNNFDHTVKDGVTLYLLQSVDQSLLTATKE
FT                   RIDFLPHYDTLVKSGMYEYYASEGQNPLPFALAELIDNSLSATSRNNGVRRIQIKLLFD
FT                   ETQGKPAVAVVDNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPLPVPRSLNSD
FT                   ISYFGVGGKQAVFFVGQSARMISKPIDSKDVHELVLSKEDFEKKEKNKEAIYSGYIRNR
FT                   KPADSAHITNDDERFLHNLIEEEKEKDSFTAVVITGVQPEHIQYLKNYLHLWTRQLTHI
FT                   YHYYIHGPKGNEISTAKAIGPFNNIDIEISLFEKGKTPKIINLREIQDDMQTLYINTAS
FT                   DSFEFKAHVEGDGVVEGVIRYHPFLYDRETFPDDPCFPSKLKDEDDDDDCFISEKAARG
FT                   KRPIFECFWNGRLIPYTSVGDFDWCAPPKKRGLVPIECFNRISGALFTNDKFQVSTNKL
FT                   TFMDLELKLKDKNTLFTRILNGQEQRMKIDREFALWLKDCHEKHDKQIKFTLFKGIITR
FT                   PDLPTKKQGPWATFSAIEWDGKIYKAGQL"
FT   gene            complement(15089751..15091456)
FT                   /pseudo
FT                   /locus_tag="mCG_5407"
FT                   /note="gene_id=mCG5407.2"
FT   mRNA            complement(join(15089751..15090603,15090840..15091456))
FT                   /pseudo
FT                   /locus_tag="mCG_5407"
FT                   /note="gene_id=mCG5407.2 transcript_id=mCT4291.2 created on
FT                   21-APR-2003"
FT   gene            complement(15128657..15161363)
FT                   /locus_tag="mCG_120549"
FT                   /note="gene_id=mCG120549.0"
FT   mRNA            complement(join(15128657..15128901,15131825..15131927,
FT                   15132846..15132976,15134081..15134173,15137179..15137268,
FT                   15139674..15139826,15140982..15141187,15143763..15143907,
FT                   15144812..15144918,15146602..15146695,15149923..15150012,
FT                   15151348..15151450,15153369..15153541,15153637..15153760,
FT                   15156191..15156268,15158241..15158350,15161214..15161363))
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, transcript variant mCT121739"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT121739.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(15128764..15128901,15131825..15131927,
FT                   15132846..15132976,15134081..15134173,15137179..15137268,
FT                   15139674..15139826,15140982..15141187,15143763..15143907,
FT                   15144812..15144918,15146602..15146695,15149923..15150012,
FT                   15151348..15151450,15153369..15153541,15153637..15153760,
FT                   15156191..15156268,15158241..15158341))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, isoform CRA_a"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT121739.0
FT                   protein_id=mCP71276.1 isoform=CRA_a"
FT                   /protein_id="EDL38385.1"
FT                   /translation="MKRSSVSTCGAGRLSMQELRTLDLNKPGLYTPQTKERSTFGKLST
FT                   HKPTSERKVSIFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLYEFLT
FT                   ENGYVYSVSMKSLQAPSTKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKALGYPFT
FT                   LSKSSMYTVGAPHTWPHIVAALVWLIDCIKIDTAMKESSPLFDDGQLWGEETEDGIKHN
FT                   KLFLEYTKKCYEKFMTGADSFEEEDAELQAKLKDLYKVDASKLESLEAENKALNEQIAR
FT                   LEEEREREPNRLMSLKKLKASLQADVQNYKAYMSNLESHLAVLKQKSNSLDEEIGRVEQ
FT                   ECETVKQENTRLQSIVDNQKYSVADIERINHEKNELQQTINKLTKDLEAEQQQMWNEEL
FT                   KYARGKEAIEAQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRTQVY
FT                   APLKELLNESEEEINKALNKKRHLEDTLEQLNTMKTESKNTVRMLKEEIQKLDDLHQQA
FT                   VKEAEEKDKKSASELESLEKHKHLLESGVNDGLSEAMDELDAVQREYQLTVKTTTEERR
FT                   KVENNLQRLLEMVATHVGSLEKHLEEENAKADREYEEFMSEDLLENIREMAEKYKRNAA
FT                   QLKAPDK"
FT   mRNA            complement(join(<15151382..15151450,15153369..15153541,
FT                   15153637..15153760,15156001..15156052,15156191..15156268,
FT                   15158241..15158350,15161214..>15161296))
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, transcript variant mCT170871"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT170871.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(<15151382..15151450,15153369..15153541,
FT                   15153637..15153760,15156001..>15156020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120549"
FT                   /product="mCG120549, isoform CRA_b"
FT                   /note="gene_id=mCG120549.0 transcript_id=mCT170871.0
FT                   protein_id=mCP93789.0 isoform=CRA_b"
FT                   /protein_id="EDL38386.1"
FT                   /translation="EDSVIIRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQ
FT                   LYEFLTENGYVYSVSMKSLQAPSTKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKA
FT                   LGYPFTLSKSSMYTVGAPHTWPHIV"
FT   gene            15161397..15226424
FT                   /locus_tag="mCG_5408"
FT                   /note="gene_id=mCG5408.2"
FT   mRNA            join(15161397..15161966,15170023..15170085,
FT                   15173270..15173480,15174129..15174198,15180346..15180452,
FT                   15193200..15193503)
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, transcript variant mCT172485"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT172485.0 created
FT                   on 28-AUG-2002"
FT   CDS             join(15170068..15170085,15173270..15173480,
FT                   15174129..15174198,15180346..15180445)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, isoform CRA_b"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT172485.0
FT                   protein_id=mCP95404.0 isoform=CRA_b"
FT                   /protein_id="EDL38388.1"
FT                   /translation="MEYHTKIRELILDGSSQLIQEGLRSGFLYPLVEKQHGSSRHITLP
FT                   LDAYSLTELCEMAKHLPSLNEVELQTLQLIGGSKTFDAIVIDASWENKSAKRRNRSQIQ
FT                   ESLCSHWILLTKSLMNVLYWRELKKKLL"
FT   mRNA            join(<15188983..15189054,15193200..15193449,
FT                   15195581..15195639,15199415..15199500,15205932..15206103,
FT                   15214876..15215167,15225475..15226424)
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, transcript variant mCT4292"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT4292.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<15189004..15189054,15193200..15193449,
FT                   15195581..15195639,15199415..15199500,15205932..15206103,
FT                   15214876..15215167,15225475..15225566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5408"
FT                   /product="mCG5408, isoform CRA_a"
FT                   /note="gene_id=mCG5408.2 transcript_id=mCT4292.2
FT                   protein_id=mCP6306.2 isoform=CRA_a"
FT                   /protein_id="EDL38387.1"
FT                   /translation="IAEAEAVGPLALRRPAQESWEAKMRHNQMYCETPPTVTIHVKSGS
FT                   NRSHQTRKPISLKRPILKDSWEASENNAQNNKSKRPRGPCLIIQRQEMTAFFKLFDDDL
FT                   IQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTRINFFIALYLANTVEEDEEEAK
FT                   YEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERS
FT                   VHHSGAVRNYNRDEVHLPRGPSATPVDCSLCGKKGRYVRLGLSSSSSSSSDTGELMEKG
FT                   SQELHSAFSVDTAGDPPHTYSQVANDHQSNKENETNFVKKNKSVEWFAESEE"
FT   gene            complement(15193987..>15236000)
FT                   /locus_tag="mCG_146330"
FT                   /note="gene_id=mCG146330.1"
FT   mRNA            complement(join(15193987..15195303,15205525..15205585,
FT                   15206672..15206807,15225730..15225876,15227609..15227630,
FT                   15235181..>15236000))
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, transcript variant mCT193682"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT193682.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(15194020..15195303,15198249..15198348,
FT                   15205525..15205585,15206672..15206807,15225730..15225876,
FT                   15227609..15227630,15235181..>15235991))
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, transcript variant mCT186433"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT186433.0
FT                   created on 14-JUL-2003"
FT   gene            complement(15231099..15232857)
FT                   /locus_tag="mCG_148350"
FT                   /note="gene_id=mCG148350.0"
FT   mRNA            complement(join(15231099..15231214,15231229..15232857))
FT                   /locus_tag="mCG_148350"
FT                   /product="mCG148350"
FT                   /note="gene_id=mCG148350.0 transcript_id=mCT188613.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15232018..15232188)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148350"
FT                   /product="mCG148350"
FT                   /note="gene_id=mCG148350.0 transcript_id=mCT188613.0
FT                   protein_id=mCP108829.0"
FT                   /protein_id="EDL38391.1"
FT                   /translation="MLDQAWKHIPILSALESHEFRVNLGYLMSSQNSLGYTIRKEKNND
FT                   KLHILDSHIKY"
FT   CDS             complement(15235538..>15235999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, isoform CRA_b"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT193682.0
FT                   protein_id=mCP114644.0 isoform=CRA_b"
FT                   /protein_id="EDL38390.1"
FT                   /translation="PAPDVRLSKDDVVLPCEVEAPERRSELRADSFLLDFGSVPRERAH
FT                   FPGLRVLAWGHASWRARAPVVPFPCCPRPDRRDPVVSSMWKGSGWELRGRSYPLEIRRT
FT                   RAESRATETLQDVTPRIACWTRVATEPGELRAASSWSLSRGLFSVGDSY"
FT   CDS             complement(15235538..>15235990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146330"
FT                   /product="mCG146330, isoform CRA_a"
FT                   /note="gene_id=mCG146330.1 transcript_id=mCT186433.0
FT                   protein_id=mCP107780.0 isoform=CRA_a"
FT                   /protein_id="EDL38389.1"
FT                   /translation="DVRLSKDDVVLPCEVEAPERRSELRADSFLLDFGSVPRERAHFPG
FT                   LRVLAWGHASWRARAPVVPFPCCPRPDRRDPVVSSMWKGSGWELRGRSYPLEIRRTRAE
FT                   SRATETLQDVTPRIACWTRVATEPGELRAASSWSLSRGLFSVGDSY"
FT   gene            <15253548..15296288
FT                   /locus_tag="mCG_5393"
FT                   /note="gene_id=mCG5393.2"
FT   mRNA            join(<15253548..15253806,15262640..15262777,
FT                   15264060..15264181,15267436..15267556,15269278..15269414,
FT                   15270872..15270974,15273814..15273878,15275558..15275729,
FT                   15277482..15277568,15278535..15278666,15279955..15280083,
FT                   15286030..15286116,15287274..15287305,15287825..15287888,
FT                   15290038..15290151,15290710..15290779,15294600..15294649,
FT                   15294735..15296288)
FT                   /locus_tag="mCG_5393"
FT                   /product="mCG5393"
FT                   /note="gene_id=mCG5393.2 transcript_id=mCT4307.2 created on
FT                   28-AUG-2002"
FT   CDS             join(<15253549..15253806,15262640..15262777,
FT                   15264060..15264181,15267436..15267556,15269278..15269414,
FT                   15270872..15270974,15273814..15273878,15275558..15275729,
FT                   15277482..15277568,15278535..15278666,15279955..15280083,
FT                   15286030..15286116,15287274..15287305,15287825..15287888,
FT                   15290038..15290151,15290710..15290779,15294600..15294649,
FT                   15294735..15294920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5393"
FT                   /product="mCG5393"
FT                   /note="gene_id=mCG5393.2 transcript_id=mCT4307.2
FT                   protein_id=mCP6314.2"
FT                   /protein_id="EDL38392.1"
FT                   /translation="RTRGCRGARAAMAAGGGGSYDPLAPAGVPCAFSPDSQAYFALASS
FT                   DGQLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESHQRKKRKSEVTGTKDQ
FT                   ADLLALGTAVGSILLYSTVRGELHSKLTSGGHENRVNCIQWHQDNDCLYSCSDDKYIVE
FT                   WSTQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATPV
FT                   SSLRFTTIRPNESQPSDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPV
FT                   YVDLTLSENKEEPVKLAVVCRDGQVHLFEHILNGHCKKPLTSNCTIQIATPGKGKKVTP
FT                   KPIPILAASFCLDKMSLLLVYGNWFQPTIERVALNSKDTHICLERDISNCWAPTVETAI
FT                   TKVKTPVMNSEAKVLVPGIPGHHAPIKLPPAQPKEAENKRKLGSTEATIEERLGAMDLD
FT                   RKGRKDDLQTNSFAVLLTQGLESNDFEILNKVLQTKNVNLIKRTVLRIPLRVVIPLLQE
FT                   LTKRLQGHPNSAALMIQWLKCVLTIHASYLSTLPDLVEQLGTLYQLMESRVKTFQKLSN
FT                   LHGKLILLVTQVTASEKSKKMTSPGQKAKLVYEEESSEEESDDEVPEKDSDDNWDEDED
FT                   KDSEKDEGVDEDNEEEDEDMEDKEENEEDREVSSEKELNGDSDLDPENESEEE"
FT   gene            15310577..>15329041
FT                   /locus_tag="mCG_5409"
FT                   /note="gene_id=mCG5409.2"
FT   mRNA            join(15310577..15310817,15322466..15322604,
FT                   15324990..15325103,15326553..15326840,15327923..15328134,
FT                   15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT173272"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173272.0 created
FT                   on 18-SEP-2002"
FT   mRNA            join(15322216..15322254,15322466..15322604,
FT                   15324990..15325103,15326553..15326840,15327923..15328134,
FT                   15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT4287"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT4287.1 created on
FT                   18-SEP-2002"
FT   CDS             join(15322577..15322604,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_a"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173272.0
FT                   protein_id=mCP96191.0 isoform=CRA_a"
FT                   /protein_id="EDL38393.1"
FT                   /translation="MDTRDDVTLAKVPAPVAVYCGSVPRTSVGLRAPPPGGIDSSLLAH
FT                   DEASLQPVSSVLPSSEKPSQLSREHEDQSSLMLNAPLKGWQARNGYPRGLGVLPLGHHL
FT                   GAAIPSLESEASSVARDTIQIKDKLKKRRLSEGMAASSQASLDPVGGPRGVPLRSTIPR
FT                   TTSQRLLRVPRPMPPIQSIPTTPEANSAKEKDLDPPGGRQDLQDPGASAQEVQISRQYL
FT                   HCADEKMHKSLGGLVIPPIPKARMPTGTSSCRPGSLPSPLCPSQDVLMGPKAPHTR"
FT   CDS             join(15322577..15322604,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_a"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT4287.1
FT                   protein_id=mCP6291.1 isoform=CRA_a"
FT                   /protein_id="EDL38395.1"
FT                   /translation="MDTRDDVTLAKVPAPVAVYCGSVPRTSVGLRAPPPGGIDSSLLAH
FT                   DEASLQPVSSVLPSSEKPSQLSREHEDQSSLMLNAPLKGWQARNGYPRGLGVLPLGHHL
FT                   GAAIPSLESEASSVARDTIQIKDKLKKRRLSEGMAASSQASLDPVGGPRGVPLRSTIPR
FT                   TTSQRLLRVPRPMPPIQSIPTTPEANSAKEKDLDPPGGRQDLQDPGASAQEVQISRQYL
FT                   HCADEKMHKSLGGLVIPPIPKARMPTGTSSCRPGSLPSPLCPSQDVLMGPKAPHTR"
FT   gene            <15324104..15367157
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /note="gene_id=mCG5405.2"
FT   mRNA            join(<15324104..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329037,
FT                   15333101..15333147,15335237..15335400,15337909..15338059,
FT                   15338284..15338448,15342074..15342227,15343167..15343272,
FT                   15344467..15344702,15346885..15347043,15351594..15351711,
FT                   15352036..15352130,15353680..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367032)
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, transcript variant
FT                   mCT182011"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT182011.0 created
FT                   on 15-APR-2003"
FT   mRNA            join(<15324110..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..>15329041)
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, transcript variant mCT173273"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173273.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<15324111..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5409"
FT                   /product="mCG5409, isoform CRA_b"
FT                   /note="gene_id=mCG5409.2 transcript_id=mCT173273.0
FT                   protein_id=mCP96192.0 isoform=CRA_b"
FT                   /protein_id="EDL38394.1"
FT                   /translation="LSSQASFAAKVPAPVAVYCGSVPRTSVGLRAPPPGGIDSSLLAHD
FT                   EASLQPVSSVLPSSEKPSQLSREHEDQSSLMLNAPLKGWQARNGYPRGLGVLPLGHHLG
FT                   AAIPSLESEASSVARDTIQIKDKLKKRRLSEGMAASSQASLDPVGGPRGVPLRSTIPRT
FT                   TSQRLLRVPRPMPPIQSIPTTPEANSAKEKDLDPPGGRQDLQDPGASAQEVQISRQYLH
FT                   CADEKMHKSLGGLVIPPIPKARMPTGTSSCRPGSLPSPLCPSQDVLMGPKAPHTR"
FT   CDS             join(<15324135..15324135,15324990..15325103,
FT                   15326553..15326840,15327923..15328134,15328847..15329037,
FT                   15333101..15333147,15335237..15335400,15337909..15338059,
FT                   15338284..15338448,15342074..15342227,15343167..15343272,
FT                   15344467..15344702,15346885..15347043,15351594..15351711,
FT                   15352036..15352130,15353680..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367014)
FT                   /codon_start=1
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, isoform CRA_a"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT182011.0
FT                   protein_id=mCP104933.0 isoform=CRA_a"
FT                   /protein_id="EDL38396.1"
FT                   /translation="AKVPAPVAVYCGSVPRTSVGLRAPPPGGIDSSLLAHDEASLQPVS
FT                   SVLPSSEKPSQLSREHEDQSSLMLNAPLKGWQARNGYPRGLGVLPLGHHLGAAIPSLES
FT                   EASSVARDTIQIKDKLKKRRLSEGMAASSQASLDPVGGPRGVPLRSTIPRTTSQRLLRV
FT                   PRPMPPIQSIPTTPEANSAKEKDLDPPGGRQDLQDPGASAQEVQISRQYLHCADEKMHK
FT                   SLGGLVIPPIPKARMPTGTSSCRPGSLPSPLCPSQDVLMGPKAPHTRLTCENGPLEKTP
FT                   KSPASKPLVPVVKAKSAEAPETSLASSQSTFTLTAFSSHAKETRSLENEEDQKESSTKV
FT                   QVTISKSAQEKMRLKQMKEMELLRRAKEPEWERELVSQGLGTRRTSAKEGLLPLRGSGA
FT                   LSEPAGMSSPRRNNMGALQRKRANRASLPSIPVSKQEPGFARHASANSLPAVLTLGSPE
FT                   WEEEEEEMDLRALRELRPFSNPELGLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVL
FT                   GTRLHDVSLAVTAEVTNLRSKVSRLAISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGNT
FT                   SEFIQRAANRALGAMVENVTPARALVALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEK
FT                   LLSGSRDNTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANAKFDAFLKQSLPSHDLRK
FT                   VMAAIKQRGIQDNHELQSAKGRKVSKSLVVCENGLPSHEGLGSNGPRLMGLRSSSVRGS
FT                   VETSEQLRELTRLLEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSN
FT                   KKVNQWALESLAQMLPILKESIHPMLLSLIIAAADNLNSKNSGISTAASTVLDAMMGSL
FT                   DHLCLLQAFAGRVRFLTGPAVLDITDRLSVLVASVYPRKPQAVERHILPVLWYFLNKMS
FT                   GNGVLPGRGGNVRTAVCRLARSLQEQMGSRLQDFAASQPQQVLKALQGLLASESLGAND
FT                   KVIGGRMAPDIQMTGTTCPQQLD"
FT   mRNA            join(15350627..15350751,15351594..15353875,
FT                   15354608..15354824,15362494..15362580,15366677..15367157)
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, transcript variant
FT                   mCT4298"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT4298.2 created on
FT                   15-APR-2003"
FT   CDS             join(15353627..15353875,15354608..15354824,
FT                   15362494..15362580,15366677..15367014)
FT                   /codon_start=1
FT                   /gene="4632412N22Rik"
FT                   /locus_tag="mCG_5405"
FT                   /product="RIKEN cDNA 4632412N22, isoform CRA_b"
FT                   /note="gene_id=mCG5405.2 transcript_id=mCT4298.2
FT                   protein_id=mCP6275.2 isoform=CRA_b"
FT                   /protein_id="EDL38397.1"
FT                   /translation="MCSSPGLFPRGQPLLPPRLGSNGPRLMGLRSSSVRGSVETSEQLR
FT                   ELTRLLEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSNKKVNQWAL
FT                   ESLAQMLPILKESIHPMLLSLIIAAADNLNSKNSGISTAASTVLDAMMGSLDHLCLLQA
FT                   FAGRVRFLTGPAVLDITDRLSVLVASVYPRKPQAVERHILPVLWYFLNKMSGNGVLPGR
FT                   GGNVRTAVCRLARSLQEQMGSRLQDFAASQPQQVLKALQGLLASESLGANDKVIGGRMA
FT                   PDIQMTGTTCPQQLD"
FT   gene            complement(15381075..15390425)
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /note="gene_id=mCG148331.0"
FT   mRNA            complement(join(15381075..15382247,15386595..15390425))
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /product="cDNA sequence BC027072"
FT                   /note="gene_id=mCG148331.0 transcript_id=mCT188594.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(15382034..15382247,15386595..15390220))
FT                   /codon_start=1
FT                   /gene="BC027072"
FT                   /locus_tag="mCG_148331"
FT                   /product="cDNA sequence BC027072"
FT                   /note="gene_id=mCG148331.0 transcript_id=mCT188594.0
FT                   protein_id=mCP108809.0"
FT                   /protein_id="EDL38398.1"
FT                   /translation="MGCTPSHNVIVNSVAKSGIQFFKKPKAILPGCQWGSPKCPIPLLV
FT                   QSSTFCDSGGELHLGERLVEETVSSSKKLQAMAEGVRQLPKAMEGLIPESQTFQVNKPQ
FT                   GHRATDISFRTEGSHGTQEVDFSGKESKENTPQETSKGNRESVCHQPDSQDHCRQSATE
FT                   SKGRVDFPEPLVKAHQHAYAYLHTSLSRYEAIVRLVQQASQTWGLLRPMLNFLLLCFEE
FT                   AGQLLSEISKDGDVLLQEVRGDLAWPLRKGEPWEQHPDLLQQLLQYTVSKLRALHGTVA
FT                   ALTGSFLEGSSSCLRSTAGHLEGKLSTKRGIDECLLRALGQLESLTSGHGDAGLLGPPL
FT                   CSEDSGIGADNESVHSVEKLGKQASWDFAAELGEWKPGTAAQVEARPSGHAWQEGPYWT
FT                   GSDRPQDCPLSSPRIAKVQPAVQDEARSASTSGAGAEAVTSGPSEAAESLPWDSLGAEI
FT                   PVRTPLSRSSGLTDAPSLSEEEDCSPEEEDELSSTDLHPEPQKALPSRPRSSPDTRESL
FT                   FQPYSKELRNPQAQEMILKMKEAISERIKFVPEPSRPQDWTEEEEGGTVVPPRPRSVSG
FT                   SRGGPERQRRSQSEGCLKSHVEDPTLQELRRVQTDLSRRLEVFYALGATRQGQSRERCL
FT                   PSRASVLWPPTNCRVSPSSAISKFKASLTQNFSILPNQDKSIFQKGSPCFDGEQPCQGK
FT                   AEKLPNAIFCGKKSGRAPRDNERDIRACPTRPSVKTLIETFSPTESLRMPRNCRNLGSS
FT                   PCLRKWGVPAMPPRFPIYRGLAPLYSKPQISPAAGWRPSAPFPSLPLAEVSESEDISGD
FT                   VEEDLENLPPPPLEVLMDKSFAALECPECSQPAGSSLEETLLPGLQEASHPKRTWVSPR
FT                   LKASMSPMDLLPSKGSGSSPRLHSTRSGSTRIVGDSRKLTLDLNSKQTASPSSEAKSRA
FT                   QIQARAETIAGFSKQHQKAIPWHHTNPTPGQSRTLEPSLARFSRDPHSSEASRKGPERS
FT                   LPRVRKASPQRAQWASQGDRRLQSLPSSHGPSQPGLPAVLSSPSPPLSPRTLSPPATRK
FT                   TTSPPCQHPQSNPAPGSPPVRRTETNTPSSASSSSPSVSPSRGSKDSIHSEDSEATTAK
FT                   ASRNTCSIFYPAATSLFEAKSSSSTSHPQMLPEPGGLLRTPTGGWRGSSGQRLRADSQK
FT                   RTVLNALNPLPFVRRTASDRQRQQGDQLQQSRSDWEFHSCQNSSSSSSSEENPKQELPP
FT                   WNNSRVPELQGSSTKRASPLELCVLGHGLQPEARMNRGQDRPQPESQPQHKEIS"
FT   gene            15407079..15492627
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /note="gene_id=mCG5406.2"
FT   mRNA            join(15407079..15407289,15427269..15427416,
FT                   15436357..15436496,15438199..15438292,15439175..15439336,
FT                   15440956..15441074,15443789..15444025,15448107..15448242,
FT                   15464820..15464909,15465628..15465771,15468575..15468709,
FT                   15471548..15471671,15475060..15475124,15487223..15487494)
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, transcript variant mCT172484"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT172484.0 created
FT                   on 28-AUG-2002"
FT   mRNA            join(15418691..15418826,15427269..15427416,
FT                   15436357..15436496,15438199..15438292,15439175..15439336,
FT                   15440956..15441074,15443789..15444025,15448107..15448242,
FT                   15461817..15461957,15464820..15464909,15465628..15465771,
FT                   15468575..15468709,15471548..15471671,15475060..15475124,
FT                   15487223..15487296,15492174..15492627)
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, transcript variant mCT4290"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT4290.2 created on
FT                   28-AUG-2002"
FT   CDS             join(15427284..15427416,15436357..15436496,
FT                   15438199..15438292,15439175..15439336,15440956..15441074,
FT                   15443789..15444025,15448107..15448242,15461817..15461957,
FT                   15464820..15464909,15465628..15465771,15468575..15468709,
FT                   15471548..15471671,15475060..15475124,15487223..15487296,
FT                   15492174..15492341)
FT                   /codon_start=1
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT4290.2
FT                   protein_id=mCP6285.2 isoform=CRA_b"
FT                   /protein_id="EDL38400.1"
FT                   /translation="MTIEDLPDIPLEGSSLIGRYPFLFTGSDTSVIFSISAAPMPSDCE
FT                   FSFFDPNDASCQEILFDPKTSVSELFAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDG
FT                   LTDMTLLHYTCKSGAHGIGDIETAVKFAAQLIDLGADASLRSRWTNMNALHYASYFDVP
FT                   ELIRVILKTSKPKDVDATCSDFNFGTALHIAAHNLCAGAVKTLLELGANPAFRNDKGQI
FT                   PAEVVPDPVDMPLEMADAAAIAKEIKQMLLDAVPLPCTSAKAVLPNSDHTTSRAMLTSL
FT                   GLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKY
FT                   GIFAPLSKISKLKDGRKTTTHTPSTRATPHARSQKVDVAHVTSRVNSGLTTSKKETASE
FT                   STLALPPSEEPKTVAENDAAQPGSMSSSSSSSSLDHKQSYPKKLTTSSGGKKTLSKSPS
FT                   LPSRASAGLKSSATSAANNSHREGALHLGERVLVVGQRVGTIKFFGTTNFAPGYWYGIE
FT                   LEKPHGKNDGSVGGVQYFSCSPRYGIFAPPSRVQRLSDSLDTLSEISSNKQNHSYPGFR
FT                   RSFSTTSASSQKEINRRNAFAKSVTEGVRAKTQSTVPMAVALTVLWKDKHRCPLLWGKR
FT                   PLRDGLKSEFGCSLQVSY"
FT   CDS             join(15427284..15427416,15436357..15436496,
FT                   15438199..15438292,15439175..15439336,15440956..15441074,
FT                   15443789..15444025,15448107..15448242,15464820..15464909,
FT                   15465628..15465771,15468575..15468709,15471548..15471671,
FT                   15475060..15475124,15487223..15487299)
FT                   /codon_start=1
FT                   /gene="Rsnl2"
FT                   /locus_tag="mCG_5406"
FT                   /product="restin-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG5406.2 transcript_id=mCT172484.0
FT                   protein_id=mCP95403.0 isoform=CRA_a"
FT                   /protein_id="EDL38399.1"
FT                   /translation="MTIEDLPDIPLEGSSLIGRYPFLFTGSDTSVIFSISAAPMPSDCE
FT                   FSFFDPNDASCQEILFDPKTSVSELFAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDG
FT                   LTDMTLLHYTCKSGAHGIGDIETAVKFAAQLIDLGADASLRSRWTNMNALHYASYFDVP
FT                   ELIRVILKTSKPKDVDATCSDFNFGTALHIAAHNLCAGAVKTLLELGANPAFRNDKGQI
FT                   PAEVVPDPVDMPLEMADAAAIAKEIKQMLLDAVPLPCTSAKAVLPNSDHTTSRAMLTSL
FT                   GLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKY
FT                   GLTTSKKETASESTLALPPSEEPKTVAENDAAQPGSMSSSSSSSSLDHKQSYPKKLTTS
FT                   SGGKKTLSKSPSLPSRASAGLKSSATSAANNSHREGALHLGERVLVVGQRVGTIKFFGT
FT                   TNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCSPRYGIFAPPSRVQRLSDSLDTLSEIS
FT                   SNKQNHSYPGFRRSFSTTSASSQKEINRRNAFAK"
FT   gene            complement(15497794..16238439)
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /note="gene_id=mCG120548.1"
FT   mRNA            complement(join(15497794..15498562,15502783..15502873,
FT                   15503607..15503741,15509679..15509780,15513265..15513357,
FT                   15518873..15518970,15521994..15522123,15523617..15523681,
FT                   15523782..15523872,15525710..15525896,15527075..15527179,
FT                   15528479..15528631,15529117..15529215,15530440..15530624,
FT                   15532064..15532208,15532923..15533054,15538992..15539142,
FT                   15548221..15548383,15578715..15578843,15579082..15579176,
FT                   15596409..15596578,15615973..15616073,15616766..15616897,
FT                   15623397..15623528,15681707..15681834,15837671..15837872,
FT                   15993901..15994066,16013534..16013650,16237645..16238439))
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /product="anaplastic lymphoma kinase"
FT                   /note="gene_id=mCG120548.1 transcript_id=mCT121738.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(15530440..15530624,15532064..15532208,
FT                   15532923..15533054,15538992..15539142,15548221..15548383,
FT                   15578715..15578843,15579082..15579176,15596409..15596578,
FT                   15615973..15616073,15616766..15616897,15623397..15623528,
FT                   15681707..15681834,15837671..15837872,15993901..15993940))
FT                   /codon_start=1
FT                   /gene="Alk"
FT                   /locus_tag="mCG_120548"
FT                   /product="anaplastic lymphoma kinase"
FT                   /note="gene_id=mCG120548.1 transcript_id=mCT121738.1
FT                   protein_id=mCP70907.1"
FT                   /protein_id="EDL38401.1"
FT                   /translation="MGQRQSILKRCPEGSFLLLNTSADSKHTILSPWMRSSSDHCTLAV
FT                   SVHRHLQPSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYIS
FT                   SGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDE
FT                   GQLCSKLPAGFYCNFENGFCGWTQSPLSPHMPRWQVRTLRDAHSQGHQGRALLLSTTDI
FT                   LASEGATVTSATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVA
FT                   TDEGLSLWQHTVLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKM
FT                   SLNSVPKSRNLFEKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNN
FT                   AYQNSNLSVVVGSEGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGI
FT                   FNLEKGDTLYILVGQQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGG
FT                   GGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGG
FT                   GGWNDNTSLLWAGKSLLEGAAGGHSCPQAMKKWGWETRGGFGGGGGGGAPQVEEAEDI"
FT   gene            15888105..15889282
FT                   /pseudo
FT                   /locus_tag="mCG_13994"
FT                   /note="gene_id=mCG13994.2"
FT   mRNA            15888105..15889282
FT                   /pseudo
FT                   /locus_tag="mCG_13994"
FT                   /note="gene_id=mCG13994.2 transcript_id=mCT18769.2 created
FT                   on 14-OCT-2002"
FT   gene            complement(16330523..16331450)
FT                   /pseudo
FT                   /locus_tag="mCG_13995"
FT                   /note="gene_id=mCG13995.1"
FT   mRNA            complement(16330523..16331450)
FT                   /pseudo
FT                   /locus_tag="mCG_13995"
FT                   /note="gene_id=mCG13995.1 transcript_id=mCT18770.1 created
FT                   on 14-OCT-2002"
FT   gene            16480810..16494484
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /note="gene_id=mCG49872.2"
FT   mRNA            join(16480810..16480900,16490320..16490484,
FT                   16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT50055"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT50055.1 created
FT                   on 12-SEP-2002"
FT   mRNA            join(16481689..16481845,16490320..16490484,
FT                   16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT172971"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172971.0 created
FT                   on 12-SEP-2002"
FT   mRNA            join(16482120..16482214,16484983..16485182,
FT                   16490320..16490484,16492618..16494484)
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), transcript variant
FT                   mCT172972"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172972.0 created
FT                   on 12-SEP-2002"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172971.0
FT                   protein_id=mCP95890.0 isoform=CRA_a"
FT                   /protein_id="EDL38402.1"
FT                   /translation="MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLF
FT                   NKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERA
FT                   LVRESEGFEEHVPSDNS"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT172972.0
FT                   protein_id=mCP95891.0 isoform=CRA_a"
FT                   /protein_id="EDL38403.1"
FT                   /translation="MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLF
FT                   NKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERA
FT                   LVRESEGFEEHVPSDNS"
FT   CDS             join(16490344..16490484,16492618..16492842)
FT                   /codon_start=1
FT                   /gene="Ypel5"
FT                   /locus_tag="mCG_49872"
FT                   /product="yippee-like 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG49872.2 transcript_id=mCT50055.1
FT                   protein_id=mCP28784.1 isoform=CRA_a"
FT                   /protein_id="EDL38404.1"
FT                   /translation="MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLF
FT                   NKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERA
FT                   LVRESEGFEEHVPSDNS"
FT   gene            16562568..16586175
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /note="gene_id=mCG5418.2"
FT   mRNA            join(16562568..16562836,16565445..16565547,
FT                   16583491..16586175)
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, transcript variant mCT4722"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT4722.2 created on
FT                   29-AUG-2002"
FT   CDS             join(16562811..16562836,16565445..16565547,
FT                   16583491..16583679)
FT                   /codon_start=1
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, isoform CRA_b"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT4722.2
FT                   protein_id=mCP6278.1 isoform=CRA_b partial"
FT                   /protein_id="EDL38406.1"
FT                   /translation="MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIF
FT                   PDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKD
FT                   Q"
FT   mRNA            join(<16565439..16565547,16582107..16582249,
FT                   16583491..16583804)
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, transcript variant mCT172487"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT172487.0 created
FT                   on 29-AUG-2002"
FT   CDS             join(<16565469..16565547,16582107..16582249,
FT                   16583491..16583679)
FT                   /codon_start=1
FT                   /gene="Lbh"
FT                   /locus_tag="mCG_5418"
FT                   /product="limb-bud and heart, isoform CRA_a"
FT                   /note="gene_id=mCG5418.2 transcript_id=mCT172487.0
FT                   protein_id=mCP95406.0 isoform=CRA_a"
FT                   /protein_id="EDL38405.1"
FT                   /translation="DDRGDDERSIHGRDWSQPPQGWPFLSGIGTICEARDSQKPHAGFR
FT                   VHLGDQTPWETSDVRWDKHFFCPPSTAKQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEV
FT                   ESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ"
FT   gene            16755836..16888928
FT                   /locus_tag="mCG_5412"
FT                   /note="gene_id=mCG5412.2"
FT   mRNA            join(16755836..16756009,16809487..16809655,
FT                   16817176..16817374,16835557..16835703,16844362..16844478,
FT                   16885303..16888928)
FT                   /locus_tag="mCG_5412"
FT                   /product="mCG5412"
FT                   /note="gene_id=mCG5412.2 transcript_id=mCT4731.2 created on
FT                   18-SEP-2002"
FT   CDS             join(16809491..16809655,16817176..16817374,
FT                   16835557..16835703,16844362..16844478,16885303..16885805)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5412"
FT                   /product="mCG5412"
FT                   /note="gene_id=mCG5412.2 transcript_id=mCT4731.2
FT                   protein_id=mCP6293.2"
FT                   /db_xref="GOA:B0V2Q7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="MGI:MGI:2684937"
FT                   /db_xref="UniProtKB/TrEMBL:B0V2Q7"
FT                   /protein_id="EDL38407.1"
FT                   /translation="MVSWKGIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSR
FT                   LVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYL
FT                   RVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIF
FT                   PEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVA
FT                   YPYNIPQTEKHLLLGDFPKEIHFHVQRYPADSLPTSKEDLQLWCHRRWEEKEERLRSFY
FT                   QGEKNFHFTGQSTVPPCKSELRVLVVKLLSIVYWALFCSAMCLLIYLYSPVRWYFIISI
FT                   VFFVLQERIFGGLEIIELACYRFLHKHPHLNSKKNE"
FT   gene            complement(16837943..16839367)
FT                   /pseudo
FT                   /locus_tag="mCG_51564"
FT                   /note="gene_id=mCG51564.2"
FT   mRNA            complement(join(16837943..16838983,16839151..16839367))
FT                   /pseudo
FT                   /locus_tag="mCG_51564"
FT                   /note="gene_id=mCG51564.2 transcript_id=mCT51747.2 created
FT                   on 14-OCT-2002"
FT   gene            16898112..16906204
FT                   /locus_tag="mCG_1039541"
FT                   /note="gene_id=mCG1039541.1"
FT   mRNA            join(16898112..16898270,16898437..16898592,
FT                   16899336..16899490,16899663..16899803,16900719..16900897,
FT                   16903889..16906204)
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, transcript variant mCT157245"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT157245.1
FT                   created on 21-APR-2003"
FT   mRNA            join(16898112..16898270,16899663..16899803,
FT                   16900719..16900897,16903889..16906204)
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, transcript variant mCT182035"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT182035.0
FT                   created on 21-APR-2003"
FT   CDS             16904113..16904469
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, isoform CRA_a"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT157245.1
FT                   protein_id=mCP70980.1 isoform=CRA_a"
FT                   /protein_id="EDL38408.1"
FT                   /translation="MRGFLSPASGGHLISSSPRHAPPPRFSYACVVLQWIWLHSLLLQV
FT                   SVRSRHRNSLVNSFALPVPSAPAASKGPVNPAVSTANSHKQPEATQHSALPVQKQGGES
FT                   LLWQSPFPYRCFQP"
FT   CDS             16904113..16904469
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039541"
FT                   /product="mCG1039541, isoform CRA_a"
FT                   /note="gene_id=mCG1039541.1 transcript_id=mCT182035.0
FT                   protein_id=mCP104957.0 isoform=CRA_a"
FT                   /protein_id="EDL38409.1"
FT                   /translation="MRGFLSPASGGHLISSSPRHAPPPRFSYACVVLQWIWLHSLLLQV
FT                   SVRSRHRNSLVNSFALPVPSAPAASKGPVNPAVSTANSHKQPEATQHSALPVQKQGGES
FT                   LLWQSPFPYRCFQP"
FT   gene            complement(16952380..>16967988)
FT                   /locus_tag="mCG_5414"
FT                   /note="gene_id=mCG5414.2"
FT   mRNA            complement(join(16952380..16952803,16961259..16961317,
FT                   16962239..16962294,16964034..16964162,16967974..>16967988))
FT                   /locus_tag="mCG_5414"
FT                   /product="mCG5414"
FT                   /note="gene_id=mCG5414.2 transcript_id=mCT4728.2 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(16952729..16952803,16961259..16961317,
FT                   16962239..16962294,16964034..>16964095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5414"
FT                   /product="mCG5414"
FT                   /note="gene_id=mCG5414.2 transcript_id=mCT4728.2
FT                   protein_id=mCP6304.2"
FT                   /protein_id="EDL38410.1"
FT                   /translation="LWPGQLPHSCLLPDTAGNHGKGISQPLQGWQRHLPDRNRVDEPGH
FT                   VQLRGETQQRPLDQDMFPVVTRGNGCPHGAVPTPTVCS"
FT   gene            complement(17006342..17045251)
FT                   /locus_tag="mCG_5413"
FT                   /note="gene_id=mCG5413.2"
FT   mRNA            complement(join(17006342..17006488,17011873..17011988,
FT                   17013138..17013210,17028772..17028999,17045126..17045251))
FT                   /locus_tag="mCG_5413"
FT                   /product="mCG5413"
FT                   /note="gene_id=mCG5413.2 transcript_id=mCT4727.2 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(17006348..17006488,17011873..17011988,
FT                   17013138..17013210,17028772..17028963))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5413"
FT                   /product="mCG5413"
FT                   /note="gene_id=mCG5413.2 transcript_id=mCT4727.2
FT                   protein_id=mCP6300.2"
FT                   /protein_id="EDL38411.1"
FT                   /translation="MAHDAETSVVKFKNQDFRTLRDHCLSRGQLFIDDTFPAAASSIGE
FT                   KLLRGKHLSKLEWKRPTSKDLPFYPPHFILEGASRFDIHQGIAGDCWFLAALGSLTQNP
FT                   QCLQKILMDQSYSHQYAGIFQFRFWQCGQWVEVVIDDQLPVIGDNFLFVHPRGGNKEFW
FT                   PCLMEKAYAK"
FT   gene            complement(17138741..17362708)
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /note="gene_id=mCG5417.3"
FT   mRNA            complement(join(17138741..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..>17362349))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT193685"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT193685.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(17139262..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171861,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..>17225044))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT172486"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT172486.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(17139684..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..>17362347))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_b"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT193685.0
FT                   protein_id=mCP114661.0 isoform=CRA_b"
FT                   /protein_id="EDL38413.1"
FT                   /translation="TMRRLTRRLALPIFGVLWITVLLFFWVTKRKLEVPLGPEVQTPKP
FT                   SDADWDDLWEQFDERRYLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHKRCSL
FT                   LVYCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPEDCKQL
FT                   IKLPKVKCLRNNERQGLVRSRMRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYT
FT                   RVVCPVIDIINLDTFNYIESASELRGGFDWSLHFQWEQLSLEQKALRLDPTEPIRTPII
FT                   AGGLFVIDKAWFDYLGKYDVDMDIWGGENFEISFRVWMCGGGLEIIPCSRVGHVFRKKH
FT                   PYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYAARPFALERPFGNIENRLNLRKNLHCQ
FT                   TFKWYLENVYPELRVPPDSSIQKGNIRQRQKCLESQKQKKQEILRLSPCAKVKGDGAKS
FT                   QVWAFTYTQQIIQEELCLSVVTLFPGAPVVLALCKNGDERQLWTKTGARIEHIASHLCL
FT                   DTDMFGDSTEDGKEVVVNPCESSLMSQHWDIVSS"
FT   CDS             complement(join(17139684..17139842,17141101..17141220,
FT                   17150351..17150489,17150942..17151025,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171861,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..>17225044))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_a"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT172486.0
FT                   protein_id=mCP95405.0 isoform=CRA_a"
FT                   /protein_id="EDL38412.1"
FT                   /translation="IHVTQPSDADWDDLWEQFDERRYLNAKKWRVGDDPYKLYAFNQRE
FT                   SERISSNRAVPDTRHKRCSLLVYCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPMHL
FT                   IQEIILVDDFSNDPEDCKQLIKLPKVKCLRNNERQGLVRSRMRGADIAQGTTLTFLDSH
FT                   CEVNRDWLQPLLHRVKEVLQDYTRVVCPVIDIINLDTFNYIESASELRGGFDWSLHFQW
FT                   EQLSLEQKALRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDVDMDIWGGENFEISFRV
FT                   WMCGGGLEIIPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYAARP
FT                   FALERPFGNIENRLNLRKNLHCQTFKWYLENVYPELRVPPDSSIQKGNIRQRQKCLESQ
FT                   KQKKQEILRLSPCAKVKGDGAKSQVWAFTYTQQIIQEELCLSVVTLFPGAPVVLALCKN
FT                   GDERQLWTKTGARIEHIASHLCLDTDMFGDSTEDGKEVVVNPCESSLMSQHWDIVSS"
FT   mRNA            complement(join(17153079..17153414,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..17362708))
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, transcript variant
FT                   mCT4732"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT4732.2 created on
FT                   29-AUG-2002"
FT   CDS             complement(join(17153276..17153414,17155063..17155155,
FT                   17157586..17157712,17168147..17168250,17170821..17170905,
FT                   17171765..17171852,17180746..17180867,17181029..17181094,
FT                   17182353..17182420,17194433..17194531,17224860..17225029,
FT                   17362216..17362344))
FT                   /codon_start=1
FT                   /gene="Galnt14"
FT                   /locus_tag="mCG_5417"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 14, isoform CRA_c"
FT                   /note="gene_id=mCG5417.3 transcript_id=mCT4732.2
FT                   protein_id=mCP6266.2 isoform=CRA_c"
FT                   /protein_id="EDL38414.1"
FT                   /translation="MRRLTRRLALPIFGVLWITVLLFFWVTKRKLEVPLGPEVQTPKPS
FT                   DADWDDLWEQFDERRYLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHKRCSLL
FT                   VYCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPEDCKQLI
FT                   KLPKVKCLRNNERQGLVRSRMRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTR
FT                   VVCPVIDIINLDTFNYIESASELRGGFDWSLHFQWEQLSLEQKALRLDPTEPIRTPIIA
FT                   GGLFVIDKAWFDYLGKYDVDMDIWGGENFEISFRVWMCGGGLEIIPCSRVGHVFRKKHP
FT                   YVFPDGNANTYIKNTKRTAEVWMDEYKQYYYAARPFALERPFGNSHVTQCCRRRILIRG
FT                   TSFRGVVPPTNLPVESPTDPSSPYYLSSSS"
FT   gene            complement(17286216..17290853)
FT                   /locus_tag="mCG_148338"
FT                   /note="gene_id=mCG148338.0"
FT   mRNA            complement(join(17286216..17289124,17290736..17290853))
FT                   /locus_tag="mCG_148338"
FT                   /product="mCG148338"
FT                   /note="gene_id=mCG148338.0 transcript_id=mCT188601.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(17288869..17289124,17290736..17290770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148338"
FT                   /product="mCG148338"
FT                   /note="gene_id=mCG148338.0 transcript_id=mCT188601.0
FT                   protein_id=mCP108818.0 partial"
FT                   /protein_id="EDL38415.1"
FT                   /translation="MDHTATTPGGEIKKVELHLKFVDLARLTGQTDRPKDQHPHLHPLL
FT                   RSQAHAARPSFCVTVGTLNSGPHTCLAGTLLQEAAISSVPYLCILNRNHEH"
FT   gene            17457555..17484711
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /note="gene_id=mCG5416.1"
FT   mRNA            join(17457555..17458153,17468843..17469019,
FT                   17473091..17473188,17479773..17480185,17480669..17480833,
FT                   17482541..17484711)
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /product="EH-domain containing 3"
FT                   /note="gene_id=mCG5416.1 transcript_id=mCT4730.1 created on
FT                   24-JUL-2002"
FT   CDS             join(17457927..17458153,17468843..17469019,
FT                   17473091..17473188,17479773..17480185,17480669..17480833,
FT                   17482541..17483068)
FT                   /codon_start=1
FT                   /gene="Ehd3"
FT                   /locus_tag="mCG_5416"
FT                   /product="EH-domain containing 3"
FT                   /note="gene_id=mCG5416.1 transcript_id=mCT4730.1
FT                   protein_id=mCP6259.1"
FT                   /protein_id="EDL38416.1"
FT                   /translation="MFSWLGNDDRRKKDPEVFQTVSDGLKKLYKTKLLPLEEYYRFHEF
FT                   HSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGD
FT                   VEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNAVLESISVIDTPGILSGEKQ
FT                   RISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKAD
FT                   QIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRD
FT                   IQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDTKKKELVNNLAEIYG
FT                   RIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQ
FT                   EETQRPVQMVKGGAFEGTLQGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPV
FT                   DGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHEL
FT                   PSELPAHLLPPSKRKVSE"
FT   gene            complement(17522759..17523675)
FT                   /pseudo
FT                   /locus_tag="mCG_5415"
FT                   /note="gene_id=mCG5415.2"
FT   mRNA            complement(17522759..17523675)
FT                   /pseudo
FT                   /locus_tag="mCG_5415"
FT                   /note="gene_id=mCG5415.2 transcript_id=mCT4729.2 created on
FT                   14-OCT-2002"
FT   gene            complement(17536232..>17600881)
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /note="gene_id=mCG120176.0"
FT   mRNA            complement(join(17536232..17536809,17538670..17538846,
FT                   17541221..17541409,17542833..17542898,17543714..17543828,
FT                   17545860..17545912,17547121..17547195,17547796..17547924,
FT                   17548430..17548525,17549077..17549158,17550381..17550526,
FT                   17550651..17550842,17556119..17556205,17556313..17556400,
FT                   17556804..17556937,17557730..17557854,17559356..17559452,
FT                   17560275..17560394,17562538..17562661,17564788..17564957,
FT                   17566594..17566677,17567553..17567727,17569138..17569322,
FT                   17571158..17571267,17572031..17572124,17573177..17573328,
FT                   17573807..17573899,17575679..17575820,17576938..17577024,
FT                   17577312..17577380,17585548..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17600806..>17600881))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT121359"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT121359.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(17536759..17536809,17538670..17538846,
FT                   17541221..17541409,17542833..17542898,17543714..17543828,
FT                   17545860..17545912,17547121..17547195,17547796..17547924,
FT                   17548430..17548525,17549077..17549158,17550381..17550526,
FT                   17550651..17550842,17556119..17556205,17556313..17556400,
FT                   17556804..17556937,17557730..17557854,17559356..17559452,
FT                   17560275..17560394,17562538..17562661,17564788..17564957,
FT                   17566594..17566677,17567553..17567727,17569138..17569322,
FT                   17571158..17571267,17572031..17572124,17573177..17573328,
FT                   17573807..17573899,17575679..17575820,17576938..17577024,
FT                   17577312..17577380,17585548..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17600806..>17600880))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_a"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT121359.0
FT                   protein_id=mCP71192.0 isoform=CRA_a"
FT                   /protein_id="EDL38417.1"
FT                   /translation="SSGTPAVTMTRTTVDELVFFVNGKKVVEKNADPETTLLVYLRRKL
FT                   GLCGTKLGCGEGGCGACTVMISKYDRLQNKIVHFSVNACLTPICSLHHVAVTTVEGIGN
FT                   TKKLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNKPEPTVEEIENAFQGNLCRCTGY
FT                   RPILQGFRTFAKDGGCCGGSGNNPNCCMSQTKDQTIAPSSSLFNPEDFKPLDPTQEPIF
FT                   PPELLRLKDTPRKTLRFEGERVTWIQVSTMEELLDLKAQHPDAKLVVGNTEIGIEMKFK
FT                   NMLFPLIICPAWILELTSVAHGPEGISFGAACPLSLVESVLADAIATLPEQRTEVFRGV
FT                   MEQLRWFAGKQVKSVASIGGNIITASPISDLNPVLMASRAKLTLASRGTKRTVWMDHTF
FT                   FPGYRRTLLSPEEILVSIVIPYSRKGEFFSAFKQASRREDDIAKVTSGMRVLFKPGTTE
FT                   VQELSLCFGGMADRTVSALKTTPKQLSKSWNEELLQDVCAGLAEELHLAPDAPGGMVEF
FT                   RRTLTLSFFFKFYLTVLQKLGRADLEGMCGKLDPTFASATLLFQKDPPANVQLFQEVPK
FT                   GQSEEDMVGRPMPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIMSIDTSE
FT                   AKKVPGFVCFLTSEDVPGSNITGIFNDETVFAKDEVTCVGHIIGAVVADTPEHAHRAAR
FT                   GVKITYEDLPAIITIQDAIKNNSFYGPEVKIEKGDLKKGFSEADNVVSGELYIGGQEHF
FT                   YLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFIAKMLGVPDNRIVVRVKRMGGGFGGK
FT                   ETRSTLISTAVALAAYKTGRPVRCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTIVALE
FT                   VAHFSNGGNSEDLSRSIMERAVFHMDNAYKIPNIRGTGRICKTNLPSNTAFRGFGGPQG
FT                   MLIAEYWMSEVAVTCGLPAEEVRRKNMYKEGDLTHFNQKLEGFTLPRCWDECIASSQYQ
FT                   ARKMEVEKFNRENCWKKRGLCIIPTKFGISFTLSFLNQGGALVHVYTDGSVLLTHGGTE
FT                   MGQGLHTKMVQVASRALKIPTSKIHITETSTNTVPNTSPTAASASADLNGQAIYEACQT
FT                   ILKRLEPFKKKNPSGSWESWVMDAYTSAVSLSATGFYKTPNLGYSFETNSGNPFHYFSY
FT                   GVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYS
FT                   PEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASKAVGEPPLFLASSIFFA
FT                   IKDAIRAARAQHGDSNAKQLFQLDSPATPEKIRNACVDQFTTLCATGTPENCKSWSVRI
FT                   "
FT   mRNA            complement(join(17539265..17539521,17541221..17541409,
FT                   17542833..17542898,17543714..17543828,17545860..17545912,
FT                   17547121..17547195,17547796..17547924,17548430..17548525,
FT                   17549077..17549158,17550381..17550526,17550651..17550842,
FT                   17556119..17556205,17556313..17556400,17556804..17556937,
FT                   17557730..17557854,17559356..17559452,17560275..17560394,
FT                   17562538..17562661,17564788..17564957,17566594..17566677,
FT                   17567555..17567727,17569138..17569322,17571158..17571267,
FT                   17572031..17572124,17573177..17573328,17573807..17573899,
FT                   17575679..17575820,17576938..17577024,17577312..17577380,
FT                   17585548..17585609,17586618..17586744,17590502..17590607,
FT                   17591788..17591884,17594593..17594650,17600806..>17600874))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT193659"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT193659.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17539483..17539521,17541221..17541409,
FT                   17542833..17542898,17543714..17543828,17545860..17545912,
FT                   17547121..17547195,17547796..17547924,17548430..17548525,
FT                   17549077..17549158,17550381..17550526,17550651..17550842,
FT                   17556119..17556205,17556313..17556400,17556804..17556937,
FT                   17557730..17557854,17559356..17559452,17560275..17560394,
FT                   17562538..17562661,17564788..17564957,17566594..17566677,
FT                   17567555..>17567590))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_c"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT193659.0
FT                   protein_id=mCP114630.0 isoform=CRA_c"
FT                   /protein_id="EDL38419.1"
FT                   /translation="QCFRSWAERTLRMCGKLDPTFASATLLFQKDPPANVQLFQEVPKG
FT                   QSEEDMVGRPMPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIMSIDTSEA
FT                   KKVPGFVCFLTSEDVPGSNITGIFNDETVFAKDEVTCVGHIIGAVVADTPEHAHRAARG
FT                   VKITYEDLPAIITIQDAIKNNSFYGPEVKIEKGDLKKGFSEADNVVSGELYIGGQEHFY
FT                   LETHCTIAVPKGEAGEMELFVSTQNTMKTQSFIAKMLGVPDNRIVVRVKRMGGGFGGKE
FT                   TRSTLISTAVALAAYKTGRPVRCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTIVALEV
FT                   AHFSNGGNSEDLSRSIMERAVFHMDNAYKIPNIRGTGRICKTNLPSNTAFRGFGGPQGM
FT                   LIAEYWMSEVAVTCGLPAEEVRRKNMYKEGDLTHFNQKLEGFTLPRCWDECIASSQYQA
FT                   RKMEVEKFNRENCWKKRGLCIIPTKFGISFTLSFLNQGGALVHVYTDGSVLLTHGGTEM
FT                   GQGLHTKMVQVASRALKIPTSKIHITETSTNTVPNTSPTAASASADLNGQAIYEACQTI
FT                   LKRLEPFKKKNPSGSWESWVMDAYTSAVSLSATGFYKTPNLGYSFETNSGNPFHYFSYG
FT                   VACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSP
FT                   EGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASKKDPVAASFFLAC"
FT   mRNA            complement(join(<17585541..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17598911..>17598987))
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, transcript variant
FT                   mCT170869"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT170869.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(<17585541..17585609,17586618..17586744,
FT                   17590502..17590607,17591788..17591884,17594593..17594650,
FT                   17598911..>17598985))
FT                   /codon_start=1
FT                   /gene="Xdh"
FT                   /locus_tag="mCG_120176"
FT                   /product="xanthine dehydrogenase, isoform CRA_b"
FT                   /note="gene_id=mCG120176.0 transcript_id=mCT170869.0
FT                   protein_id=mCP93787.0 isoform=CRA_b"
FT                   /protein_id="EDL38418.1"
FT                   /translation="QGTSSFPCFLHCMVLSAPVGLERAQVVEKNADPETTLLVYLRRKL
FT                   GLCGTKLGCGEGGCGACTVMISKYDRLQNKIVHFSVNACLTPICSLHHVAVTTVEGIGN
FT                   TKKLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNKPEPTVEEIENAFQGNLCRCTGY
FT                   RPILQGFRTFAKVS"
FT   gene            complement(17670563..>17731744)
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /note="gene_id=mCG5420.2"
FT   mRNA            complement(join(17670563..17670704,17674316..17674466,
FT                   17677386..17677487,17679914..17680077,17700273..17700642))
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, transcript variant
FT                   mCT4935"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT4935.2 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(17670638..17670704,17674316..17674466,
FT                   17677386..17677487,17679914..17680077,17700273..17700553))
FT                   /codon_start=1
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, isoform CRA_b"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT4935.2
FT                   protein_id=mCP6326.0 isoform=CRA_b"
FT                   /protein_id="EDL38421.1"
FT                   /translation="MPIVCHQVPVLAGSATLATMGTLILCFGKPASYGKHSESVSSGVP
FT                   LLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRG
FT                   RPLSAVIFLKATAFCIGNGLLQAYYLVYCAEYPEEWYTDMRFSVGVFFFILGMGINIHS
FT                   DCMLRQLRKPGEVIYRIPQGGLFTYVSGANFLGEIIEWMGYALATWSVPAFAFAFFTLC
FT                   FLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF"
FT   mRNA            complement(join(<17679934..17680077,17721213..17721316,
FT                   17726441..17726640,17731445..>17731744))
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, transcript variant
FT                   mCT170908"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT170908.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<17679934..17680077,17721213..>17721283))
FT                   /codon_start=1
FT                   /gene="Srd5a2"
FT                   /locus_tag="mCG_5420"
FT                   /product="steroid 5 alpha-reductase 2, isoform CRA_a"
FT                   /note="gene_id=mCG5420.2 transcript_id=mCT170908.0
FT                   protein_id=mCP93826.0 isoform=CRA_a"
FT                   /protein_id="EDL38420.1"
FT                   /translation="IGLTSLTALVGSSLFHKRKTVHERTFIYSLLTRGRPLSAVIFLKA
FT                   TAFCIGNGLLQAYYLVYCAEYPEEWYT"
FT   gene            complement(17855142..>17914615)
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /note="gene_id=mCG1112.1"
FT   mRNA            complement(join(17855142..17857413,17858230..17858334,
FT                   17872904..17872980,17881541..17881683,17898005..17898116,
FT                   17901075..17901187,17911361..17911429,17914533..>17914615))
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, transcript variant
FT                   mCT8806"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT8806.2 created on
FT                   24-JUL-2002"
FT   mRNA            complement(join(17857159..17857413,17858230..17858334,
FT                   17881541..17881686))
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, transcript variant
FT                   mCT170864"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT170864.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(17857282..17857413,17858230..17858334,
FT                   17872904..17872980,17881541..17881683,17898005..17898116,
FT                   17901075..17901187,17911361..17911429,17914533..>17914615))
FT                   /codon_start=1
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, isoform CRA_b"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT8806.2
FT                   protein_id=mCP20448.1 isoform=CRA_b"
FT                   /protein_id="EDL38423.1"
FT                   /translation="GPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQ
FT                   VDPSVTRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSL
FT                   QTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNL
FT                   FVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNT
FT                   ICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRSWQDSSVSYAAGALTVH"
FT   CDS             complement(join(17857282..17857413,17858230..17858331))
FT                   /codon_start=1
FT                   /gene="0610016J10Rik"
FT                   /locus_tag="mCG_1112"
FT                   /product="RIKEN cDNA 0610016J10, isoform CRA_a"
FT                   /note="gene_id=mCG1112.1 transcript_id=mCT170864.0
FT                   protein_id=mCP93782.0 isoform=CRA_a"
FT                   /protein_id="EDL38422.1"
FT                   /translation="MSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMN
FT                   MSFSFLNYAQSSQCRSWQDSSVSYAAGALTVH"
FT   gene            17867697..17870632
FT                   /pseudo
FT                   /locus_tag="mCG_61978"
FT                   /note="gene_id=mCG61978.2"
FT   mRNA            join(17867697..17868347,17868409..17870632)
FT                   /pseudo
FT                   /locus_tag="mCG_61978"
FT                   /note="gene_id=mCG61978.2 transcript_id=mCT62161.2 created
FT                   on 21-APR-2003"
FT   gene            17923192..18174713
FT                   /locus_tag="mCG_148344"
FT                   /note="gene_id=mCG148344.0"
FT   mRNA            join(17923192..17923217,18172139..18174713)
FT                   /locus_tag="mCG_148344"
FT                   /product="mCG148344"
FT                   /note="gene_id=mCG148344.0 transcript_id=mCT188607.0
FT                   created on 13-JAN-2004"
FT   gene            complement(17955799..17979843)
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /note="gene_id=mCG1110.2"
FT   mRNA            complement(join(17955799..17956150,17972258..17972305,
FT                   17972400..17972472,17972701..17972805))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT8802"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT8802.2 created on
FT                   29-AUG-2002"
FT   mRNA            complement(join(17955958..17956124,17972258..17972305,
FT                   17972400..17972472,17972576..17972764))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT172463"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172463.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(17956078..17956150,17972258..17972305,
FT                   17972400..17972472,17979742..17979843))
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, transcript variant
FT                   mCT172464"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172464.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(17956091..17956150,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_b"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172464.0
FT                   protein_id=mCP95382.0 isoform=CRA_b"
FT                   /protein_id="EDL38426.1"
FT                   /translation="MESEQMLEGQTQVAENPHSEYGLTDSVETTKSHRVPSILSFKKQG
FT                   AV"
FT   CDS             complement(join(17956091..17956150,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_b"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT8802.2
FT                   protein_id=mCP20447.2 isoform=CRA_b"
FT                   /protein_id="EDL38427.1"
FT                   /translation="MESEQMLEGQTQVAENPHSEYGLTDSVETTKSHRVPSILSFKKQG
FT                   AV"
FT   CDS             complement(join(17956110..17956124,17972258..17972305,
FT                   17972400..17972435))
FT                   /codon_start=1
FT                   /gene="2810410M20Rik"
FT                   /locus_tag="mCG_1110"
FT                   /product="RIKEN cDNA 2810410M20, isoform CRA_a"
FT                   /note="gene_id=mCG1110.2 transcript_id=mCT172463.0
FT                   protein_id=mCP95383.0 isoform=CRA_a"
FT                   /protein_id="EDL38425.1"
FT                   /translation="MESEQMLEGQTQVAENPHSEYGLTDSVEHLIF"
FT   gene            complement(17985284..17985915)
FT                   /pseudo
FT                   /locus_tag="mCG_1039331"
FT                   /note="gene_id=mCG1039331.1"
FT   mRNA            complement(17985284..17985915)
FT                   /pseudo
FT                   /locus_tag="mCG_1039331"
FT                   /note="gene_id=mCG1039331.1 transcript_id=mCT157035.1
FT                   created on 23-APR-2003"
FT   gene            complement(17988216..17988783)
FT                   /pseudo
FT                   /locus_tag="mCG_1039294"
FT                   /note="gene_id=mCG1039294.0"
FT   mRNA            complement(join(17988216..17988439,17988515..17988783))
FT                   /pseudo
FT                   /locus_tag="mCG_1039294"
FT                   /note="gene_id=mCG1039294.0 transcript_id=mCT156998.1
FT                   created on 28-OCT-2002"
FT   gene            17994995..18047443
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /note="gene_id=mCG1114.3"
FT   mRNA            join(17994995..17995453,18008262..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044727)
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, transcript variant mCT193688"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT193688.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(17995045..17995453,18008262..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044555)
FT                   /codon_start=1
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, isoform CRA_a"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT193688.0
FT                   protein_id=mCP114626.0 isoform=CRA_a"
FT                   /protein_id="EDL38428.1"
FT                   /translation="MSSPAGRRKKKGSGGASPAPARPPPPAAVPAPAAGPAPAAGSPPK
FT                   RNPSSFSSPLVVGFALLRLLACHLGLLFAWLCQRFSRALMAAKRSSGTAPAPASPSPPA
FT                   PGPGGEAESVRVFHKQAFEYISIALRIDEEEKGQKEQAVEWYKKGIEELEKGIAVIVTG
FT                   QGEQYERARRLQAKMMTNLVMAKDRLQLLEKLQPVLQFSKSQTDVYNESTNLTCRNGHL
FT                   QSESGAVPKRKDPLTHASNSLPRSKTVLKSGSAGLSGHHRAPSCSGLSMVSGARPGPGP
FT                   AATTHKGTPKPNRTNKPSTPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDD
FT                   IAGQELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNAT
FT                   FFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRL
FT                   KTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKN
FT                   LLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRN
FT                   IRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV"
FT   mRNA            join(<17995217..17995453,18008259..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18047443)
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, transcript variant mCT8804"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT8804.2 created on
FT                   30-AUG-2002"
FT   CDS             join(<17995219..17995453,18008259..18008345,
FT                   18012615..18012698,18015780..18015875,18023703..18023890,
FT                   18025283..18025416,18025647..18025740,18027885..18027959,
FT                   18028714..18028785,18029740..18029815,18030119..18030210,
FT                   18030579..18030658,18031539..18031581,18033497..18033576,
FT                   18038249..18038319,18043278..18043318,18044433..18044555)
FT                   /codon_start=1
FT                   /gene="Spast"
FT                   /locus_tag="mCG_1114"
FT                   /product="spastin, isoform CRA_b"
FT                   /note="gene_id=mCG1114.3 transcript_id=mCT8804.2
FT                   protein_id=mCP20441.2 isoform=CRA_b"
FT                   /protein_id="EDL38429.1"
FT                   /translation="FALLRLLACHLGLLFAWLCQRFSRALMAAKRSSGTAPAPASPSPP
FT                   APGPGGEAESVRVFHKQAFEYISIALRIDEEEKAGQKEQAVEWYKKGIEELEKGIAVIV
FT                   TGQGEQYERARRLQAKMMTNLVMAKDRLQLLEKLQPVLQFSKSQTDVYNESTNLTCRNG
FT                   HLQSESGAVPKRKDPLTHASNSLPRSKTVLKSGSAGLSGHHRAPSCSGLSMVSGARPGP
FT                   GPAATTHKGTPKPNRTNKPSTPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKF
FT                   DDIAGQELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESN
FT                   ATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASR
FT                   RLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLL
FT                   KNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEM
FT                   RNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV"
FT   gene            <18058927..18089174
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /note="gene_id=mCG120952.1"
FT   mRNA            join(<18058927..18058964,18066005..18066091,
FT                   18068112..18068196,18069793..18069835,18071329..18071394,
FT                   18072832..18072913,18073338..18073373,18074319..18074413,
FT                   18076259..18076307,18076592..18076711,18079606..18079708,
FT                   18083658..18083705,18084570..18084638,18087962..18089173)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT122141"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT122141.1
FT                   created on 30-AUG-2002"
FT   mRNA            join(<18058941..18058964,18064906..18064992,
FT                   18068112..18068196,18069793..18069835,18071329..18071394,
FT                   18072832..18072913,18073338..18073373,18074319..18074413,
FT                   18076259..18076307,18076589..>18076710)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT172467"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172467.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<18071367..18071394,18072832..18072913,
FT                   18073338..18073373,18074319..18074413,18076259..18076307,
FT                   18076592..18076711,18079606..18079708,18083658..18083705,
FT                   18084570..18084638,18087962..18088459)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_b"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT122141.1
FT                   protein_id=mCP70801.1 isoform=CRA_b"
FT                   /protein_id="EDL38431.1"
FT                   /translation="GNLALSIHLGLKRLEVLAVFASTVLAQLGALFILKESAERFLEQP
FT                   EIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGLIPG
FT                   LSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSV
FT                   YSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDA
FT                   NEQMVLAHVSNRLCTLVSTLTVQIFKDDWIRPALSSGPVAPNVLNFSDHHVIPMPLLKN
FT                   VDERTPVTSTPAKPSSPPPEFSFNTPGKNVSPVILLNTQTRPYSLGLNRGHTPYSSVFS
FT                   QGLAFPGVGAGQGLRPTFPHIPSRYGINRMGQPRP"
FT   CDS             join(<18071367..18071394,18072832..18072913,
FT                   18073338..18073373,18074319..18074413,18076259..18076307,
FT                   18076589..>18076710)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_a"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172467.0
FT                   protein_id=mCP95387.0 isoform=CRA_a"
FT                   /protein_id="EDL38430.1"
FT                   /translation="GNLALSIHLGLKRLEVLAVFASTVLAQLGALFILKESAERFLEQP
FT                   EIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSSLCGLIP
FT                   GLSSIFLPRMNPFVLIDLAGAFALCITYMLIEI"
FT   mRNA            join(<18076263..18076307,18076592..18076711,
FT                   18079606..18079688,18080749..18080767,18083658..18083705,
FT                   18084570..18084638,18087962..18089174)
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, transcript variant mCT172468"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172468.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<18079609..18079688,18080749..18080767,
FT                   18083658..18083705,18084570..18084638,18087962..18088459)
FT                   /codon_start=1
FT                   /gene="Slc30a6"
FT                   /locus_tag="mCG_120952"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 6, isoform CRA_c"
FT                   /note="gene_id=mCG120952.1 transcript_id=mCT172468.0
FT                   protein_id=mCP95386.0 isoform=CRA_c"
FT                   /protein_id="EDL38432.1"
FT                   /translation="LLCRGHCVSHCHCPDDVWHHVPHECVHGKVLLQTTPPHVIGQLDK
FT                   LIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVSNRLCTLVSTL
FT                   TVQIFKDDWIRPALSSGPVAPNVLNFSDHHVIPMPLLKNVDERTPVTSTPAKPSSPPPE
FT                   FSFNTPGKNVSPVILLNTQTRPYSLGLNRGHTPYSSVFSQGLAFPGVGAGQGLRPTFPH
FT                   IPSRYGINRMGQPRP"
FT   gene            complement(18091258..>18113428)
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /note="gene_id=mCG1113.2"
FT   mRNA            complement(join(18091258..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18110339..18112333,18113167..>18113427))
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   transcript variant mCT8807"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT8807.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(18091259..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18113167..>18113428))
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   transcript variant mCT173270"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT173270.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(18091787..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18113167..>18113428))
FT                   /codon_start=1
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT173270.0
FT                   protein_id=mCP96189.0 isoform=CRA_a"
FT                   /protein_id="EDL38433.1"
FT                   /translation="VNFIRNNRRALIQRMGLTVTKQICDDLFALNVLNNQEANVIYCEP
FT                   LEQEAARKIIHMTMQKGSAACNLFLKSLENWDYFVYQDLTGQSGLIDSLGNLKNLERLI
FT                   LDDIRMNEEDAKNLAEGLRSLKKMRLLHLTHLSDIGEGMDYIVKSLSEESCDLQEMKLV
FT                   ACCLTANSVKVLAQNLHNLIKLSILDISENYLEKDGNEALQELIGRLGVLGELTTLMLP
FT                   WCWDVHTSLPKLLKQLEGTPGLAKLGLKNWRLRDEEIKSLGEFLEMNPLRDLQQLDLAG
FT                   HCVSSDGWLYFMNVFENLKQLVFFDFSTEEFLPDAALVRKLSQVLSKLTLLQEVKLTGW
FT                   EFDDYDISAIKGTFKLVTA"
FT   CDS             complement(join(18091787..18092079,18098945..18099112,
FT                   18101216..18101308,18102573..18102743,18107103..18107195,
FT                   18110339..18112333,18113167..>18113425))
FT                   /codon_start=1
FT                   /gene="Card12"
FT                   /locus_tag="mCG_1113"
FT                   /product="caspase recruitment domain family, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1113.2 transcript_id=mCT8807.2
FT                   protein_id=mCP20458.2 isoform=CRA_b"
FT                   /protein_id="EDL38434.1"
FT                   /translation="NFIRNNRRALIQRMGLTVTKQICDDLFALNVLNNQEANVIYCEPL
FT                   EQEAARKIIHMTMQKGSAACNLFLKSLENWDYFVYQDLTGQNLSYQVTEEDLNVLAQNL
FT                   KDLYNSPAFLNFYPLGEDIDIIFNLEKTFTEPIMWKKDHRHHRVEQLTLGSLLEALKSP
FT                   CLIEGESGKGKSTLLQRIAMLWASGGCRALKGFRLVFFIHLRSARGGLFETLYDQLLNI
FT                   PDFISKPTFKALLLKLHKEVLFLLDGYNEFHPQNCPEIEALIKENHRFKNMVIVTTTTE
FT                   CLRHIRHVGALTAEVGDMTEDSAKDLIEAVLVPDQVERLWAQIQESRCLRNLMKTPLFV
FT                   VITCAIQMGRQEFQAHTQTMLFQTFYDLLIQKNSHRYRGGASGDFARSLDYCGDLALEG
FT                   VFAHKFDFEPEHGSSMNEDVLVTIGLLCKYTAQRLKPTYKFFHKSFQEYTAGRRLSSLL
FT                   TSKEPEEVSKGNSYLNKMVSISDITSLYGNLLLYTCGSSTEATRAVMRHLAMVYQHGSL
FT                   QGLSVTKRPLWRQESIQSLRNTTEQDVLKAINVNSFVECGINLFSESMSKSDLSQEFEA
FT                   FFQGKSLYINSENIPDYLFDFFEYLPNCASALDFVKLDFYERATESQDKAEENVPGVHT
FT                   EGPSETYIPPRAVSLFFNWKQEFKTLEVTLRDINKLNKQDIKYLGKIFSSATNLRLHIK
FT                   RCAAMAGRLSSVLRTCKNMHTLMVEASPLTTDDEQYITSVTGLQNLSIHRLHTQQLPGG
FT                   LIDSLGNLKNLERLILDDIRMNEEDAKNLAEGLRSLKKMRLLHLTHLSDIGEGMDYIVK
FT                   SLSEESCDLQEMKLVACCLTANSVKVLAQNLHNLIKLSILDISENYLEKDGNEALQELI
FT                   GRLGVLGELTTLMLPWCWDVHTSLPKLLKQLEGTPGLAKLGLKNWRLRDEEIKSLGEFL
FT                   EMNPLRDLQQLDLAGHCVSSDGWLYFMNVFENLKQLVFFDFSTEEFLPDAALVRKLSQV
FT                   LSKLTLLQEVKLTGWEFDDYDISAIKGTFKLVTA"
FT   gene            complement(18103435..18103873)
FT                   /pseudo
FT                   /locus_tag="mCG_1121"
FT                   /note="gene_id=mCG1121.1"
FT   mRNA            complement(18103435..18103873)
FT                   /pseudo
FT                   /locus_tag="mCG_1121"
FT                   /note="gene_id=mCG1121.1 transcript_id=mCT8813.1 created on
FT                   30-AUG-2002"
FT   gene            18158284..18159136
FT                   /pseudo
FT                   /locus_tag="mCG_1118"
FT                   /note="gene_id=mCG1118.1"
FT   mRNA            18158284..18159136
FT                   /pseudo
FT                   /locus_tag="mCG_1118"
FT                   /note="gene_id=mCG1118.1 transcript_id=mCT8810.1 created on
FT                   14-OCT-2002"
FT   gene            <18160568..18171949
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /note="gene_id=mCG1117.3"
FT   mRNA            join(<18160568..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167731,18169369..18169482,
FT                   18170031..18171033)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT193692"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT193692.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18160576..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18171949)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT8809"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT8809.1 created on
FT                   25-JUL-2002"
FT   mRNA            join(18160611..18160855,18161542..18161773,
FT                   18163407..18163566,18164989..18165160,18167650..18167727,
FT                   18169369..18169482,18170031..18171020)
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, transcript variant
FT                   mCT170865"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT170865.0 created
FT                   on 25-JUL-2002"
FT   CDS             join(<18160723..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167731,18169369..18169460)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_b"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT193692.0
FT                   protein_id=mCP114627.0 isoform=CRA_b"
FT                   /protein_id="EDL38436.1"
FT                   /translation="QVVPEPRAQPLVSTEAGGMQPPGPPPAYAPANGDFTFVSSADAED
FT                   LSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDID
FT                   LKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITI
FT                   WIFGSLTIFLLARVLGGEVSCIWPSSWSYRIFITSSHCNSPYTFGGWIF"
FT   CDS             join(18160777..18160855,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18170168)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_c"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT8809.1
FT                   protein_id=mCP20453.1 isoform=CRA_c"
FT                   /protein_id="EDL38437.1"
FT                   /translation="MQPPGPPPAYAPANGDFTFVSSADAEDLSGSIAAPDVKLNLGVSG
FT                   DFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSL
FT                   GFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGE
FT                   VAYGQVLGVIGYSLLPLIVIAPILLVVGSFEMVSTLIKLFGVFWAAYSAASLLVGEEFK
FT                   TKKPLLIYPIFLLYIYFLSLYTGV"
FT   CDS             join(18161566..18161773,18163407..18163566,
FT                   18164989..18165160,18167650..18167727,18169369..18169482,
FT                   18170031..18170168)
FT                   /codon_start=1
FT                   /gene="Yipf4"
FT                   /locus_tag="mCG_1117"
FT                   /product="Yip1 domain family, member 4, isoform CRA_a"
FT                   /note="gene_id=mCG1117.3 transcript_id=mCT170865.0
FT                   protein_id=mCP93783.0 isoform=CRA_a"
FT                   /protein_id="EDL38435.1"
FT                   /translation="MKKQVDFDIDMEIPGDEPLRPQHLKSRGREIPELKASLDYTVIKF
FT                   SACRGYILKPCLNKVEKKFQFKDEHLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRG
FT                   YGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGP
FT                   LAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLP
FT                   LIVIAPILLVVGSFEMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIY
FT                   FLSLYTGV"
FT   CDS             18173587..18173943
FT                   /codon_start=1
FT                   /locus_tag="mCG_148344"
FT                   /product="mCG148344"
FT                   /note="gene_id=mCG148344.0 transcript_id=mCT188607.0
FT                   protein_id=mCP108824.0"
FT                   /protein_id="EDL38424.1"
FT                   /translation="MWKCKLNKPNLLFGHDACAGIETLTNSRVMLPFSTFTHSESKSMF
FT                   WFLFVCFVFQDRVSLYSPGCPGTHFVDQAGLELRNPPASASQVLGLKACAATTTWQKHG
FT                   FYVSFSVLYKSDLF"
FT   gene            18199339..18375138
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /note="gene_id=mCG1116.2"
FT   mRNA            join(18199339..18199859,18217355..18217536,
FT                   18219825..18219962,18229086..18229279,18232336..18232447,
FT                   18233204..18233286,18236976..18237359,18245469..18245527,
FT                   18251061..18252458,18257910..18258059,18261603..18261830,
FT                   18265015..18265175,18266286..18266375,18266792..18266923,
FT                   18268780..18268961,18269940..18270073,18270884..18271045,
FT                   18271138..18271269,18271771..18271868,18274871..18275018,
FT                   18276400..18276533,18277897..18278043,18280005..18280192,
FT                   18280967..18281296,18281545..18281644,18282903..18283117,
FT                   18283256..18283464,18283907..18284253,18285285..18285504,
FT                   18286206..18286339,18287127..18287237,18290334..18290461,
FT                   18291605..18291736,18293934..18294149,18294807..18294990,
FT                   18295649..18295804,18297004..18297137,18298860..18299013,
FT                   18301299..18301415,18302854..18303008,18303505..18303631,
FT                   18306684..18306794,18307651..18307784,18310231..18310358,
FT                   18311668..18312230,18313521..18313696,18314149..18314245,
FT                   18314380..18314574,18315183..18315383,18318357..18318636,
FT                   18319068..18319324,18319581..18319689,18319982..18320203,
FT                   18321487..18322267,18323772..18323915,18324481..18324610,
FT                   18326253..18326384,18327036..18327203,18330007..18330180,
FT                   18331372..18331568,18332595..18332895,18334814..18335031,
FT                   18340929..18341093,18342384..18342552,18349336..18349549,
FT                   18361293..18361438,18362433..18362543,18363077..18363294,
FT                   18364259..18364420,18365523..18365600,18368312..18368500,
FT                   18369460..18369594,18374279..18375138)
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /product="baculoviral IAP repeat-containing 6"
FT                   /note="gene_id=mCG1116.2 transcript_id=mCT8808.2 created on
FT                   25-JUL-2002"
FT   gene            complement(18247277..>18289027)
FT                   /locus_tag="mCG_146329"
FT                   /note="gene_id=mCG146329.0"
FT   mRNA            complement(join(18247277..18247476,18279955..18281288,
FT                   18283341..18283441,18288729..>18289027))
FT                   /locus_tag="mCG_146329"
FT                   /product="mCG146329"
FT                   /note="gene_id=mCG146329.0 transcript_id=mCT186432.0
FT                   created on 14-JUL-2003"
FT   CDS             join(18261787..18261830,18265015..18265175,
FT                   18266286..18266375,18266792..18266923,18268780..18268961,
FT                   18269940..18270073,18270884..18271045,18271138..18271269,
FT                   18271771..18271868,18274871..18275018,18276400..18276533,
FT                   18277897..18278043,18280005..18280192,18280967..18281296,
FT                   18281545..18281644,18282903..18283117,18283256..18283464,
FT                   18283907..18284253,18285285..18285504,18286206..18286339,
FT                   18287127..18287237,18290334..18290461,18291605..18291736,
FT                   18293934..18294149,18294807..18294990,18295649..18295804,
FT                   18297004..18297137,18298860..18299013,18301299..18301415,
FT                   18302854..18303008,18303505..18303631,18306684..18306794,
FT                   18307651..18307784,18310231..18310358,18311668..18312230,
FT                   18313521..18313696,18314149..18314245,18314380..18314574,
FT                   18315183..18315383,18318357..18318636,18319068..18319324,
FT                   18319581..18319689,18319982..18320203,18321487..18322267,
FT                   18323772..18323915,18324481..18324610,18326253..18326384,
FT                   18327036..18327203,18330007..18330180,18331372..18331568,
FT                   18332595..18332895,18334814..18335031,18340929..18341093,
FT                   18342384..18342552,18349336..18349549,18361293..18361438,
FT                   18362433..18362543,18363077..18363294,18364259..18364420,
FT                   18365523..18365600,18368312..18368500,18369460..18369594,
FT                   18374279..18374458)
FT                   /codon_start=1
FT                   /gene="Birc6"
FT                   /locus_tag="mCG_1116"
FT                   /product="baculoviral IAP repeat-containing 6"
FT                   /note="gene_id=mCG1116.2 transcript_id=mCT8808.2
FT                   protein_id=mCP20444.2"
FT                   /protein_id="EDL38438.1"
FT                   /translation="MLLSTPGTWKLQTDSNSWDEHVFELVLPKACMVGHVDFKFVLNSN
FT                   ITSVPQIQVTLLKNKAPGLGKANALNIEVEHNGNPSLVDLNEEMHHMDVEESQCLRLCP
FT                   FLEDHKEDILCGPVWLASGLDLSGHAGMLTLTSPKLVKGMAGGKYRSFLIHVKAVSDRG
FT                   AADEMCSSGLRPVVRLPSLKQQGHKGYSLASLLAKVAAGKEKSSNVKNENAGGTRKSEN
FT                   LRGCDLLQEVSVTIRRFKKTSICKERVQRCAMLQFSEFHEKLLNTLCRRSDDGQVTEHA
FT                   QSLVLDALCWLAGVHSNGSGSSKEGNECLLSKTRKCLSDIVRVCFFEAGRSIAHKCARF
FT                   LALCISNGKCEPCQPGFGSVLLKALLDNMCFLPAAATGGSVYWYFVLLNYVKDEDLAGC
FT                   STACAALLTAVSRQLQDRLTPLEALLQTRYGLYSSPFDPVLFDLEMSGSSWKTVYSSST
FT                   AVQSDEIDLSDVLSGNGRVSSCTAAEGSFTSLTGLLEVEPLHFTCVSTSDGTRIERDDA
FT                   STFTVSSFGVPPAVGGLSSGTVGEASTALSSAAQVALQSLSHAMASAEQQLQVLQEKQQ
FT                   QLLKLQQQKAKLEAKLHQTTAAAAAAASAAAAAAAGPVHNAVPSNPVAAPGFFIHPSDV
FT                   IPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVNLAAQNKNSSKSRM
FT                   NPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPILLTDVLIPTCGD
FT                   LASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKITVIGRYGSTNAR
FT                   AKIPLGFYYGHSYILPWESELKLMHDPLRGEGESASQPEIDQHLAMMVALQEDIQCRYN
FT                   LACHRLEALLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQLQLQLNLAH
FT                   NAVQRLKVAIGASRKLLNETSGPEDLIQTSSTEQLRTIVRYLLDTLLSLLHSSNGHSVP
FT                   AVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNVLQELYNS
FT                   EQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPELSMHRRTEGVLDI
FT                   PMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQNLNRSSKGGSSLD
FT                   RLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQATS
FT                   KHFKDLIRLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTLAHDRCISVVQKLVLFLLSM
FT                   DFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDISWGG
FT                   AWAQYSLTCMLQDILAGELLAPVAAEAMEECTVSEDVGATAGDSDDSLQQSPAQLLETI
FT                   DEPLTHEIAGTPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKDPLAAKVFKPISST
FT                   WYDYWGADYGTYNYNPYIGGLGMPVAKPPSNTEKNGSQTVSVSVSQALDARLEVGLEQQ
FT                   AELMLKMMSTLEADSILQALTNTSPTFSQSPTGTDDSLLGNLQPANQNSQLMIQLSSVP
FT                   MLNVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSSGNKENGADIFLYNANRIPVISL
FT                   NQASIASFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSSIGIQETTAHLLVSD
FT                   PNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSELLLK
FT                   LIHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITC
FT                   SDKVMSRSGSDSSAGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQL
FT                   PLSSNREYSARVSVTTNTTDSVSDEEKVSGGKDVNGSSASTPGSPACVADLVLANQQIM
FT                   SQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTV
FT                   HMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICN
FT                   NMVTSTRAIVNTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGT
FT                   ITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPSAVLLKEIHIQP
FT                   HLASLATCPSSVSVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPR
FT                   DASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLE
FT                   GMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNC
FT                   AASGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSAKM
FT                   AALKRSGRMNYMCPSSSAVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDRELF
FT                   ELLFNWSMSLPCNVVLKKAVDSLLCSMCHIHPNYFSLLMGWMGIIPPPVQCHHRLSMTD
FT                   DSKKQDLSSSLTDDSKNAQAPLSLTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLA
FT                   SFCFSHISYSESIAQSVDNSQDKLRRHHVPQHCNKMPITADLVAPILRFLTEVGNSHIM
FT                   KDWLGGSEVNPLWTALLFLLCHSGSTAGGHNLGAQQSSTRSASHSSATTTVLTTQQRTA
FT                   IENATVAFFLQCISCHPNNQKLMAQVLCELFQTAPQRGSLPTSGNISGFVRRLFLQLML
FT                   EDEKVTMFLQSPCPLYKGRINATSHVIQHPMFGAGHKFRTLHLPVSTTLSDVLDRVSDT
FT                   PSITAKLISEQKDDKEKKNHEEKEKVKAENGFQDNYSVVVASGLKSQSKRAMASTPPRP
FT                   PSRRGRTIPDKIGSASSSADAASKIITVPVFHLFHRLLAGQPLPAEMTLAQLLTLLYDR
FT                   KLPQGYRSIDLTVKLGSKVITDPSLSKTDSFKRLHPEKDHGDLVGSCPEDEALTPSDEC
FT                   MDGVLDESLLETCPIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVIASTTQEKP
FT                   KDSDQFEWVTIEQSGELVYEAPETIAAEPPPVKSAVQATSPIPAHSLAAFGLFLRLPGY
FT                   AEVLLKERKHAQCLLRLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSATPLTTD
FT                   DGVLLRRMALEIGALHLILVCLSALSHHAPRVPNSSLSQTEPQVSNSHNPTSAEEQQLY
FT                   WAKGTGFGTGSTASGWDVEQALTKQRLEEEHVTCLLQVLASYINPMSGAVNGEAQASPE
FT                   SRAQNSSALPSVLLELLSQSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCT
FT                   SMVPLLLPLSTENGEEEEDEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKAGVKP
FT                   DAPDQEPEGLALLVPDIQRTAEIVHAATANLRQANQEKKLGEYSKKVVMKPKPLSVLKS
FT                   LEEKYVAVMKKLQFDTFEMVSEDDDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEA
FT                   VTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPP
FT                   LVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLIL
FT                   VAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHF
FT                   YLKRIELMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKRHTAQLREELLKLPCPEGLD
FT                   PDIEDASPVCRATAGAEDTLTHDHVNPSSSKDLPSDFQL"
FT   CDS             complement(join(18281056..18281288,18283341..18283441,
FT                   18288729..>18288745))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146329"
FT                   /product="mCG146329"
FT                   /note="gene_id=mCG146329.0 transcript_id=mCT186432.0
FT                   protein_id=mCP107779.0"
FT                   /protein_id="EDL38439.1"
FT                   /translation="GVPSWRATIIAKCWSISGWLADSPSPLRGSCINFSSLSQDLLEFL
FT                   FCAARFTAGGSMTEPGKSWASSALITTETASLGGVSGGVIKSGVVFGVGGITSDGWMKN
FT                   PGAATGLEGTAL"
FT   gene            <18389535..18529925
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /note="gene_id=mCG1120.2"
FT   mRNA            join(18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18529771..18529925)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT172465"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT172465.1 created
FT                   on 27-MAR-2003"
FT   mRNA            join(<18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529689..18529924)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT193661"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT193661.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18389535..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529692..18529924)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT8812"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT8812.2 created on
FT                   27-MAR-2003"
FT   CDS             join(<18389674..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529689..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT193661.0
FT                   protein_id=mCP114628.0 isoform=CRA_c"
FT                   /protein_id="EDL38442.1"
FT                   /translation="WDTVSGAAMPGMMWTPELALLRGFSTEAERLVWKQEGICGSDIGV
FT                   FLELLLEGSYEALFFHSTTQTILNSTMMAEEKIDSYLEKQIVNFLDCSTDLEEIERQQL
FT                   VFLLGVSSLQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESV
FT                   YSLTSKPILLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQQLLEERSPQLFALAKNC
FT                   IDQVMKQENLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTG
FT                   ALGKRTRFQENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKL
FT                   ADSERFQMPDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLLSQPKFWAIQTS
FT                   ALILRTKLERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQL
FT                   AGLLFELGCTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEKKETPGLYCLL
FT                   GDVLQDHSCYDKAWELSRHRSARAQRSKALLHLRNKEFRECVECFERSVKINPMQLGVW
FT                   FSLGCAYLALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALK
FT                   CNYEHWQIWENYILTSTDVGEFGEAIKAYHRLLDLRDKYKDIQVLKILVQAVVNDMTDR
FT                   SGAVASSLKGKLQELFGRITSRVTNDGEVWRLYAQVHGNGQSEKPDENDKAFQCLSKAY
FT                   KCDTQSSCWEKDATAFKEVVQRAIGLAHVAMKCAESKSSPQEAVQTLSSVRLNLRGLLS
FT                   KAKQNFTDVVSGEVSGELASEIAAVNALEAELQDLSNQLRNRY"
FT   CDS             join(18389698..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18529771..18529815)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT172465.1
FT                   protein_id=mCP95384.1 isoform=CRA_a"
FT                   /protein_id="EDL38440.1"
FT                   /translation="MPGMMWTPELALLRGFSTEAERLVWKQEGICGSDIGVFLELLLEG
FT                   SYEALFFHSTTQTILNSTMMAEEKIDSYLEKQIVNFLDCSTDLEEIERQQLVFLLGVSS
FT                   LQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESVYSLTSKPI
FT                   LLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQQLLEERSPQLFALAKNCIDQVMKQE
FT                   NLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTGALGKRTRF
FT                   QENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKLADSERFQM
FT                   PDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLLSQPKFWAIQTSALILRTKL
FT                   ERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELG
FT                   CTSSALQIFEKLEMWEDVVICHERAGRHGKSCKTSATSFETGTD"
FT   CDS             join(18389698..18389797,18390414..18390591,
FT                   18393305..18393434,18396394..18396534,18399939..18400041,
FT                   18409643..18409807,18413226..18413359,18417954..18418066,
FT                   18421346..18421412,18436768..18436881,18444317..18444412,
FT                   18447459..18447581,18465825..18466052,18496046..18496144,
FT                   18501895..18501947,18506861..18507026,18522964..18523161,
FT                   18524564..18524675,18528402..18528502,18529692..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT8812.2
FT                   protein_id=mCP20450.3 isoform=CRA_d"
FT                   /protein_id="EDL38443.1"
FT                   /translation="MPGMMWTPELALLRGFSTEAERLVWKQEGICGSDIGVFLELLLEG
FT                   SYEALFFHSTTQTILNSTMMAEEKIDSYLEKQIVNFLDCSTDLEEIERQQLVFLLGVSS
FT                   LQLFVQSNWTGPLVDLHPQDFLPSGLLEQFSEVKGLDAIIMGLLILDGESVYSLTSKPI
FT                   LLLIARIILVNIRHKLTALQSLPWWTLRYVNIHQQLLEERSPQLFALAKNCIDQVMKQE
FT                   NLFEGDSGRLLAIQFHLECAHVFLYYYEYKEAKDQFSTAKDISKLEIDLTGALGKRTRF
FT                   QENYVAQLIVDVRRKEAVPFSCEFSPAPTPQECLAKNLELNDDTVLNEIKLADSERFQM
FT                   PDLCAEELAVVLGVCTNFQKNNPVHKLTEEELLAFTSCLLSQPKFWAIQTSALILRTKL
FT                   ERGSTRRVERAMRQTQALADQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELG
FT                   CTSSALQIFEKLEMWEDVVICHERAGRHGKAEEILRQELEKKETPGLYCLLGDVLQDHS
FT                   CYDKAWELSRHRSARAQRSKALLHLRNKEFRECVECFERSVKINPMQLGVWFSLGCAYL
FT                   ALEDYGGSAKAFQRCVTLEPDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQI
FT                   WENYILTSTDVGEFGEAIKAYHRLLDLRDKYKDIQVLKILVQAVVNDMTDRSGAVASSL
FT                   KGKLQELFGRITSRVTNDGEVWRLYAQVHGNGQSEKPDENDKAFQCLSKAYKCDTQSSC
FT                   WEKDATAFKEVVQRAIGLAHVAMKCAESKSSPQEAVQTLSSVRLNLRGLLSKAKNFTDV
FT                   VSGEVSGELASEIAAVNALEAELQDLSNQLRNRY"
FT   mRNA            join(18433124..18433191,18436768..18436881,
FT                   18444317..18444412,18447459..18447581,18465825..18466052,
FT                   18496046..18496144,18501895..18501947,18506861..18507026,
FT                   18522964..18523161,18524564..18524675,18528402..18528502,
FT                   18529689..18529918)
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, transcript
FT                   variant mCT181397"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT181397.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(18433180..18433191,18436768..18436881,
FT                   18444317..18444412,18447459..18447581,18465825..18466052,
FT                   18496046..18496144,18501895..18501947,18506861..18507026,
FT                   18522964..18523161,18524564..18524675,18528402..18528502,
FT                   18529689..18529811)
FT                   /codon_start=1
FT                   /gene="Ttc27"
FT                   /locus_tag="mCG_1120"
FT                   /product="tetratricopeptide repeat domain 27, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1120.2 transcript_id=mCT181397.0
FT                   protein_id=mCP104319.0 isoform=CRA_b"
FT                   /protein_id="EDL38441.1"
FT                   /translation="MESKCLLSQPKFWAIQTSALILRTKLERGSTRRVERAMRQTQALA
FT                   DQFEDKATSVLERLKIFYCCQVPPHWAVQRQLAGLLFELGCTSSALQIFEKLEMWEDVV
FT                   ICHERAGRHGKAEEILRQELEKKETPGLYCLLGDVLQDHSCYDKAWELSRHRSARAQRS
FT                   KALLHLRNKEFRECVECFERSVKINPMQLGVWFSLGCAYLALEDYGGSAKAFQRCVTLE
FT                   PDNAEAWNNLSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFGEAIK
FT                   AYHRLLDLRDKYKDIQVLKILVQAVVNDMTDRSGAVASSLKGKLQELFGRITSRVTNDG
FT                   EVWRLYAQVHGNGQSEKPDENDKAFQCLSKAYKCDTQSSCWEKDATAFKEVVQRAIGLA
FT                   HVAMKCAESKSSPQEAVQTLSSVRLNLRGLLSKAKQNFTDVVSGEVSGELASEIAAVNA
FT                   LEAELQDLSNQLRNRY"
FT   gene            18661330..19050521
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /note="gene_id=mCG120941.1"
FT   mRNA            join(18661330..18662215,18663183..18663253,
FT                   18721474..18721765,18806995..18807164,18834919..18835086,
FT                   18881044..18881268,18882852..18883126,18906024..18906129,
FT                   18909477..18909548,18923624..18923746,18931032..18931199,
FT                   18933561..18933788,18936117..18936139,18939501..18939600,
FT                   18940085..18940183,18947185..18947310,18948452..18948577,
FT                   18949919..18950041,18953373..18953492,18968913..18969035,
FT                   18971733..18971855,18973761..18973883,18979725..18979847,
FT                   18985952..18986077,19007471..19007596,19011413..19011556,
FT                   19018018..19018197,19019443..19019529,19021241..19021369,
FT                   19022069..19022209,19023070..19023240,19043814..19043936,
FT                   19048182..19048331,19049124..19050521)
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, transcript variant mCT122131"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT122131.1
FT                   created on 03-SEP-2002"
FT   mRNA            join(18661330..18662215,18663183..18663253,
FT                   18664272..18664605)
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, transcript variant mCT170878"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT170878.0
FT                   created on 03-SEP-2002"
FT   CDS             join(18661740..18662215,18663183..18663253,
FT                   18721474..18721765,18806995..18807164,18834919..18835086,
FT                   18881044..18881268,18882852..18883126,18906024..18906129,
FT                   18909477..18909548,18923624..18923746,18931032..18931199,
FT                   18933561..18933788,18936117..18936139,18939501..18939600,
FT                   18940085..18940183,18947185..18947310,18948452..18948577,
FT                   18949919..18950041,18953373..18953492,18968913..18969035,
FT                   18971733..18971855,18973761..18973883,18979725..18979847,
FT                   18985952..18986077,19007471..19007596,19011413..19011556,
FT                   19018018..19018197,19019443..19019529,19021241..19021369,
FT                   19022069..19022209,19023070..19023240,19043814..19043936,
FT                   19048182..19048331,19049124..19049305)
FT                   /codon_start=1
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT122131.1
FT                   protein_id=mCP70792.1 isoform=CRA_b"
FT                   /protein_id="EDL38445.1"
FT                   /translation="MAGAWLRWGLLLWAGLLAWSAHGRVRRITYVVRPGPGLPAGALPL
FT                   AGPPRTFNVALDARYSRSSTAASSRALAGPPAERTRRTSQPGGAALPGLRSPLPPEPAR
FT                   PGGPGRQLHSKAGAQTAVTRFAKHGRQVVRSQVQQDAQSAGGSRLQVQQKQQLQGINVC
FT                   GGQCCHGWSKPPGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGSKGKACEITAAQDTVP
FT                   PAFGGQNPGSSWAPLEQAAKHTSTKKADTLPRVSPVAQMTLTLKPKPSMGLSQQIHPQV
FT                   APLSSQNVMIRHGQTQEYLLKPKYFPAPKVVSAEQSTEGSFSLRYGQEQGTAPFQVSNH
FT                   TGRIKVVFTPSICKVTCTKGNCQNSCQKGNTTTLISENGHAADTLTATNFRVVICHLPC
FT                   MNGGQCSSRDKCQCPPNFTGKLCQIPVLGASMPKLYQHAQQQGKALGSHVIHSTHTLPL
FT                   TMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDSPGGQKVKEAQPGQSQVSYQG
FT                   LPVQKTQTVHSTYSHQQLIPHVYPVAAKTQLGRCFQETIGSQQCGKALPGLSKQEDCCG
FT                   TVGTSWGFNKCQKCPKKQSYHGYTQMMECLQGYKRVNNTFCQDINECQLQGVCPNGECL
FT                   NTMGSYRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYRLVSPGRHCMHPLSVHLTKQI
FT                   CCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHQHIGKEAVYVKPK
FT                   NTQPVAKSTHPPPLPAKEEPVEALTSSWEHGPRGAEPEVVTAPPEKEIPSLDQEKTRLE
FT                   PGQPQLSPGVSTIHLHPQFPVVVEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECT
FT                   VNPDICGAGHCINLPVRYTCICYEGYKFSEQLRKCVDIDECAQVRHLCSQGRCENTEGS
FT                   FLCVCPAGFMASEEGTNCIDVDECLRPDMCRDGRCINTAGAFRCEYCDSGYRMSRRGYC
FT                   EDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGFRGWNGQCLDVDECLQPKVCTNGSCTN
FT                   LEGSYMCSCHRGYSPTPDHRHCQDIDECQQGNLCMNGQCRNTDGSFRCTCGQGYQLSAA
FT                   KDQCEDIDECEHHHLCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLEDSSVCQ
FT                   GGDCINTAGSYDCTCPDGFQLNDNKGCQDINECAQPGLCGSHGECLNTQGSFHCVCEQG
FT                   FSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECE
FT                   LLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYY
FT                   NLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPA
FT                   GESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMD
FT                   ECQDPNSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTESNEQIEETDVYQDLCWE
FT                   HLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRP
FT                   YGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCD
FT                   CFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYIPSDKPNYC
FT                   TPLNSALNLDKESDLE"
FT   CDS             join(18661740..18662215,18663183..18663253,
FT                   18664272..18664297)
FT                   /codon_start=1
FT                   /gene="Ltbp1"
FT                   /locus_tag="mCG_120941"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG120941.1 transcript_id=mCT170878.0
FT                   protein_id=mCP93796.0 isoform=CRA_a"
FT                   /protein_id="EDL38444.1"
FT                   /translation="MAGAWLRWGLLLWAGLLAWSAHGRVRRITYVVRPGPGLPAGALPL
FT                   AGPPRTFNVALDARYSRSSTAASSRALAGPPAERTRRTSQPGGAALPGLRSPLPPEPAR
FT                   PGGPGRQLHSKAGAQTAVTRFAKHGRQVVRSQVQQDAQSAGGSRLQVQQKQQLQGINVC
FT                   GGQCCHGWSKPPGSQRCTKRLQTPSAP"
FT   gene            19087933..19182890
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /note="gene_id=mCG11038.2"
FT   mRNA            join(19087933..19088183,19143642..19143844,
FT                   19146032..19146134,19148267..19148329,19148825..19148956,
FT                   19150269..19150446,19152525..19152641,19154982..19155257,
FT                   19161587..19161664,19163810..19163926,19165924..19166039,
FT                   19168163..19168310,19178010..19178046,19178327..19178452,
FT                   19178752..19179113,19180704..19182890)
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, transcript
FT                   variant mCT11160"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT11160.2 created
FT                   on 18-SEP-2002"
FT   mRNA            join(19117550..19117592,19140701..19140833,
FT                   19143642..19143844,19146032..19146134,19148267..19148329,
FT                   19148825..19148956,19150269..19150416,19151944..19152117,
FT                   19152525..19152641,19154982..19155257,19161587..19161664,
FT                   19163813..19163926,19165924..19166039,19168163..19168310,
FT                   19178010..19178046,19178327..19178452,19178752..19179113,
FT                   19180704..19182890)
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, transcript
FT                   variant mCT173269"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT173269.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(19143775..19143844,19146032..19146134,
FT                   19148267..19148329,19148825..19148956,19150269..19150446,
FT                   19152525..19152641,19154982..19155257,19161587..19161664,
FT                   19163810..19163926,19165924..19166039,19168163..19168310,
FT                   19178010..19178046,19178327..19178452,19178752..19179113,
FT                   19180704..19180712)
FT                   /codon_start=1
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT11160.2
FT                   protein_id=mCP20445.2 isoform=CRA_a"
FT                   /protein_id="EDL38446.1"
FT                   /translation="MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWY
FT                   LSSTELAGKLLCMYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFRE
FT                   VASQLGHEKHISLMDISSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFL
FT                   EHKSFRRISVRNLTVILPRKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKN
FT                   WNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVK
FT                   MHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQ
FT                   PTSPTTPNKPVVPLEWASEVVPKPDPTIINKHIRKLVESVFRNYDHDHDGYISQEDFES
FT                   IAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMNYLKPT
FT                   FCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPGSLPGSPA
FT                   LPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAV
FT                   WGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTVQAGVDVVDRGTAFEPDQDDGQDE
FT                   AKQGGEDG"
FT   CDS             join(19143775..19143844,19146032..19146134,
FT                   19148267..19148329,19148825..19148956,19150269..19150416,
FT                   19151944..19152117,19152525..19152641,19154982..19155257,
FT                   19161587..19161664,19163813..19163926,19165924..19166039,
FT                   19168163..19168310,19178010..19178046,19178327..19178452,
FT                   19178752..19179113,19180704..19180712)
FT                   /codon_start=1
FT                   /gene="Rasgrp3"
FT                   /locus_tag="mCG_11038"
FT                   /product="RAS, guanyl releasing protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG11038.2 transcript_id=mCT173269.0
FT                   protein_id=mCP96188.0 isoform=CRA_b"
FT                   /protein_id="EDL38447.1"
FT                   /translation="MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWY
FT                   LSSTELAGKLLCMYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFRE
FT                   VASQLGHEKHISLMDISSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFL
FT                   EHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVI
FT                   TKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSN
FT                   GNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSEL
FT                   VSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPNKPVV
FT                   PLEWASEVVPKPDPTIINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFC
FT                   VLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGI
FT                   IKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFP
FT                   GVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKM
FT                   KSKFHDKAAKDKGFAKWENEKPTVQAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG"
FT   gene            complement(19190954..19205533)
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /note="gene_id=mCG11040.1"
FT   mRNA            complement(join(19190954..19192723,19192809..19192976,
FT                   19193263..19193379,19193973..19194053,19195058..19195242,
FT                   19198610..19198744,19201473..19201621,19205395..19205533))
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, transcript variant
FT                   mCT11162"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT11162.2 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(19190955..19192976,19193263..19193379,
FT                   19193973..19194053,19195058..19195242,19198610..19198744,
FT                   19201473..19201621,19205395..>19205518))
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, transcript variant
FT                   mCT193680"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT193680.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(19192064..19192723,19192809..19192976,
FT                   19193263..19193379,19193973..19194053,19195058..19195242,
FT                   19198610..19198744,19201473..19201621,19205395..19205447))
FT                   /codon_start=1
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, isoform CRA_a"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT11162.2
FT                   protein_id=mCP20446.2 isoform=CRA_a"
FT                   /protein_id="EDL38448.1"
FT                   /translation="MECDLMETDILESLEDLGYKGPLLDDGALLQAVSAGAASPEFTKL
FT                   CAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYPSLTSGDVTKRLLV
FT                   EKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANIT
FT                   MFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLL
FT                   IKRLDVTVQSFGWSDRAKSQTDKLAKVYQPKRSLLSPKGKVSVAHLLAARQDLSKILRT
FT                   SSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQAGGRGGGR
FT                   GGYEHSSYGGRGGHEQGGRGGRGSYDHGGRGGGRGNKHQGGWTDGGSGSGGGYQDGAYR
FT                   DSGFQPGGYHGGHSGGYQAGGYGGFQTSSYTGSGYQGGGYQQDNRYQDGGHHGERGSGR
FT                   GGRGGRGGRGGRGSQGGGWGGRGSQTYHQGGQFEQHFQHGGYQYSHSGFGQGRHYTS"
FT   CDS             complement(join(19192770..19192976,19193263..19193379,
FT                   19193973..19194053,19195058..19195242,19198610..19198744,
FT                   19201473..19201621,19205395..>19205507))
FT                   /codon_start=1
FT                   /gene="2810405J04Rik"
FT                   /locus_tag="mCG_11040"
FT                   /product="RIKEN cDNA 2810405J04, isoform CRA_b"
FT                   /note="gene_id=mCG11040.1 transcript_id=mCT193680.0
FT                   protein_id=mCP114625.0 isoform=CRA_b"
FT                   /protein_id="EDL38449.1"
FT                   /translation="GTRCRREGSLTTRKFEYHSSMECDLMETDILESLEDLGYKGPLLD
FT                   DGALLQAVSAGAASPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLG
FT                   EMNCPYPSLTSGDVTKRLLVEKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVF
FT                   QELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWE
FT                   KIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTDKLAKVYQPKRSLLSPKG
FT                   KVSVAHLLAARQDLSKILRTSSGSIREKTACAINKVTRVLLIFFPMH"
FT   gene            19316644..19317630
FT                   /pseudo
FT                   /locus_tag="mCG_50080"
FT                   /note="gene_id=mCG50080.2"
FT   mRNA            19316644..19317630
FT                   /pseudo
FT                   /locus_tag="mCG_50080"
FT                   /note="gene_id=mCG50080.2 transcript_id=mCT50263.2 created
FT                   on 05-NOV-2002"
FT   gene            19491612..19492092
FT                   /pseudo
FT                   /locus_tag="mCG_1039334"
FT                   /note="gene_id=mCG1039334.1"
FT   mRNA            19491612..19492092
FT                   /pseudo
FT                   /locus_tag="mCG_1039334"
FT                   /note="gene_id=mCG1039334.1 transcript_id=mCT157038.1
FT                   created on 05-NOV-2002"
FT   gene            19518908..19547007
FT                   /locus_tag="mCG_1039549"
FT                   /note="gene_id=mCG1039549.1"
FT   mRNA            join(19518908..19519205,19519397..19519498,
FT                   19535872..19535977,19544127..19544320,19546531..19547007)
FT                   /locus_tag="mCG_1039549"
FT                   /product="mCG1039549"
FT                   /note="gene_id=mCG1039549.1 transcript_id=mCT157253.1
FT                   created on 22-APR-2003"
FT   CDS             join(19544242..19544320,19546531..19546700)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039549"
FT                   /product="mCG1039549"
FT                   /note="gene_id=mCG1039549.1 transcript_id=mCT157253.1
FT                   protein_id=mCP71316.1"
FT                   /protein_id="EDL38450.1"
FT                   /translation="MSSTFQGFISQILMELTEEFSASIISGGGKQISQLQKHTGISISE
FT                   IIISISTGNCSKSFWTNCLSSGFHGSDIRRSLNYKFW"
FT   gene            complement(19937167..19937918)
FT                   /locus_tag="mCG_16218"
FT                   /note="gene_id=mCG16218.0"
FT   mRNA            complement(19937167..19937918)
FT                   /locus_tag="mCG_16218"
FT                   /product="mCG16218"
FT                   /note="gene_id=mCG16218.0 transcript_id=mCT16232.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(19937394..19937840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16218"
FT                   /product="mCG16218"
FT                   /note="gene_id=mCG16218.0 transcript_id=mCT16232.0
FT                   protein_id=mCP8447.1"
FT                   /protein_id="EDL38451.1"
FT                   /translation="MQTAHTGLSHTADGADGQTSLCCPGNAGTKAVIPSGAHPVARALE
FT                   ASRNSSKRTVPLTQRPRIGHHRFALFVPFPTSLEAEIACGSLVPDVEPHRGLVGKELKV
FT                   RGCVLEVCWITEVSCLLRISIINFLDQLSLAVNTIQLFGPPVSY"
FT   gene            complement(20587611..20588770)
FT                   /locus_tag="mCG_1050357"
FT                   /note="gene_id=mCG1050357.0"
FT   mRNA            complement(20587611..20588770)
FT                   /locus_tag="mCG_1050357"
FT                   /product="mCG1050357"
FT                   /note="gene_id=mCG1050357.0 transcript_id=mCT194363.0
FT                   created on 23-APR-2004"
FT   CDS             complement(20587799..20588314)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050357"
FT                   /product="mCG1050357"
FT                   /note="gene_id=mCG1050357.0 transcript_id=mCT194363.0
FT                   protein_id=mCP115392.0"
FT                   /protein_id="EDL38452.1"
FT                   /translation="MCSNVCVCVCVCVCVCVCVCVCVCLCVSVSGMSDMYACVYVYVCM
FT                   YVCMYVHMYVCMYVCMYVYVCVCLCVCVFVCVCVVSVVCVYAFVYMCICVSMCFCQWNE
FT                   WHVCMCMYVDMCVVFMCLCIRGKCGVCACVSVCVCLCTSLYKYLCLYVGICILRHCCVS
FT                   MFIEKKTV"
FT   gene            complement(21014574..21015418)
FT                   /pseudo
FT                   /locus_tag="mCG_49156"
FT                   /note="gene_id=mCG49156.2"
FT   mRNA            complement(21014574..21015418)
FT                   /pseudo
FT                   /locus_tag="mCG_49156"
FT                   /note="gene_id=mCG49156.2 transcript_id=mCT49339.2 created
FT                   on 28-OCT-2002"
FT   gene            21772093..21772660
FT                   /pseudo
FT                   /locus_tag="mCG_57490"
FT                   /note="gene_id=mCG57490.2"
FT   mRNA            21772093..21772660
FT                   /pseudo
FT                   /locus_tag="mCG_57490"
FT                   /note="gene_id=mCG57490.2 transcript_id=mCT57673.2 created
FT                   on 05-NOV-2002"
FT   gene            complement(21840588..21841151)
FT                   /pseudo
FT                   /locus_tag="mCG_2763"
FT                   /note="gene_id=mCG2763.2"
FT   mRNA            complement(21840588..21841151)
FT                   /pseudo
FT                   /locus_tag="mCG_2763"
FT                   /note="gene_id=mCG2763.2 transcript_id=mCT1968.2 created on
FT                   05-NOV-2002"
FT   gene            <21863373..22039722
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /note="gene_id=mCG140969.0"
FT   mRNA            join(<21863373..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010297..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035838..22035905,22037214..22039722)
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), transcript variant mCT172470"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT172470.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<21863374..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010297..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035838..22035905,22037214..22037369)
FT                   /codon_start=1
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), isoform CRA_a"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT172470.0
FT                   protein_id=mCP95389.0 isoform=CRA_a"
FT                   /protein_id="EDL38453.1"
FT                   /translation="ARERAEPGTRNGRHGPSAEPPRPLGGSGGGDRPGGCAAVVFPRQS
FT                   GAARRTRRSHQPFFGAVRSHRRRQKFGLNRSCREETFFPLFPLPPGRRRRRRGSHPPPL
FT                   PLAPTLVGSGSARPAGAAGASPREGRSAPGAPSGARGPRAAGAAAARVPRAGEGARPAP
FT                   GPTARRRRRRRRMYLVAGGRGLAGCGHLSVSLLGLLLLLARSGTRALVCLPCDESKCEE
FT                   PRSCPGSIVQGVCGCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITEYEV
FT                   GVCEDEDWDDDQLIGFEPCNENLISGCNIINGKCECGTIRTCNNPFEFPRKDMCLSALK
FT                   RIEEEKPDCSKARCEVRFSPRCPEDSILIEGYAPPGECCPLPSRCVCDPAGCLRKVCQP
FT                   GYLNILVSKASGKPGECCDLYECKPVFSVDCSTVECPPVQQAVCPLDSYETQVRLTADG
FT                   CCTLPARCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNSVE
FT                   YYDGDMFRMDNCRFCRCQGGVSICFTAQCGELNCERYYVPEGECCPVCEDPIYPLNNPA
FT                   GCYANGQIRAHGDRWREDDCTFCQCINGEPHCVATACGQSCMHPVKVPGECCPVCEEPT
FT                   YITIDPPACGELSNCSLKEKDCVYGFKLDHNGCRTCQCKIREELCLGLKRACTLDCPFG
FT                   FLTDVHNCELCQCRPRPKKCRPTMCDKFCPLGFLKNKHGCDICRCKKCPELPCSKICPL
FT                   GFQQDSHGCLICKCRGTCLSMDGHHHKNEESWHDGCRECYCHNGKEMCALITCPVPACG
FT                   NPTIRSGQCCPSCTDDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRV
FT                   LCETEVCPPLLCQNPSRTQDSCCPQCTDDPPQPSTSHNESVPSYCRNDEGDIFLAAESW
FT                   KPDACTSCVCVDSAISCYSESCPSVACERPVLRKGQCCPYCLEDTIPKKVVCHFSGKTY
FT                   ADEERWDIDSCTHCYCLQGQTLCSTVSCPPLPCAEPIKVEGSCCPMCPEMYVPEPTNVP
FT                   IEKKNHRGEIDLEVPMWPTPSENDIIHLPRAFLLINQKKQWVPLLCWYRTPTKLVSVDC
FT                   KKGTRVQVDGPQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV"
FT   mRNA            join(<21863926..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010261..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035715..22035905,22037193..22038276)
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), transcript variant mCT193662"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT193662.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<21863926..21864229,21900856..21901029,
FT                   21942914..21943156,21944187..21944307,21966091..21966212,
FT                   21976228..21976410,21978653..21978850,21998411..21998539,
FT                   22007534..22007690,22009045..22009166,22010261..22010470,
FT                   22013833..22014048,22018105..22018326,22030938..22031132,
FT                   22033141..22033263,22035715..22035905,22037193..22037369)
FT                   /codon_start=1
FT                   /gene="Crim1"
FT                   /locus_tag="mCG_140969"
FT                   /product="cysteine rich transmembrane BMP regulator 1
FT                   (chordin like), isoform CRA_b"
FT                   /note="gene_id=mCG140969.0 transcript_id=mCT193662.0
FT                   protein_id=mCP114642.0 isoform=CRA_b"
FT                   /protein_id="EDL38454.1"
FT                   /translation="LAGCGHLSVSLLGLLLLLARSGTRALVCLPCDESKCEEPRSCPGS
FT                   IVQGVCGCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITEYEVGVCEDED
FT                   WDDDQLIGFEPCNENLISGCNIINGKCECGTIRTCNNPFEFPRKDMCLSALKRIEEEKP
FT                   DCSKARCEVRFSPRCPEDSILIEGYAPPGECCPLPSRCVCDPAGCLRKVCQPGYLNILV
FT                   SKASGKPGECCDLYECKPVFSVDCSTVECPPVQQAVCPLDSYETQVRLTADGCCTLPAR
FT                   CECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNSVEYYDGDMF
FT                   RMDNCRFCRCQGGVSICFTAQCGELNCERYYVPEGECCPVCEDPIYPLNNPAGCYANGQ
FT                   IRAHGDRWREDDCTFCQCINGEPHCVATACGQSCMHPVKVPGECCPVCEEPTYITIDPP
FT                   ACGELSNCSLKEKDCVYGFKLDHNGCRTCQCKIREELCLGLKRACTLDCPFGFLTDVHN
FT                   CELCQCRPRPKKCRPTMCDKFCPLGFLKNKHGCDICRCKKCPELPCSKICPLGFQQDSH
FT                   GCLICKCREVPPSAGPPVLSGTCLSMDGHHHKNEESWHDGCRECYCHNGKEMCALITCP
FT                   VPACGNPTIRSGQCCPSCTDDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTC
FT                   HSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDDPPQPSTSHNESVPSYCRNDEGDIFL
FT                   AAESWKPDACTSCVCVDSAISCYSESCPSVACERPVLRKGQCCPYCLEDTIPKKVVCHF
FT                   SGKTYADEERWDIDSCTHCYCLQGQTLCSTVSCPPLPCAEPIKVEGSCCPMCPEMYVPE
FT                   PTNVPIEKKNHRGEIDLEVPMWPTPSENDIIHLPRDMGHLQVDYRDNNRLHPGEDSSLD
FT                   SIVSVVVPIIICLSIIIAFLLINQKKQWVPLLCWYRTPTKPSSLNNQLVSVDCKKGTRV
FT                   QVDGPQRMLRIAEPDARFSGFYSMQKQNHLQADNFYQTV"
FT   gene            complement(22041018..>22081236)
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /note="gene_id=mCG2768.2"
FT   mRNA            complement(join(22041018..22041568,22047845..22047920,
FT                   22063753..22064021,22065854..22065995,22067842..22067958,
FT                   22075978..22076086,22080974..>22081199))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT193693"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193693.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(22041022..22041884,22044720..22044785,
FT                   22047845..22047920,22050090..22050170,22063753..22064021,
FT                   22065854..22065995,22067842..22067958,22075978..22076086,
FT                   22080974..>22081227))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT1961"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT1961.2 created on
FT                   19-SEP-2002"
FT   mRNA            complement(join(22041027..22041884,22044720..22044785,
FT                   22047845..22047920,22063753..22064021,22065854..22065995,
FT                   22067842..22067958,22075978..22076086,22080974..>22081236))
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), transcript variant mCT193694"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193694.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(22041537..22041568,22047845..22047920,
FT                   22063753..22064021,22065854..22065995,22067842..22067958,
FT                   22075978..22076086,22080974..>22081197))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_a"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193693.0
FT                   protein_id=mCP114658.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6P395"
FT                   /db_xref="InterPro:IPR011680"
FT                   /db_xref="InterPro:IPR015641"
FT                   /db_xref="MGI:MGI:2675856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P395"
FT                   /protein_id="EDL38455.1"
FT                   /translation="FYEFQEPAGSVQEQENCNASPEAGAGAHAGGDSFPALASSLEEKL
FT                   SLCFRPTSEAEPPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLT
FT                   LNLSEKGMNDGLLFDASDEEELREQLDMHSIIVSCVNEEPLFTADQVIEEIEEMMQESP
FT                   DPEDDETPTQSDRLSMLSQEIQTLKRSSMSSYEERVKRLSVSELNELLEEIEAAIKQYS
FT                   EELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKKLKSGSSQNGRSER
FT                   SHMPGTYLTTVIPYEKKSGPPSVEDLQILTKMWLSVLNSSI"
FT   CDS             complement(join(22041868..22041884,22044720..22044785,
FT                   22047845..22047920,22063753..22064021,22065854..22065995,
FT                   22067842..22067958,22075978..22076086,22080974..>22081236))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_b"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT193694.0
FT                   protein_id=mCP114659.0 isoform=CRA_b"
FT                   /protein_id="EDL38456.1"
FT                   /translation="AAGAMAADGDWQDFYEFQEPAGSVQEQENCNASPEAGAGAHAGGD
FT                   SFPALASSLEEKLSLCFRPTSEAEPPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVD
FT                   WKSSHTRTLHLLTLNLSEKGMNDGLLFDASDEEELREQLDMHSIIVSCVNEEPLFTADQ
FT                   VIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSMSSYEERVKRLSVSELNE
FT                   LLEEIEAAIKQYSEELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKK
FT                   LKSGSSQNGRSERSHMPGTYLTTVIPYEKKSGPPSVEDLQILTKILHAMKEDSEKVPSL
FT                   LTDYILKVLCPT"
FT   CDS             complement(join(22041868..22041884,22044720..22044785,
FT                   22047845..22047920,22050090..22050170,22063753..22064021,
FT                   22065854..22065995,22067842..22067958,22075978..22076086,
FT                   22080974..>22081227))
FT                   /codon_start=1
FT                   /gene="Fez2"
FT                   /locus_tag="mCG_2768"
FT                   /product="fasciculation and elongation protein zeta 2
FT                   (zygin II), isoform CRA_c"
FT                   /note="gene_id=mCG2768.2 transcript_id=mCT1961.2
FT                   protein_id=mCP2872.2 isoform=CRA_c"
FT                   /protein_id="EDL38457.1"
FT                   /translation="AMAADGDWQDFYEFQEPAGSVQEQENCNASPEAGAGAHAGGDSFP
FT                   ALASSLEEKLSLCFRPTSEAEPPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDWKS
FT                   SHTRTLHLLTLNLSEKGMNDGLLFDASDEEELREQLDMHSIIVSCVNEEPLFTADQVIE
FT                   EIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSMSSYEERVKRLSVSELNELLE
FT                   EIEAAIKQYSEELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKKLKS
FT                   GSSQNGRSERSHMPGTRFSMEGISNVIQNGLRHTFGNSGGEKQYLTTVIPYEKKSGPPS
FT                   VEDLQILTKILHAMKEDSEKVPSLLTDYILKVLCPT"
FT   gene            22156428..22159013
FT                   /locus_tag="mCG_128529"
FT                   /note="gene_id=mCG128529.1"
FT   mRNA            join(22156428..22156550,22157158..22159013)
FT                   /locus_tag="mCG_128529"
FT                   /product="mCG128529"
FT                   /note="gene_id=mCG128529.1 transcript_id=mCT129825.1
FT                   created on 22-APR-2003"
FT   CDS             join(22156445..22156550,22157158..22158500)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128529"
FT                   /product="mCG128529"
FT                   /note="gene_id=mCG128529.1 transcript_id=mCT129825.1
FT                   protein_id=mCP70835.1"
FT                   /db_xref="GOA:D3YYI8"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="MGI:MGI:3704479"
FT                   /db_xref="UniProtKB/TrEMBL:D3YYI8"
FT                   /protein_id="EDL38458.1"
FT                   /translation="MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNY
FT                   GLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFD
FT                   GLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVDDIVLAIPEL
FT                   LKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYY
FT                   AVNYPLRDGIDDESYEATFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGH
FT                   AKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPD
FT                   FKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEE
FT                   DPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKE
FT                   VTEEEKTKEEKPEAKGVKEEVKLA"
FT   gene            <22173573..22295879
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /note="gene_id=mCG128538.2"
FT   mRNA            join(<22173573..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293335,22295233..22295879)
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, transcript variant mCT193690"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT193690.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(22173573..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293334,22295233..22295879)
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, transcript variant mCT129836"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT129836.1
FT                   created on 30-AUG-2002"
FT   CDS             join(<22173694..22173726,22203091..22203160,
FT                   22213752..22213817,22234570..22234726,22242458..22242591,
FT                   22247594..22247671,22255175..22255360,22268080..22268124,
FT                   22269937..22269999,22273552..22273699,22287608..22287711,
FT                   22290704..22290930,22292822..22293335,22295233..22295339)
FT                   /codon_start=1
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, isoform CRA_b"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT193690.0
FT                   protein_id=mCP114638.0 isoform=CRA_b"
FT                   /protein_id="EDL38460.1"
FT                   /translation="GGKNPLLSSNKGAILIFMGIVVLTMKASVIEVLLVLLVTGIHSNK
FT                   ETPKKTKRPKLTVPQINCDVKAGKIINPEFMVKCPAGCQDPKYHVYGTGVYASYSSVCG
FT                   AAIHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVAESKPQKGVAY
FT                   PSTLTYSSSKTAAAKAGETTKAYEKPSIPGTTIQPVTLTQAQATPVAEVTHRSTSKPFA
FT                   ASVTNSPRPQPVGHRSQEMEEVDGWKPGPVLLDSGFVPKEELSTQSSEPVPQGDPNCKI
FT                   DLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHM
FT                   NSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKV
FT                   EEVSRVARESGINVFFITVEGAAEREKQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHK
FT                   TVQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSVGTSNFRTVLQFVANLSKEFEIS
FT                   DTDTRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFK
FT                   KSKPNKRKVMIIITDGRSYDDVRIPAMAAYQKGGDHVCNRHCVGCSGRAGGNGHSPRQG
FT                   PFLLCGRF"
FT   CDS             join(22203109..22203160,22213752..22213817,
FT                   22234570..22234726,22242458..22242591,22247594..22247671,
FT                   22255175..22255360,22268080..22268124,22269937..22269999,
FT                   22273552..22273699,22287608..22287711,22290704..22290930,
FT                   22292822..22293334,22295233..22295412)
FT                   /codon_start=1
FT                   /gene="Vit"
FT                   /locus_tag="mCG_128538"
FT                   /product="vitrin, isoform CRA_a"
FT                   /note="gene_id=mCG128538.2 transcript_id=mCT129836.1
FT                   protein_id=mCP71119.1 isoform=CRA_a"
FT                   /protein_id="EDL38459.1"
FT                   /translation="MGIVVLTMKASVIEVLLVLLVTGIHSNKETPKKTKRPKLTVPQIN
FT                   CDVKAGKIINPEFMVKCPAGCQDPKYHVYGTGVYASYSSVCGAAIHSGVLDNSGGKILV
FT                   RKVAGQSGYKGSYSNGVQSLSLPRWRESFIVAESKPQKGVAYPSTLTYSSSKTAAAKAG
FT                   ETTKAYEKPSIPGTTIQPVTLTQAQATPVAEVTHRSTSKPFAASVTNSPRPQPVGHRSQ
FT                   EMEEVDGWKPGPVLLDSGFVPKEELSTQSSEPVPQGDPNCKIDLSFLIDGSTSIGKRRF
FT                   RIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEKITQRGG
FT                   LSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFI
FT                   TVEGAAEREKQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVCDTDRLAC
FT                   SKTCLNSADIGFVIDGSSSVGTSNFRTVLQFVANLSKEFEISDTDTRVGAVQYTYEQRL
FT                   EFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMIIITDGR
FT                   SYDDVRIPAMAAYQKGVITYAIGIAWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPR
FT                   IIQNICTEFNSQPRN"
FT   gene            complement(22318373..22320556)
FT                   /locus_tag="mCG_148337"
FT                   /note="gene_id=mCG148337.0"
FT   mRNA            complement(join(22318373..22319517,22319547..22320556))
FT                   /locus_tag="mCG_148337"
FT                   /product="mCG148337"
FT                   /note="gene_id=mCG148337.0 transcript_id=mCT188600.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22318711..22318860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148337"
FT                   /product="mCG148337"
FT                   /note="gene_id=mCG148337.0 transcript_id=mCT188600.0
FT                   protein_id=mCP108817.0"
FT                   /protein_id="EDL38461.1"
FT                   /translation="MSTLPAFSSSFGWCWPLVRKQIEPPSRYFYFRLRRVPHSRPSYMI
FT                   QCLF"
FT   gene            complement(22323601..>22415666)
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /note="gene_id=mCG2766.2"
FT   mRNA            complement(join(22323601..22324066,22324156..22324242,
FT                   22326039..22326146,22336162..22336302,22338324..22338491,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT1959"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT1959.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(22323638..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22331406..22331453,22332964..22333139,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT170902"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170902.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(22323638..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..>22415666))
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, transcript
FT                   variant mCT170901"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170901.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22323897..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22331406..22331453,22332964..22333139,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170902.0
FT                   protein_id=mCP93820.0 isoform=CRA_a"
FT                   /protein_id="EDL38462.1"
FT                   /translation="MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARA
FT                   QYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKM
FT                   LEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLR
FT                   QYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKS
FT                   ELTDSASVLDNFKFLESAAADFSDEDEDEDTDGRAKSVIDTSTIVRKKALPDTSEDRDT
FT                   KEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKER
FT                   KGKKGVKRPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEQELSRADEVEAL
FT                   TFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFT
FT                   LRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKG
FT                   PVLCVVMSSNGEQCYSGGTDGRIQSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLA
FT                   YSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDNQASSSSCQINRVISHPTLPISITA
FT                   HEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCI
FT                   QEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV"
FT   CDS             complement(join(22323897..22324066,22324156..22324242,
FT                   22326039..22326146,22328389..22328556,22330107..22330228,
FT                   22342196..22342243,22343771..22343946,22346310..22346446,
FT                   22348932..22349075,22351788..22351898,22356490..22356625,
FT                   22362027..22362162,22363429..22363596,22366791..22366869,
FT                   22371562..22371635,22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT170901.0
FT                   protein_id=mCP93819.0 isoform=CRA_b"
FT                   /protein_id="EDL38463.1"
FT                   /translation="MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARA
FT                   QYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKM
FT                   LEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLR
FT                   QYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKS
FT                   ELTDSASVLDNFKFLESAAADFSDEDEDEDTDGRAKSVIDTSTIVRKKALPDTSEDRDT
FT                   KEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKER
FT                   KGKKGVKRPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEQELSRADEVEAL
FT                   TFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFT
FT                   LRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKG
FT                   PVLCVVMSSNGEQCYSGGTDGRIQSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLA
FT                   YSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDNQASSSSCQINRVISHPTLPISITA
FT                   HEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCI
FT                   QEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV"
FT   CDS             complement(join(22338362..22338491,22342196..22342243,
FT                   22343771..22343946,22346310..22346446,22348932..22349075,
FT                   22351788..22351898,22356490..22356625,22362027..22362162,
FT                   22363429..22363596,22366791..22366869,22371562..22371635,
FT                   22379989..22380092,22415433..22415666))
FT                   /codon_start=1
FT                   /gene="Strn"
FT                   /locus_tag="mCG_2766"
FT                   /product="striatin, calmodulin binding protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2766.2 transcript_id=mCT1959.2
FT                   protein_id=mCP2888.2 isoform=CRA_c"
FT                   /protein_id="EDL38464.1"
FT                   /translation="MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARA
FT                   QYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKM
FT                   LEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLR
FT                   QYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKS
FT                   ELTDSASVLDNFKFLESAAADFSDEDEDEDTDGRAKSVIDTSTIVRKKALPDTSEDRDT
FT                   KEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKER
FT                   KGKKGVKRPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEQELSRADEVEAL
FT                   TFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFT
FT                   LRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKS
FT                   FGSKRPSTGPHGRGVGAGLQCGTPALALLLSRRHSSLMEYN"
FT   gene            complement(22428119..22429889)
FT                   /locus_tag="mCG_2767"
FT                   /note="gene_id=mCG2767.1"
FT   mRNA            complement(22428119..22429889)
FT                   /locus_tag="mCG_2767"
FT                   /product="mCG2767"
FT                   /note="gene_id=mCG2767.1 transcript_id=mCT1960.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(22429426..22429734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2767"
FT                   /product="mCG2767"
FT                   /note="gene_id=mCG2767.1 transcript_id=mCT1960.1
FT                   protein_id=mCP2894.2"
FT                   /db_xref="GOA:Q9D8A9"
FT                   /db_xref="InterPro:IPR013544"
FT                   /db_xref="MGI:MGI:2444098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8A9"
FT                   /protein_id="EDL38465.1"
FT                   /translation="MWLLLGIYPEDAPTCKKDTCSPMFIAALFIIARSWKGPRCPSTEE
FT                   WIQKMWYIYTTEYYSAIKNTEFMKFLGKWMELENIILSEVTQSQKNTNSMHSLISGY"
FT   gene            complement(22431955..22513178)
FT                   /locus_tag="mCG_1040528"
FT                   /note="gene_id=mCG1040528.1"
FT   mRNA            complement(join(22431955..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22453537..22453671,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22513119..22513178))
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, transcript variant mCT129835"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT129835.1
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(22431955..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22452867..22453046,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22512697..>22512822))
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, transcript variant mCT161026"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT161026.2
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(22432128..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22452867..22453046,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512109,22512697..>22512821))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, isoform CRA_b"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT161026.2
FT                   protein_id=mCP90021.2 isoform=CRA_b"
FT                   /protein_id="EDL38467.1"
FT                   /translation="VPVGPASADQNPTVTLLGPGGEGRVAEKAPQTPELGASGFSGCEL
FT                   RTSIMELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQ
FT                   LTGLISSSPGPPTRKLLAKNLAALYSIGDTYTVFQTLDKCNDIIRSKDDTAAYLPTKLA
FT                   AVACVGAFYEKMGRMLGSAFPETVNNLLKSLKSAESQGRSEILMSLQKVLTGLGGAAAS
FT                   SHRDIYKNARSLLTDRSMAVRCAVAKAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPR
FT                   ATQTHVDAVYSRRCVSFMLRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSS
FT                   ENKSGTADIAASQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMA
FT                   ARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSGYSFAMAALLGGVHQCP
FT                   LGIPHAKGKMVVSIAEDLLRTAAQNSRLSLQRTQAGWLLLGALMTLGPSVVRYHLPKML
FT                   LLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALCAMRSFVAHCPELLTEDAIRKL
FT                   MTPIECAMTMMSHIPSVIKAHGAHLKASAAMVRLRLYDILALLPPKTYEGSFNALLREL
FT                   VAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEH
FT                   DPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQA
FT                   KGVRQQAVQLNIFTAVLSALKGLAENKSTLGPEEVRKSALTLVMGALDNPNPILRCAAG
FT                   EALGRMAQVVGEASFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHL
FT                   KTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPS
FT                   HTEVHQCLGRCLGAIITTVGPELQGNAATISTIRSSCLVGCAITQDHSDSLVQAAAISC
FT                   LQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREAAEVCEYAMSLA
FT                   KNAGDKEISGGNVNPFTPGVSSRSDVHCRHQGVNITDTGLEGLLFGMLDRETDRKLCSD
FT                   IHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSGTYECSHTLKQGKDEESEKKDEMDDDA
FT                   MFTTLGEEDKSKPFVAPRWATRVFAADCLCRIINLCENSDQAHFDLALARSAKLRNPKN
FT                   DLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQA
FT                   NVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDTVQAGK
FT                   GSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEAESKPKRAMNNPDDDDDDYGTID
FT                   ELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGAFYTPETIDTAR
FT                   LHYRNSWAPILHAVALWLNSTGFISQESTEATTVSGVQKRSPAVSLNQVPGAMASAKPL
FT                   PEVNKDRMHLILDEEDMEKESCPTLGEGGDTGGLIPGKSLVFATMELLMFILVRHMPHL
FT                   STKMLDSPSHTAMKTQLSEESARLVAATVAILSDLPSLCSPAGCMTILPTILFLIARIL
FT                   KDTAIKSADNQVPPPVSAALQGIKSIVTLSMAKTEDTQKQWTTLIRSTLACILEYSQPD
FT                   DCMPAPDEVSTLTAIALFLWSASSEIIGVQSLQNGCMNRFKSALNSCDPWHSNRALSTP
FT                   YIHSLAPLVVGKLKAVERHRPASSTELLAVQEGIKVLETLVALGEEQNRVQLLALLVPT
FT                   LISYLLDENSFASASSISKDLHEFALQNLMHIGPLYPHAFKTVMGAAPELKARLETAVR
FT                   ASQASKAKAAARQPAPTTHSTPTIKLKTSFF"
FT   CDS             complement(join(22432128..22432432,22434311..22434482,
FT                   22435971..22436122,22439502..22439726,22440967..22441233,
FT                   22445904..22446158,22447397..22447634,22453537..22453671,
FT                   22466199..22466267,22469303..22469484,22472967..22473217,
FT                   22473630..22473873,22474196..22474340,22479386..22479555,
FT                   22481145..22481334,22483718..22483877,22486107..22486297,
FT                   22488285..22488390,22490875..22491050,22491823..22491986,
FT                   22493242..22493351,22493984..22494083,22495324..22495476,
FT                   22496648..22496759,22498479..22498729,22499273..22499428,
FT                   22502415..22502664,22507415..22507564,22508429..22508537,
FT                   22509243..22509454,22511962..22512087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040528"
FT                   /product="mCG1040528, isoform CRA_a"
FT                   /note="gene_id=mCG1040528.1 transcript_id=mCT129835.1
FT                   protein_id=mCP70774.1 isoform=CRA_a"
FT                   /protein_id="EDL38466.1"
FT                   /translation="MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDV
FT                   KEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAALYSIGDTYTVFQTLDKCNDIIRSKDD
FT                   TAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVNNLLKSLKSAESQGRSEILMSLQKV
FT                   LTGLGGAAASSHRDIYKNARSLLTDRSMAVRCAVAKAYVVFVTTLGGQWLERSFATFLS
FT                   HVLDLVSHPRATQTHVDAVYSRRCVSFMLRATVGSLLGEKAQIAAAKEICQAIGKQMKA
FT                   VEAVVNDTSSENKSGTADIAASQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIV
FT                   TSVLLHPSMAARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSGYSFAMA
FT                   ALLGGVHQCPLGIPHAKGKMVVSIAEDLLRTAAQNSRLSLQRTQAGWLLLGALMTLGPS
FT                   VVRYHLPKMLLLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALCAMRSFVAHCPE
FT                   LLTEDAIRKLMTPIECAMTMMSHIPSVIKAHGAHLKASAAMVRLRLYDILALLPPKTYE
FT                   GSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPN
FT                   SASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQML
FT                   DHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPEEVRKSALTLVMGALDN
FT                   PNPILRCAAGEALGRMAQVVGEASFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRY
FT                   VGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLV
FT                   LTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNAATISTIRSSCLVGCAITQDHSD
FT                   SLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREAA
FT                   EVCEYAMSLAKNAGDKEISGGNVNPFTPGVSSRSDVHCRHQGVNITDTGLEGLLFGMLD
FT                   RETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSGTYECSHTLKQGKDEES
FT                   EKKDEMDDDAMFTTLGEEDKSKPFVAPRWATRVFAADCLCRIINLCENSDQAHFDLALA
FT                   RSAKLRNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFP
FT                   GHVILEQYQANVGAALRPAFSQDTPSDIIAKACQIPGVSIQFLCSPRPEEPIEHVTACL
FT                   QALHTLLGSPYARIHIAEDQVYVVAMNIKKEAESKPKRAMNNPDDDDDDYGTIDELPPD
FT                   SLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGAFYTPETIDTARLHYRN
FT                   SWAPILHAVALWLNSTGFISQESTEATTVSGVQKRSPAVSLNQVPGAMASAKPLPEVNK
FT                   DRMHLILDEEDMEKESCPTLGEGGDTGGLIPGKSLVFATMELLMFILVRHMPHLSTKML
FT                   DSPSHTAMKTQLSEESARLVAATVAILSDLPSLCSPAGCMTILPTILFLIARILKDTAI
FT                   KSADNQVPPPVSAALQGIKSIVTLSMAKTEDTQKQWTTLIRSTLACILEYSQPDDCMPA
FT                   PDEVSTLTAIALFLWSASSEIIGVQSLQNGCMNRFKSALNSCDPWHSNRALSTPYIHSL
FT                   APLVVGKLKAVERHRPASSTELLAVQEGIKVLETLVALGEEQNRVQLLALLVPTLISYL
FT                   LDENSFASASSISKDLHEFALQNLMHIGPLYPHAFKTVMGAAPELKARLETAVRASQAS
FT                   KAKAAARQPAPTTHSTPTIKLKTSFF"
FT   gene            22513397..22523634
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /note="gene_id=mCG2760.2"
FT   mRNA            join(22513397..22513491,22514612..22514738,
FT                   22515663..22515734,22516820..22517046,22517891..22517932,
FT                   22518778..22518898,22519034..22519124,22519928..22520044,
FT                   22521634..22521715,22522960..22523634)
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /product="RIKEN cDNA 2310002B06"
FT                   /note="gene_id=mCG2760.2 transcript_id=mCT1965.2 created on
FT                   30-AUG-2002"
FT   CDS             join(22515676..22515734,22516820..22517046,
FT                   22517891..22517932,22518778..22518898,22519034..22519124,
FT                   22519928..22520044,22521634..22521715,22522960..22523015)
FT                   /codon_start=1
FT                   /gene="2310002B06Rik"
FT                   /locus_tag="mCG_2760"
FT                   /product="RIKEN cDNA 2310002B06"
FT                   /note="gene_id=mCG2760.2 transcript_id=mCT1965.2
FT                   protein_id=mCP2896.2"
FT                   /protein_id="EDL38468.1"
FT                   /translation="MKESMTEEEDYMSDSFINVQEDVRPGVPMLRQIREARRKEEKQQQ
FT                   ANLRNRQKSVKEEERERRDIGLKNALGCENKGFALLQKMGYKSGQALGKSGDGIVEPIP
FT                   LNVKTGKSGIGHESSLKRKAEERLENYRRKIHMKNQNEAKAAEEFRMRLKSKQDEMRLE
FT                   GDLRRSQRACQQLDAQKNIQVPREAWYWLRPEEETEEEEEEKEEQDEDECPSEDLSVLE
FT                   KLQILTGYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADHD"
FT   gene            complement(22528295..22530069)
FT                   /pseudo
FT                   /locus_tag="mCG_2756"
FT                   /note="gene_id=mCG2756.2"
FT   mRNA            complement(22528295..22530069)
FT                   /pseudo
FT                   /locus_tag="mCG_2756"
FT                   /note="gene_id=mCG2756.2 transcript_id=mCT1962.2 created on
FT                   14-OCT-2002"
FT   gene            complement(22531578..22562053)
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /note="gene_id=mCG2769.2"
FT   mRNA            complement(join(22531578..22533096,22533178..22533234,
FT                   22534402..22534503,22536336..22536467,22541679..22541859,
FT                   22543133..22543252,22544147..22544269,22546588..22546638,
FT                   22547308..22547342,22548319..22548367,22548486..22548565,
FT                   22548982..22549102,22551754..22551890,22553577..22553697,
FT                   22555520..22555651,22561911..22562053))
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /product="eukaryotic translation initiation factor 2-alpha
FT                   kinase 2"
FT                   /note="gene_id=mCG2769.2 transcript_id=mCT1952.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(22532974..22533096,22533178..22533234,
FT                   22534402..22534503,22536336..22536467,22541679..22541859,
FT                   22543133..22543252,22544147..22544269,22546588..22546638,
FT                   22547308..22547342,22548319..22548367,22548486..22548565,
FT                   22548982..22549102,22551754..22551890,22553577..22553697,
FT                   22555520..22555635))
FT                   /codon_start=1
FT                   /gene="Eif2ak2"
FT                   /locus_tag="mCG_2769"
FT                   /product="eukaryotic translation initiation factor 2-alpha
FT                   kinase 2"
FT                   /note="gene_id=mCG2769.2 transcript_id=mCT1952.2
FT                   protein_id=mCP2895.1"
FT                   /db_xref="GOA:Q91YN2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1353449"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YN2"
FT                   /protein_id="EDL38469.1"
FT                   /translation="MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVL
FT                   IDEKEFPEAKGKSKQEARNAAAKLAVDILDNENKVDCHTSASEQGLPYGNYIGLVNSFA
FT                   QKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKS
FT                   PPKTAGTSSSVVTSTFSGFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKV
FT                   SPDDVQRNKYTLDARFNSDFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAE
FT                   HEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWM
FT                   RNRNQSKVDKALILDLYEQIVTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLAT
FT                   ALENDGKSRTRRTGTLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFF
FT                   ESLRKGDFSNDIFDNKEKSLLKKLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC"
FT   gene            complement(22564330..22574615)
FT                   /locus_tag="mCG_60634"
FT                   /note="gene_id=mCG60634.3"
FT   mRNA            complement(join(22564330..22564724,22568441..22568597,
FT                   22570359..22570453,22574057..22574183,22574550..22574615))
FT                   /locus_tag="mCG_60634"
FT                   /product="mCG60634"
FT                   /note="gene_id=mCG60634.3 transcript_id=mCT172488.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(22564594..22564724,22568441..22568498))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60634"
FT                   /product="mCG60634"
FT                   /note="gene_id=mCG60634.3 transcript_id=mCT172488.0
FT                   protein_id=mCP95407.0"
FT                   /protein_id="EDL38470.1"
FT                   /translation="MRANSQETHGAIGPFLFRKGEVGDWKRLFNETQNQEMDERFKECL
FT                   AGTSLGDKLKYEAYCLA"
FT   gene            <22595947..22599765
FT                   /locus_tag="mCG_146121"
FT                   /note="gene_id=mCG146121.0"
FT   mRNA            join(<22595947..22595972,22597822..22597937,
FT                   22598521..22598565,22599224..22599308,22599442..22599765)
FT                   /locus_tag="mCG_146121"
FT                   /product="mCG146121"
FT                   /note="gene_id=mCG146121.0 transcript_id=mCT186224.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<22595947..22595972,22597822..22597937,
FT                   22598521..22598565,22599224..22599306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146121"
FT                   /product="mCG146121"
FT                   /note="gene_id=mCG146121.0 transcript_id=mCT186224.0
FT                   protein_id=mCP107777.0"
FT                   /protein_id="EDL38471.1"
FT                   /translation="AQSGCGGLRMARIMEPLARKIFKGVLAAELVGVAGAYCLFKKMHS
FT                   SQDFRQTMSKKFPFILEVYYKSIEQSGMYGVREKDEEKWLTSKN"
FT   gene            complement(22598471..>22618811)
FT                   /locus_tag="mCG_12062"
FT                   /note="gene_id=mCG12062.2"
FT   mRNA            complement(join(22598471..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616636..22617842,22618645..>22618811))
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, transcript variant mCT15066"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT15066.1 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(22599213..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616350..22617842,22618645..22618811))
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, transcript variant mCT170876"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT170876.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22599346..22599482,22600018..22600099,
FT                   22600191..22600249,22601104..22601190,22601599..22601783,
FT                   22601983..22602040,22602707..22602807,22603906..22603972,
FT                   22605312..22605380,22605481..22605583,22606267..22606320,
FT                   22611123..22611211,22613165..22613351,22613936..22614167,
FT                   22616350..22617842,22618645..22618800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, isoform CRA_a"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT170876.0
FT                   protein_id=mCP93794.0 isoform=CRA_a"
FT                   /protein_id="EDL38472.1"
FT                   /translation="MSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSLEEV
FT                   LRLGGTKQDYLMLATLDENEEVVDGGKKGTIDDLQQGELESFIQNLNLAKYSKSLIEED
FT                   EPEKKENASKKEAKLLKVENKKQKATEGKKTSEKKVKNKTVAEQRPESCPVSKAKKDKQ
FT                   PDVFEFLERQTMLLRPGGKWYDMEYSGEYSLEPQPPDVVSKYKALAQKLYEHEVSLFKS
FT                   KTNNQKGGSSTWMKAIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGSKQQ
FT                   CLMALDTFKELLITDLLPDSRKLRVFSQHPFHKLEEMSSGNKDSRDRRLILWYYEHQLK
FT                   HLVAEFVQVLETLSHDSLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQNRIA
FT                   TKASHLLEVLLRKHPNMKGVVCGEIERLLFRSNISPKAQYYAICFLNQMVLSHEESELA
FT                   NKLITLYFCFFRTCIKKKDIESKMLSAILTGVNRAYPYSQIGDDKVREQVDTLFKVLHV
FT                   VNFNTSVQALMLLFQVMNSQQTISDRYYTALYRKMLDPGLTTCSKQAMFLNLIYKSLKA
FT                   DIMLRRVKAFVKRLLQVTCTQMPPFICGALYLVSEILKAKPDLRSQLDDHPESDEENFV
FT                   DVGDDSDDEKFTDADKGTATDAVKEVESKETEPESSAEAEKPKAASWVHFDNLKGGKQI
FT                   KTYDPFSRNPLFCGAENTTLWELKKLSEHFHPSVALFAKTILEGNCIQYSGDPLQDFTL
FT                   MRFLDRFVYRNPKLHKGKENTDSVVMQPKRKHFMKNVRDLAVNSKEFLAKEESQIPVDE
FT                   VFFYRYYKKVAVVKDKQKRSADEESIEDIDDEEFENMIDTFEDDNCFPPGKDDIDFASN
FT                   MKKTKGAKADLEDSESSDGELGDLDDDEVSLGSMNDEDFEIDEDGGTFMDVSDDESEDA
FT                   PEFADANPKANTKKSKRKSEDDFDFAGSFQGQKKKKKSFNDSSLFVSAEEFGHLLDENM
FT                   GSKFDTIGMNAMANRDNASFKQLKWEAERDDWLHNRDVKSIIKKKKNFRKKMKAPQKPK
FT                   RQRK"
FT   CDS             complement(join(22614145..22614167,22616636..22617842,
FT                   22618645..>22618809))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12062"
FT                   /product="mCG12062, isoform CRA_b"
FT                   /note="gene_id=mCG12062.2 transcript_id=mCT15066.1
FT                   protein_id=mCP2882.1 isoform=CRA_b"
FT                   /protein_id="EDL38473.1"
FT                   /translation="QPAMSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSL
FT                   EEVLRLGGTKQDYLMLATLDENEEVVDGGKKGTIDDLQQGELESFIQNLNLAKYSKSLI
FT                   EEDEPEKKENASKKEAKLLKVENKKQKATEGKKTSEKKVKNKTVAEQRPESCPVSKAKK
FT                   DKQPDVFEFLERQTMLLRPGGKWYDMEYSGEYSLEPQPPDVVSKYKALAQKLYEHEVSL
FT                   FKSKTNNQKGGSSTWMKAIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGS
FT                   KQQCLMALDTFKELLITDLLPDSRKLRVFSQHPFHKLEEMSSGNKDSRDRRLILWYYEH
FT                   QLKHLVAEFVQVLETLSHDSLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQN
FT                   RIATKASHLLEVLLRKHPNMKGVVCGEIERLLFRSNISPKAQYYAICFLNQMVLSHEEK
FT                   RCWIQA"
FT   gene            <22618905..22629933
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /note="gene_id=mCG12058.3"
FT   mRNA            join(<22618905..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22629933)
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, transcript variant
FT                   mCT193658"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT193658.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<22618905..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628418)
FT                   /codon_start=1
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, isoform CRA_a"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT193658.0
FT                   protein_id=mCP114633.0 isoform=CRA_a"
FT                   /protein_id="EDL38474.1"
FT                   /translation="RGGAWPRGVGMNALVRRCVARAGLPCIWRGKCYSSGNEPAESNQV
FT                   TPMLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGE
FT                   LLGVWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVS
FT                   QKLSEIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEF
FT                   FDVLPVHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHVEVCP
FT                   DAGVIIQELSQRIASTGGAALIADYGHDGTKTDTLRGFYGHQLHDVLIAPGTADLTADV
FT                   DFSYLHRMAQGKVASLGPVEQRTFLKNMGIDVRLKVVVYLSNTKPLNFGNYLN"
FT   mRNA            join(<22618906..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628361,22628769..22629384)
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, transcript variant
FT                   mCT12070"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT12070.1 created
FT                   on 30-AUG-2002"
FT   CDS             join(<22618908..22618971,22619261..22619424,
FT                   22620310..22620390,22621357..22621467,22623795..22624008,
FT                   22624977..22625035,22625557..22625667,22626679..22626822,
FT                   22628188..22628361,22628769..22628984)
FT                   /codon_start=1
FT                   /gene="2410091C18Rik"
FT                   /locus_tag="mCG_12058"
FT                   /product="RIKEN cDNA 2410091C18, isoform CRA_b"
FT                   /note="gene_id=mCG12058.3 transcript_id=mCT12070.1
FT                   protein_id=mCP2879.1 isoform=CRA_b"
FT                   /protein_id="EDL38475.1"
FT                   /translation="GGAWPRGVGMNALVRRCVARAGLPCIWRGKCYSSGNEPAESNQVT
FT                   PMLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGEL
FT                   LGVWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQ
FT                   KLSEIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEFF
FT                   DVLPVHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHVEVCPD
FT                   AGVIIQELSQRIASTGGAALIADYGHDGTKTDTLRGFYGHQLHDVLIAPGTADLTADVD
FT                   FSYLHRMAQGKVASLGPVEQRTFLKNMGIDVRLKVLLDRAGEPSAKQQLLGGYDMLMNP
FT                   QKMGERFHFFALLPHQRLHGGSQERNACQSKTPSSSVAGFDELVWQ"
FT   gene            complement(22633520..22695146)
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /note="gene_id=mCG12054.3"
FT   mRNA            complement(join(22633520..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657484,
FT                   22663570..22663727,22665324..22665455,22667013..22667151,
FT                   22689854..>22690099))
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, transcript variant
FT                   mCT193655"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT193655.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657461,
FT                   22663553..22663727,22665324..22665455,22667013..22667151,
FT                   22694231..22695146))
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, transcript variant
FT                   mCT170870"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT170870.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657461,
FT                   22663553..22663727,22665324..22665455,22667013..22667151,
FT                   22694231..22694518))
FT                   /codon_start=1
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, isoform CRA_b"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT170870.0
FT                   protein_id=mCP93788.0 isoform=CRA_b"
FT                   /protein_id="EDL38477.1"
FT                   /translation="MSANNSPPSAQKSVFPATVSAVLPAPSPCSSPKTGLSARLSNGSF
FT                   SAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFG
FT                   MYDKILLFRHDMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYK
FT                   APTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGL
FT                   SVPRPLQPECVPLLSEEVCILRSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPT
FT                   ICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPCSVGTDADMPM
FT                   DIDSSDVNSDGSRGLDDSEEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIPLM
FT                   RVVQSIKHTKRRSSTVVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEI
FT                   PLSEILRVSSPQDFTSISQGSNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGLDV
FT                   AQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLATSISVSNCQVQENVDISSVYQIFA
FT                   DEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVN
FT                   LECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIV
FT                   HCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNR
FT                   SLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNLLQ
FT                   VKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLEY
FT                   PKHFIMAPNPDDMEEDP"
FT   CDS             complement(join(22633736..22633909,22634553..22634638,
FT                   22636351..22636618,22638417..22638515,22639038..22639199,
FT                   22640927..22641033,22643009..22643081,22644422..22644474,
FT                   22648053..22648329,22649925..22650002,22653248..22653371,
FT                   22654291..22654474,22656652..22656729,22657292..22657484,
FT                   22663570..22663727,22665324..22665455,22667013..22667151,
FT                   22689854..>22689913))
FT                   /codon_start=1
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, isoform CRA_c"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT193655.0
FT                   protein_id=mCP114631.0 isoform=CRA_c"
FT                   /protein_id="EDL38478.1"
FT                   /translation="DEDSIPDRRIEISRDGRRNMFPECGFFGMYDKILLFRHDMNSENI
FT                   LQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVR
FT                   QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEE
FT                   SHTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQ
FT                   GMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPCSVGTDADMPMDIDSSDVNSDGSRGL
FT                   DDSEEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIPLMRVVQSIKHTKRRSST
FT                   VVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRVSSPQDFT
FT                   SISQGSNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGLDVAQSWEKAIRQALMPV
FT                   TPQASVCTSPGQGKDHKDLATSISVSNCQVQENVDISSVYQIFADEVLGSGQFGIVYGG
FT                   KHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVM
FT                   EKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAE
FT                   PFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSL
FT                   SGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNLLQVKMRKRYSVDKSLSH
FT                   PWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLEYPKHFIMAPNPDDMEE
FT                   DP"
FT   mRNA            complement(join(22654164..22654474,22656652..22656729,
FT                   22657292..22657484,22663570..22663727,22665324..22665455,
FT                   22667013..22667151,22689854..22689989,22690216..22690284))
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, transcript variant
FT                   mCT12066"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT12066.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(22654287..22654474,22656652..22656729,
FT                   22657292..22657484,22663570..22663727,22665324..22665455,
FT                   22667013..22667151,22689854..22689856))
FT                   /codon_start=1
FT                   /gene="Prkcn"
FT                   /locus_tag="mCG_12054"
FT                   /product="protein kinase C, nu, isoform CRA_a"
FT                   /note="gene_id=mCG12054.3 transcript_id=mCT12066.0
FT                   protein_id=mCP2893.1 isoform=CRA_a"
FT                   /protein_id="EDL38476.1"
FT                   /translation="MFPECGFFGMYDKILLFRHDMNSENILQLITSADEIHEGDLVEVV
FT                   LSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFK
FT                   IPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEESHTHQEPSKRIPSWSGRPI
FT                   WMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKV
FT                   PRDCLGEVTFNGEPCSVGTDADMPMDIDSSDVNSDGSRGLDDSEEPSPPEDKMFFLDPT
FT                   DLDVERDEETVKTIR"
FT   gene            <22727599..22764599
FT                   /locus_tag="mCG_12059"
FT                   /note="gene_id=mCG12059.2"
FT   mRNA            join(<22727599..22728082,22746324..22746602,
FT                   22753103..22753279,22755090..22755189,22757346..22757462,
FT                   22763843..22764599)
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, transcript variant mCT172466"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT172466.0 created
FT                   on 30-AUG-2002"
FT   mRNA            join(<22727599..22728082,22739576..22739680,
FT                   22746324..22746602,22753103..22753279,22755090..22755189,
FT                   22757346..22757462,22763843..22764598)
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, transcript variant mCT12071"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT12071.2 created
FT                   on 30-AUG-2002"
FT   mRNA            join(<22727600..22728082,22739534..22739680,
FT                   22746324..22746602,22753103..22753279,22755090..22755189,
FT                   22757346..22757462,22763843..22764464)
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, transcript variant mCT193660"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT193660.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<22727600..22728082,22739534..22739680,
FT                   22746324..22746602,22753103..22753279,22755090..22755189,
FT                   22757346..22757462,22763843..22763988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, isoform CRA_c"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT193660.0
FT                   protein_id=mCP114634.0 isoform=CRA_c"
FT                   /protein_id="EDL38481.1"
FT                   /translation="SFLPSFLPSFLPSFLPSFLPPSLPSFFPSILSKIRKWFSLSLGSQ
FT                   SSCHPGKLSPLASRLLGEDCWFVLALHSGRPQEATGRQTQSIQGWRREKAGRPARVPGL
FT                   VTAGGPGNPRPHTLAEMAGSEDKRVVGTLHLLLLQATVLSLTAGNLSLVSAAWTQEKNH
FT                   HQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAE
FT                   WVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDS
FT                   AVPCAMMLELARALDKKLHSLKDVSGSKPDLSLQLIFFDGEEAFHHWSPQDSLYGSRHL
FT                   AQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKEL
FT                   YELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEE
FT                   NLHASTIDNLNKIIQVFVLEYLHL"
FT   CDS             join(<22727600..22728082,22739576..22739680,
FT                   22746324..22746602,22753103..22753279,22755090..22755189,
FT                   22757346..22757462,22763843..22763988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, isoform CRA_a"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT12071.2
FT                   protein_id=mCP2878.2 isoform=CRA_a"
FT                   /protein_id="EDL38479.1"
FT                   /translation="SFLPSFLPSFLPSFLPSFLPPSLPSFFPSILSKIRKWFSLSLGSQ
FT                   SSCHPGKLSPLASRLLGEDCWFVLALHSGRPQEATGRQTQSIQGWRREKAGRPARVPGL
FT                   VTAGGPGNPRPHTLAEMAGSEDKRVVGTLHLLLLQATVLSLTAGNLSLVSAAWTQEKQV
FT                   AEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPY
FT                   GYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARAL
FT                   DKKLHSLKDVSGSKPDLSLQLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSR
FT                   GTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERK
FT                   YFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKII
FT                   QVFVLEYLHL"
FT   CDS             join(<22727600..22728082,22746324..22746602,
FT                   22753103..22753279,22755090..22755189,22757346..22757462,
FT                   22763843..22763988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12059"
FT                   /product="mCG12059, isoform CRA_b"
FT                   /note="gene_id=mCG12059.2 transcript_id=mCT172466.0
FT                   protein_id=mCP95385.0 isoform=CRA_b"
FT                   /protein_id="EDL38480.1"
FT                   /translation="SFLPSFLPSFLPSFLPSFLPPSLPSFFPSILSKIRKWFSLSLGSQ
FT                   SSCHPGKLSPLASRLLGEDCWFVLALHSGRPQEATGRQTQSIQGWRREKAGRPARVPGL
FT                   VTAGGPGNPRPHTLAEMAGSEDKRVVGTLHLLLLQATVLSLTAGNLSLVSAAWTQEKHI
FT                   MQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWD
FT                   SRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLQLIFFDGEEAFHHWSP
FT                   QDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWF
FT                   NRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPE
FT                   VWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL"
FT   gene            complement(22776979..22777840)
FT                   /pseudo
FT                   /locus_tag="mCG_141437"
FT                   /note="gene_id=mCG141437.0"
FT   mRNA            complement(22776979..22777840)
FT                   /pseudo
FT                   /locus_tag="mCG_141437"
FT                   /note="gene_id=mCG141437.0 transcript_id=mCT175406.0
FT                   created on 05-NOV-2002"
FT   gene            complement(23004221..23025673)
FT                   /gene="Cdc42ep3"
FT                   /locus_tag="mCG_12055"
FT                   /note="gene_id=mCG12055.2"
FT   mRNA            complement(join(23004221..23006210,23025396..23025673))
FT                   /gene="Cdc42ep3"
FT                   /locus_tag="mCG_12055"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 3,
FT                   transcript variant mCT12067"
FT                   /note="gene_id=mCG12055.2 transcript_id=mCT12067.2 created
FT                   on 25-JUL-2002"
FT   CDS             complement(23005219..23005983)
FT                   /codon_start=1
FT                   /gene="Cdc42ep3"
FT                   /locus_tag="mCG_12055"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12055.2 transcript_id=mCT12067.2
FT                   protein_id=mCP2897.1 isoform=CRA_a"
FT                   /protein_id="EDL38482.1"
FT                   /translation="MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIG
FT                   KEGQHDVFGDISFLQGNYELLPGNQEKAHSGQFPGHNDFFRANSTSDSMFTETPSPVLK
FT                   NAISLPTIGGSQALMLPLLSPVTFHSKQESFGRPKLPRLSCEPVMEEKVQEQSSLLENG
FT                   AVHQGDTSWGSSGSGSQSSQGRDSHSSSLSEQSSDWPADDMFEHPASCELVKSKTKSEE
FT                   SFSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK"
FT   mRNA            complement(join(<23005691..23006210,23023546..23023579))
FT                   /gene="Cdc42ep3"
FT                   /locus_tag="mCG_12055"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 3,
FT                   transcript variant mCT170872"
FT                   /note="gene_id=mCG12055.2 transcript_id=mCT170872.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(<23005691..23005983)
FT                   /codon_start=1
FT                   /gene="Cdc42ep3"
FT                   /locus_tag="mCG_12055"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12055.2 transcript_id=mCT170872.0
FT                   protein_id=mCP93790.0 isoform=CRA_b"
FT                   /protein_id="EDL38483.1"
FT                   /translation="MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIG
FT                   KEGQHDVFGDISFLQGNYELLPGNQEKAHSGQFPGHNDFFRANSTSDSMFTET"
FT   gene            complement(23154253..23156504)
FT                   /locus_tag="mCG_1039566"
FT                   /note="gene_id=mCG1039566.0"
FT   mRNA            complement(join(23154253..23155670,23156317..23156504))
FT                   /locus_tag="mCG_1039566"
FT                   /product="mCG1039566"
FT                   /note="gene_id=mCG1039566.0 transcript_id=mCT157270.0
FT                   created on 31-OCT-2002"
FT   CDS             complement(23155415..23155594)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039566"
FT                   /product="mCG1039566"
FT                   /note="gene_id=mCG1039566.0 transcript_id=mCT157270.0
FT                   protein_id=mCP71032.1"
FT                   /protein_id="EDL38484.1"
FT                   /translation="MLVVTCNLPWLVHLHCRALLSTITKTLGKGFDLRPKQIAAERLTT
FT                   VGVSPWLSWALAPS"
FT   gene            23251207..23285096
FT                   /locus_tag="mCG_148346"
FT                   /note="gene_id=mCG148346.0"
FT   mRNA            join(23251207..23251494,23282933..23285096)
FT                   /locus_tag="mCG_148346"
FT                   /product="mCG148346"
FT                   /note="gene_id=mCG148346.0 transcript_id=mCT188609.0
FT                   created on 13-JAN-2004"
FT   CDS             23251326..23251493
FT                   /codon_start=1
FT                   /locus_tag="mCG_148346"
FT                   /product="mCG148346"
FT                   /note="gene_id=mCG148346.0 transcript_id=mCT188609.0
FT                   protein_id=mCP108827.0"
FT                   /protein_id="EDL38485.1"
FT                   /translation="MALPSALCLAFLLLVPVMDSNPWEVLACGPERQNFLWIPHIPHPL
FT                   DSLRLWSMGF"
FT   gene            <23287518..23357624
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /note="gene_id=mCG125705.2"
FT   mRNA            join(<23287518..23287607,23293939..23294405,
FT                   23322882..23323056,23324279..23324381,23331993..23332053,
FT                   23339454..23339529,23340534..23340611,23343132..23343230,
FT                   23344925..23344978,23345068..23345148,23354291..23354810)
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, transcript variant
FT                   mCT193700"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT193700.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(23287685..23287863,23287911..23288031,
FT                   23293939..23294405,23322882..23323056,23324279..23324381,
FT                   23331993..23332053,23339454..23339529,23340534..23340611,
FT                   23343132..23343230,23344925..23344978,23345068..23345148,
FT                   23354291..23354340,23357322..23357624)
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, transcript variant
FT                   mCT126968"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT126968.1
FT                   created on 10-SEP-2002"
FT   mRNA            join(<23287885..23288031,23293939..23294405,
FT                   23322882..23323056,23324279..23324381,23331993..23332053,
FT                   23339454..23339529,23340537..23340611,23343132..23343230,
FT                   23344925..23344978,23345068..23345148,23354291..23354669)
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, transcript variant
FT                   mCT193701"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT193701.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<23293945..23294405,23322882..23323056,
FT                   23324279..23324381,23331993..23332053,23339454..23339529,
FT                   23340534..23340611,23343132..23343230,23344925..23344978,
FT                   23345068..23345148,23354291..23354344)
FT                   /codon_start=1
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, isoform CRA_b"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT193700.0
FT                   protein_id=mCP114673.0 isoform=CRA_b"
FT                   /protein_id="EDL38487.1"
FT                   /translation="KPRMPHSTNKELILGIMAGTAGISLLAFWYHKVLKPRTTMNFPKL
FT                   LSLGKKFGSLTLPEESHSAQGASVVFQRRQLQILEKLNELLTNMEELKEEIRFLKETIP
FT                   KLEECIQDEFGGKVTVHKISPQHRARKKKGTTVQRSATSNSSEEAESEGGYITANTDTE
FT                   EQNFPFPKALNTHIEELKLDVLLQKADHLRTNESHKMESFELLCDHKEKFSEETEFLWR
FT                   LARAYGDMYDLSTSTQEKKHYANIGKTLGERAITRAPMNGHCHLWYAVLCGYVSEFEGL
FT                   QNKINCGHLFKKHLEIAIQLLPEEPLLYYLKGRYCYTVSRLSWIEKKMAATLFGEIPYS
FT                   TVHEALHNFLKTEELQPGYSMSNYMYTAKCYVELGEPQEACKFCNLALLLPVVTKEDKD
FT                   AHKEVKKMISSLKR"
FT   CDS             join(<23293945..23294405,23322882..23323056,
FT                   23324279..23324381,23331993..23332053,23339454..23339529,
FT                   23340537..23340611,23343132..23343230,23344925..23344978,
FT                   23345068..23345148,23354291..23354344)
FT                   /codon_start=1
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, isoform CRA_c"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT193701.0
FT                   protein_id=mCP114674.0 isoform=CRA_c"
FT                   /protein_id="EDL38488.1"
FT                   /translation="KPRMPHSTNKELILGIMAGTAGISLLAFWYHKVLKPRTTMNFPKL
FT                   LSLGKKFGSLTLPEESHSAQGASVVFQRRQLQILEKLNELLTNMEELKEEIRFLKETIP
FT                   KLEECIQDEFGGKVTVHKISPQHRARKKKGTTVQRSATSNSSEEAESEGGYITANTDTE
FT                   EQNFPFPKALNTHIEELKLDVLLQKADHLRTNESHKMESFELLCDHKEKFSEETEFLWR
FT                   LARAYGDMYDLSTSTQEKKHYANIGKTLGERAITRAPMNGHCHLWYAVLCGYVSEFEGL
FT                   QNKINCGHLFKHLEIAIQLLPEEPLLYYLKGRYCYTVSRLSWIEKKMAATLFGEIPYST
FT                   VHEALHNFLKTEELQPGYSMSNYMYTAKCYVELGEPQEACKFCNLALLLPVVTKEDKDA
FT                   HKEVKKMISSLKR"
FT   CDS             join(23293954..23294405,23322882..23323056,
FT                   23324279..23324381,23331993..23332053,23339454..23339529,
FT                   23340534..23340611,23343132..23343230,23344925..23344978,
FT                   23345068..23345148,23354291..23354340,23357322..23357349)
FT                   /codon_start=1
FT                   /gene="AW061290"
FT                   /locus_tag="mCG_125705"
FT                   /product="expressed sequence AW061290, isoform CRA_a"
FT                   /note="gene_id=mCG125705.2 transcript_id=mCT126968.1
FT                   protein_id=mCP71059.1 isoform=CRA_a"
FT                   /protein_id="EDL38486.1"
FT                   /translation="MPHSTNKELILGIMAGTAGISLLAFWYHKVLKPRTTMNFPKLLSL
FT                   GKKFGSLTLPEESHSAQGASVVFQRRQLQILEKLNELLTNMEELKEEIRFLKETIPKLE
FT                   ECIQDEFGGKVTVHKISPQHRARKKKGTTVQRSATSNSSEEAESEGGYITANTDTEEQN
FT                   FPFPKALNTHIEELKLDVLLQKADHLRTNESHKMESFELLCDHKEKFSEETEFLWRLAR
FT                   AYGDMYDLSTSTQEKKHYANIGKTLGERAITRAPMNGHCHLWYAVLCGYVSEFEGLQNK
FT                   INCGHLFKKHLEIAIQLLPEEPLLYYLKGRYCYTVSRLSWIEKKMAATLFGEIPYSTVH
FT                   EALHNFLKTEELQPGYSMSNYMYTAKCYVELGEPQEACKFCNLALLLPVVTKEDKDAHK
FT                   EVKKMISSLKRKFHTSSSV"
FT   gene            23299309..23301314
FT                   /locus_tag="mCG_141086"
FT                   /note="gene_id=mCG141086.0"
FT   mRNA            join(23299309..23299435,23300095..23301314)
FT                   /locus_tag="mCG_141086"
FT                   /product="mCG141086"
FT                   /note="gene_id=mCG141086.0 transcript_id=mCT172964.0
FT                   created on 10-SEP-2002"
FT   CDS             join(23299419..23299435,23300095..23301115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141086"
FT                   /product="mCG141086"
FT                   /note="gene_id=mCG141086.0 transcript_id=mCT172964.0
FT                   protein_id=mCP95883.0"
FT                   /db_xref="GOA:G3X9J2"
FT                   /db_xref="MGI:MGI:1918173"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J2"
FT                   /protein_id="EDL38489.1"
FT                   /translation="MGKCLSCWKKDQCFQPNHDDPVTPQRMHHGSSRALQTKVALGLIT
FT                   CRPSSTYKIGRKSSSSSSSTTHLCPCKGRHSLLRRFRKRKQQGSRVNFDSQEDLTSSAA
FT                   NSSDQFTLRKSRKYFSSRKLSVVSCHRNSVTYETPRGSLSHENEIQGFSKKSTSTDAPK
FT                   RISFSDPEHGDRYFANLETKPGSSGHWSFERTPYPLTLTTSLFSLPTVISSSSQVNVSG
FT                   ADNQEHGQLNKVSEDALHHRSQSLSGNYSPAGLEQHPSSASFLQDELSSLYQTIGSLTV
FT                   EVTSGSFEEESFATPSLDEDIPSPIETDEIRSSQIFLSLRRAAQIGKFPNNHSPKTIET
FT                   SIQLS"
FT   gene            complement(23374198..23387702)
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /note="gene_id=mCG12056.2"
FT   mRNA            complement(join(23374198..23374467,23375072..23375434,
FT                   23381118..23381162,23382972..23383342,23385930..>23386318))
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, transcript variant mCT170873"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT170873.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(23375370..23375434,23381118..23381162,
FT                   23382972..23383342,23385930..>23386318))
FT                   /codon_start=1
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT170873.0
FT                   protein_id=mCP93792.0 isoform=CRA_b"
FT                   /protein_id="EDL38491.1"
FT                   /translation="AEFLELLSHNEEFGRTVGAGSLVDVLPWLQLFPNPVRTTFRKFEQ
FT                   LNRNFSNFVLDKFLRHRESLVPGAAPRDMTDAFILSAEKKASGAPGDDSSGLDLEDVPA
FT                   TITDIFGASQDTLSTALLWLLILFTRYPDVQARVQAELDQVVGRDRLPCMSDQPNLPYV
FT                   MAFLYESMRFSSFLPVTIPHATTANTFVLGYYIPKNTVVFVNQWSVNHDPAKWPNPEDF
FT                   DPARFLDKDGFINKALASSVMIFSVGKRRCIGWHTTMSSHFLEAERVPWDTRHQATSSS
FT                   PRPQGRLC"
FT   mRNA            complement(join(23379614..23383342,23385930..23386973,
FT                   23387348..23387702))
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, transcript variant mCT12068"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT12068.1 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(23382754..23383342,23385930..23386972))
FT                   /codon_start=1
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT12068.1
FT                   protein_id=mCP2874.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q64429"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64429"
FT                   /protein_id="EDL38490.1"
FT                   /translation="MATSLSADSPQQLSSLSTQQTTLLLLFSVLAAVHLGQWLLRQWQR
FT                   KPWSSPPGPFPWPLIGNAAAVGQASHLYFARLARRYGDVFQIRLGSCPVVVLNGESAIH
FT                   QALVQQGSIFADRPPFASFRVVSGGRSLAFGHYSEHWKTQRRSAYSTMRAFSTRHPRSR
FT                   GLLEGHALAEARELVAVLVRRCAGGAFLDPTQPVIVAVANVMSAVCFGCRYNHDDAEFL
FT                   ELLSHNEEFGRTVGAGSLVDVLPWLQLFPNPVRTTFRKFEQLNRNFSNFVLDKFLRHRE
FT                   SLVPGAAPRDMTDAFILSAEKKASGAPGDDSSGLDLEDVPATITDIFGASQDTLSTALL
FT                   WLLILFTRYPDVQARVQAELDQVVGRDRLPCMSDQPNLPYVMAFLYESMRFSSFLPVTI
FT                   PHATTANTFVLGYYIPKNTVVFVNQWSVNHDPAKWPNPEDFDPARFLDKDGFINKALAS
FT                   SVMIFSVGKRRCIGEELSKMLLFLFISILAHQCNFKANQNESSNMSFSYGLTIKPKSFR
FT                   IHVSLRESMELLDNAVKKLQTEEGCK"
FT   mRNA            complement(join(<23383091..23383326,23386957..23386973,
FT                   23387348..23387645))
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, transcript variant mCT170874"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT170874.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(<23383091..23383272)
FT                   /codon_start=1
FT                   /gene="Cyp1b1"
FT                   /locus_tag="mCG_12056"
FT                   /product="cytochrome P450, family 1, subfamily b,
FT                   polypeptide 1, isoform CRA_c"
FT                   /note="gene_id=mCG12056.2 transcript_id=mCT170874.0
FT                   protein_id=mCP93791.0 isoform=CRA_c"
FT                   /protein_id="EDL38492.1"
FT                   /translation="MSDQPNLPYVMAFLYESMRFSSFLPVTIPHATTANTFVLGYYIPK
FT                   NTVVFVNQWSVNHDPA"
FT   gene            <23444371..23447467
FT                   /locus_tag="mCG_145590"
FT                   /note="gene_id=mCG145590.0"
FT   mRNA            join(<23444371..23444490,23446070..23446209,
FT                   23446646..23447467)
FT                   /locus_tag="mCG_145590"
FT                   /product="mCG145590"
FT                   /note="gene_id=mCG145590.0 transcript_id=mCT185014.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<23444484..23444490,23446070..23446209,
FT                   23446646..23446765)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145590"
FT                   /product="mCG145590"
FT                   /note="gene_id=mCG145590.0 transcript_id=mCT185014.0
FT                   protein_id=mCP106310.0"
FT                   /protein_id="EDL38493.1"
FT                   /translation="LTGTLPKRRQKDCKDQRKWRRPGKQGPLVNTIEACINPETEGAST
FT                   GPAQNWMMMMMIKEKEKEKEKEKEKEKEKEKEKEKEKEQEELM"
FT   gene            23484139..23486121
FT                   /locus_tag="mCG_148342"
FT                   /note="gene_id=mCG148342.0"
FT   mRNA            join(23484139..23484380,23485922..23486121)
FT                   /locus_tag="mCG_148342"
FT                   /product="mCG148342"
FT                   /note="gene_id=mCG148342.0 transcript_id=mCT188605.0
FT                   created on 13-JAN-2004"
FT   CDS             join(23484361..23484380,23485922..23486036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148342"
FT                   /product="mCG148342"
FT                   /note="gene_id=mCG148342.0 transcript_id=mCT188605.0
FT                   protein_id=mCP108821.0"
FT                   /protein_id="EDL38494.1"
FT                   /translation="MRDAIESLQQPPFFLLLPYPHFQFLQANESRRCLSSVTGLFHFK"
FT   gene            complement(23521518..>23568818)
FT                   /gene="Arl6ip2"
FT                   /locus_tag="mCG_12057"
FT                   /note="gene_id=mCG12057.1"
FT   mRNA            complement(join(23521518..23523447,23525694..23526125,
FT                   23527003..23527074,23527723..23527779,23529305..23529432,
FT                   23530277..23530415,23532956..23533048,23534272..23534328,
FT                   23534598..23534648,23537868..23537972,23538207..23538341,
FT                   23549079..23549327,23568777..>23568818))
FT                   /gene="Arl6ip2"
FT                   /locus_tag="mCG_12057"
FT                   /product="ADP-ribosylation factor-like 6 interacting
FT                   protein 2, transcript variant mCT12069"
FT                   /note="gene_id=mCG12057.1 transcript_id=mCT12069.1 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(23523296..23523447,23524884..23524958,
FT                   23525694..>23525924))
FT                   /gene="Arl6ip2"
FT                   /locus_tag="mCG_12057"
FT                   /product="ADP-ribosylation factor-like 6 interacting
FT                   protein 2, transcript variant mCT170875"
FT                   /note="gene_id=mCG12057.1 transcript_id=mCT170875.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(23523328..23523447,23525694..23526125,
FT                   23527003..23527074,23527723..23527779,23529305..23529432,
FT                   23530277..23530415,23532956..23533048,23534272..23534328,
FT                   23534598..23534648,23537868..23537972,23538207..23538341,
FT                   23549079..23549327,23568777..>23568800))
FT                   /codon_start=1
FT                   /gene="Arl6ip2"
FT                   /locus_tag="mCG_12057"
FT                   /product="ADP-ribosylation factor-like 6 interacting
FT                   protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG12057.1 transcript_id=mCT12069.1
FT                   protein_id=mCP2876.1 isoform=CRA_b"
FT                   /protein_id="EDL38496.1"
FT                   /translation="IGTRWRRGLGEDYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFEL
FT                   DEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPL
FT                   TGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFAL
FT                   STMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEH
FT                   SYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDG
FT                   RLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPH
FT                   PKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQF
FT                   RSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYII
FT                   SGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLK
FT                   PLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD"
FT   CDS             complement(join(23524926..23524958,23525694..>23525924))
FT                   /codon_start=1
FT                   /gene="Arl6ip2"
FT                   /locus_tag="mCG_12057"
FT                   /product="ADP-ribosylation factor-like 6 interacting
FT                   protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG12057.1 transcript_id=mCT170875.0
FT                   protein_id=mCP93793.0 isoform=CRA_a"
FT                   /protein_id="EDL38495.1"
FT                   /translation="IFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLAL
FT                   TSLCTWAYVKYSGEFREIGTMIDQIAETLWEQEQNGSCNYYR"
FT   gene            complement(23606183..23607483)
FT                   /pseudo
FT                   /locus_tag="mCG_17907"
FT                   /note="gene_id=mCG17907.2"
FT   mRNA            complement(23606183..23607483)
FT                   /pseudo
FT                   /locus_tag="mCG_17907"
FT                   /note="gene_id=mCG17907.2 transcript_id=mCT17356.2 created
FT                   on 15-JUL-2003"
FT   gene            complement(23707163..23739997)
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /note="gene_id=mCG17910.2"
FT   mRNA            complement(join(23707163..23708215,23710216..23710314,
FT                   23710403..23710460,23711721..23711922,23713006..23713127,
FT                   23716267..23716484,23722168..23722239,23726282..23726354,
FT                   23726439..23726541,23727486..23727566,23728302..23728539,
FT                   23731197..23731315,23739430..23739997))
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   transcript variant mCT17359"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT17359.3 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23707163..23708215,23710216..23710314,
FT                   23710403..23710460,23711721..23713231))
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   transcript variant mCT181444"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181444.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23707511..23708215,23710216..23710314,
FT                   23710403..23710460,23711721..23711922,23713006..23713460))
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   transcript variant mCT181445"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181445.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(23708160..23708215,23710216..23710314,
FT                   23710403..23710460,23711721..23711922,23713006..23713118))
FT                   /codon_start=1
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181445.0
FT                   protein_id=mCP104368.0 isoform=CRA_c"
FT                   /protein_id="EDL38499.1"
FT                   /translation="MKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSV
FT                   VPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFT
FT                   KLCNDHEVLPFIKYKVFDAKASAKTLSGLLEWKCKTDAVEALTALNHYQIRVPNGSNPY
FT                   TLKLCFSTSSHL"
FT   CDS             complement(join(23708160..23708215,23710216..23710314,
FT                   23710403..23710460,23711721..23711843))
FT                   /codon_start=1
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181444.0
FT                   protein_id=mCP104367.0 isoform=CRA_b"
FT                   /protein_id="EDL38498.1"
FT                   /translation="MSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCND
FT                   HEVLPFIKYKVFDAKASAKTLSGLLEWKCKTDAVEALTALNHYQIRVPNGSNPYTLKLC
FT                   FSTSSHL"
FT   mRNA            complement(join(23724467..23726354,23726439..23726541,
FT                   23727486..23727566,23728302..23728539,23731197..23731315,
FT                   23739430..>23739989))
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   transcript variant mCT181446"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181446.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(23728532..23728539,23731197..23731315,
FT                   23739430..>23739989))
FT                   /codon_start=1
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT181446.0
FT                   protein_id=mCP104366.0 isoform=CRA_d"
FT                   /protein_id="EDL38500.1"
FT                   /translation="AKLAEGEAGGWLRDKGKRPLSPRSLLSHGLLERAAEDAGPAQTRA
FT                   EEAQPAAGTDQRHLRPVSRAVSTAAAMSSSSSSSPKEETYEEDREFESQAKRLKTEEGE
FT                   IVYSAEESENRQEATPQAGSDSDSGGGDGGDGDGGSGGGGDGGDGEEGEGGEEGDEGDG
FT                   DEGGSGGDEGGSGGGALGACPCPRREVEVIIKFLFPLLSMFEGSVNLLWKLTLWRHWRN
FT                   LGQYAM"
FT   CDS             complement(join(23728532..23728539,23731197..23731315,
FT                   23739430..23739776))
FT                   /codon_start=1
FT                   /gene="Hnrpll"
FT                   /locus_tag="mCG_17910"
FT                   /product="heterogeneous nuclear ribonucleoprotein L-like,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17910.2 transcript_id=mCT17359.3
FT                   protein_id=mCP15310.2 isoform=CRA_a"
FT                   /protein_id="EDL38497.1"
FT                   /translation="MSSSSSSSPKEETYEEDREFESQAKRLKTEEGEIVYSAEESENRQ
FT                   EATPQAGSDSDSGGGDGGDGDGGSGGGGDGGDGEEGEGGEEGDEGDGDEGGSGGDEGGS
FT                   GGGALGACPCPRREVEVIIKFLFPLLSMFEGSVNLLWKLTLWRHWRNLGQYAM"
FT   gene            23731695..23732237
FT                   /pseudo
FT                   /locus_tag="mCG_125696"
FT                   /note="gene_id=mCG125696.0"
FT   mRNA            23731695..23732237
FT                   /pseudo
FT                   /locus_tag="mCG_125696"
FT                   /note="gene_id=mCG125696.0 transcript_id=mCT126959.0
FT                   created on 22-OCT-2002"
FT   gene            23805090..23862755
FT                   /gene="Galm"
FT                   /locus_tag="mCG_17911"
FT                   /note="gene_id=mCG17911.2"
FT   mRNA            join(23805090..23805541,23815648..23815802,
FT                   23822637..23822843,23827746..23827827,23859159..23859300,
FT                   23860818..23860992,23861639..23862755)
FT                   /gene="Galm"
FT                   /locus_tag="mCG_17911"
FT                   /product="galactose mutarotase"
FT                   /note="gene_id=mCG17911.2 transcript_id=mCT17360.2 created
FT                   on 19-SEP-2002"
FT   CDS             join(23805352..23805541,23815648..23815802,
FT                   23822637..23822843,23827746..23827827,23859159..23859300,
FT                   23860818..23860992,23861639..23861716)
FT                   /codon_start=1
FT                   /gene="Galm"
FT                   /locus_tag="mCG_17911"
FT                   /product="galactose mutarotase"
FT                   /note="gene_id=mCG17911.2 transcript_id=mCT17360.2
FT                   protein_id=mCP15313.1"
FT                   /protein_id="EDL38501.1"
FT                   /translation="MVSVTRTVFGELPSGGGTVEKFQLRSDQLSVDIISWGCTITALQV
FT                   KDRQGKASDVVLGFAELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPN
FT                   SLHGGFTGFDKVLWTPQVLTNGVQFFRVSPDGEEGYPGELKVWVTYTLDGGELVINYRA
FT                   QASQTTPVNLTNHSYFNLAGQGSPNIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAF
FT                   DLRKPVELGTHLQDYHIHGFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFY
FT                   TGNFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFS
FT                   VA"
FT   gene            complement(23877735..23885039)
FT                   /locus_tag="mCG_17902"
FT                   /note="gene_id=mCG17902.2"
FT   mRNA            complement(join(23877735..23879256,23879823..23879858,
FT                   23880345..23880398,23881776..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..23885039))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT17251"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT17251.3 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23877743..23879256,23879823..23879858,
FT                   23880345..23880398,23881785..23881886,23881967..23882041,
FT                   23882277..23882736,23882917..23883093,23883507..23883687,
FT                   23884907..23885039))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181436"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181436.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23877743..23879256,23880345..23880398,
FT                   23881776..23881886,23881967..23882041,23882917..23883093,
FT                   23883507..23883687,23884907..23885018))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181440"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181440.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23877743..23879256,23880345..23880398,
FT                   23881809..23881886,23881967..23882041,23882917..23883093,
FT                   23883507..23883687,23884907..23885017))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181437"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181437.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23877779..23879256,23879823..23879858,
FT                   23880345..23880398,23881776..23881886,23881967..23883093,
FT                   23883507..23883687,23884907..23885038))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181438"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181438.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23877779..23879256,23879823..23879858,
FT                   23880345..23880398,23881776..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884300..23884589))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181435"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181435.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23878967..23879256,23879823..23879858,
FT                   23880345..23880398,23881785..23881886,23881967..23883093,
FT                   23883507..23883687,23884907..>23885025))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT193683"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT193683.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(23878971..23879256,23879823..23879858,
FT                   23880345..23880398,23881785..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..>23885038))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT193684"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT193684.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(23879202..23879256,23879823..23879858,
FT                   23880345..23880398,23881785..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..>23884958))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_l"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT193684.0
FT                   protein_id=mCP114652.0 isoform=CRA_l"
FT                   /protein_id="EDL38513.1"
FT                   /translation="SRVHGPAIMSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPL
FT                   RTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPA
FT                   RRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRS
FT                   RSASPRRSRSVSLRRSRSASLRRSRSGSIIGSRSRSRSRSRSRSISRPRSSRSKSRSPS
FT                   PKRSRSPSGSPHRSASPERMD"
FT   CDS             complement(join(23879202..23879256,23880345..23880398,
FT                   23881809..23881886,23881967..23882041,23882917..23883093,
FT                   23883507..23883687,23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_e"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181437.0
FT                   protein_id=mCP104362.0 isoform=CRA_e"
FT                   /protein_id="EDL38506.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRS
FT                   RSVSLRRSRSASLRRSRSRSRSRSRSRSISRPRSSRSPSGSPHRSASPERMD"
FT   CDS             complement(join(23879202..23879256,23880345..23880398,
FT                   23881776..23881886,23881967..23882041,23882917..23883093,
FT                   23883507..23883687,23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_h"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181440.0
FT                   protein_id=mCP104360.0 isoform=CRA_h"
FT                   /protein_id="EDL38509.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRS
FT                   RSVSLRRSRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSSRSPSGSPHRSASP
FT                   ERMD"
FT   CDS             complement(join(23879202..23879256,23879823..23879858,
FT                   23880345..23880398,23881776..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_a"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT17251.3
FT                   protein_id=mCP15305.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q3THA6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1926232"
FT                   /db_xref="UniProtKB/TrEMBL:Q3THA6"
FT                   /protein_id="EDL38502.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRS
FT                   RSVSLRRSRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSR
FT                   SPSGSPHRSASPERMD"
FT   CDS             complement(join(23879202..23879256,23879823..23879858,
FT                   23880345..23880398,23881776..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884300..23884411))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_c"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181435.0
FT                   protein_id=mCP104364.0 isoform=CRA_c"
FT                   /protein_id="EDL38504.1"
FT                   /translation="MRSSARGRPLQAATAFFLSLFFFRRFERGFWLWGGDSETKVYVGN
FT                   LGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSR
FT                   VRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSH
FT                   SRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGSRYFQSRS
FT                   RSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHRSASPERMD"
FT   mRNA            complement(join(23880224..23880398,23881776..23881886,
FT                   23881967..23882041,23882917..23883093,23883507..23883687,
FT                   23884907..23885021))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181434"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181434.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(23880341..23880398,23881776..23881886,
FT                   23881967..23882041,23882917..23883093,23883507..23883687,
FT                   23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_b"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181434.0
FT                   protein_id=mCP104358.0 isoform=CRA_b"
FT                   /protein_id="EDL38503.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRS
FT                   RSVSLRRSRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSR"
FT   mRNA            complement(join(23881506..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..23885017))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181441"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181441.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23881652..23881886,23881967..23882291))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181442"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181442.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(23881730..23881886,23881967..23882041,
FT                   23882917..23883093,23883507..23883687,23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_i"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181441.0
FT                   protein_id=mCP104356.0 isoform=CRA_i"
FT                   /protein_id="EDL38510.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRS
FT                   RSVSLRRSRSASLRRSRSGSIIGSRYFQYVAHFSCLLVDGLS"
FT   CDS             complement(join(23881730..23881886,23881967..23882070))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_j"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181442.0
FT                   protein_id=mCP104363.0 isoform=CRA_j"
FT                   /protein_id="EDL38511.1"
FT                   /translation="MLYFSNLKNRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSR
FT                   SVSLRRSRSASLRRSRSGSIIGSRYFQYVAHFSCLLVDGLS"
FT   mRNA            complement(join(23882587..23882736,23882917..23883093,
FT                   23883507..23883687,23884300..23884535))
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, transcript variant mCT181439"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181439.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(23882709..23882736,23882917..23883093,
FT                   23883507..23883687,23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_d"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181436.0
FT                   protein_id=mCP104359.0 isoform=CRA_d"
FT                   /protein_id="EDL38505.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRFLRLSQSP"
FT   CDS             complement(join(23882709..23882736,23882917..23883093,
FT                   23883507..23883687,23884300..23884411))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_g"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181439.0
FT                   protein_id=mCP104357.0 isoform=CRA_g"
FT                   /protein_id="EDL38508.1"
FT                   /translation="MRSSARGRPLQAATAFFLSLFFFRRFERGFWLWGGDSETKVYVGN
FT                   LGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSR
FT                   VRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRFLRLSQ
FT                   SP"
FT   CDS             complement(join(23882829..23883093,23883507..23883687,
FT                   23884907..>23884958))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_k"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT193683.0
FT                   protein_id=mCP114651.0 isoform=CRA_k"
FT                   /protein_id="EDL38512.1"
FT                   /translation="SRVHGPAIMSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPL
FT                   RTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPA
FT                   RRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRYLINEGMVGILVNQSNSFISKAETSV
FT                   FL"
FT   CDS             complement(join(23882829..23883093,23883507..23883687,
FT                   23884907..23884934))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17902"
FT                   /product="mCG17902, isoform CRA_f"
FT                   /note="gene_id=mCG17902.2 transcript_id=mCT181438.0
FT                   protein_id=mCP104361.0 isoform=CRA_f"
FT                   /protein_id="EDL38507.1"
FT                   /translation="MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN
FT                   PPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPND
FT                   RCYECGEKGHYAYDCHRYSRRRRSRYLINEGMVGILVNQSNSFISKAETSVFL"
FT   gene            <23893995..23895851
FT                   /locus_tag="mCG_17905"
FT                   /note="gene_id=mCG17905.1"
FT   mRNA            <23893995..23895851
FT                   /locus_tag="mCG_17905"
FT                   /product="mCG17905"
FT                   /note="gene_id=mCG17905.1 transcript_id=mCT17354.1 created
FT                   on 25-JUL-2002"
FT   CDS             <23893995..23895644
FT                   /codon_start=1
FT                   /locus_tag="mCG_17905"
FT                   /product="mCG17905"
FT                   /note="gene_id=mCG17905.1 transcript_id=mCT17354.1
FT                   protein_id=mCP15300.1"
FT                   /protein_id="EDL38514.1"
FT                   /translation="ATTMSLLSSLEECTTGLYLFLNNRFSDAINLIHPWSKNSSYHALI
FT                   YSMFMVVKAILTFEPQDIQIGMNAAKEALKTCNNFRKKPRIVTLSRLMSRQGIKSIKEE
FT                   ELHAEVCYAECLVLKSAITFIQDDSLLSFLKSGVNVGSSYQIYKDCQQVLELMPENQSK
FT                   THRHLIGGIKFGVGVFNLMFSLVPPKSLKLLNMVGYSGDREVGLALLHDSASEPHINNI
FT                   LSVFTLLFYYNYVRVVVGVEKASTAATESLFLIYLEKFPNCVVLKFFRARFNMLNGNFE
FT                   SAKLKLQECIITQNEWKQVHHLCYWELMWCHIFLQNWKQAYNYASLLFQHSRWSKAIYI
FT                   YSKAIILALIPPDCVDSENESLSSYFLRVDSLRIKILGSSVPIEKFIAEKSQRYGTTTG
FT                   WFTAQPLLEFIYAWSGFRVMSKKIELISSWLLIIDKGKELLSENPNEEYGIDDMSLLNL
FT                   LKGLCLKHLGKHLKAEHYFIRVIRKEKMLKYDHYLVPYSYYELGMLHYLKGDYANAMKN
FT                   LDNIKNYKDYSMEARLQFRAHIALEQIAKLEK"
FT   gene            23902529..23906582
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /note="gene_id=mCG17906.1"
FT   mRNA            join(23902529..23902760,23903707..23903850,
FT                   23905824..23906582)
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   transcript variant mCT17355"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT17355.2 created
FT                   on 27-MAR-2003"
FT   mRNA            join(23902530..23902760,23903707..23903850,
FT                   23904611..23904906)
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   transcript variant mCT172478"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT172478.0 created
FT                   on 27-MAR-2003"
FT   mRNA            join(23902550..23902756,23903707..23903850,
FT                   23905824..23906538)
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   transcript variant mCT181443"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT181443.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(23903726..23903850,23905824..23906199)
FT                   /codon_start=1
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT17355.2
FT                   protein_id=mCP15307.2 isoform=CRA_b"
FT                   /protein_id="EDL38516.1"
FT                   /translation="MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSANIVL
FT                   VNFLEDGRLSVTGIMGHSVQTVETISEGDHRVREKLMHVFASGDCKGYSPEDLEEKRTS
FT                   LKKWLEKNHIPVTEQGDAQRTLCVAGVLTIDPPYAPENCSSSNEIILSRIQDLIQGHLS
FT                   ASQ"
FT   CDS             join(23903726..23903850,23905824..23906199)
FT                   /codon_start=1
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT181443.0
FT                   protein_id=mCP104365.0 isoform=CRA_b"
FT                   /protein_id="EDL38517.1"
FT                   /translation="MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSANIVL
FT                   VNFLEDGRLSVTGIMGHSVQTVETISEGDHRVREKLMHVFASGDCKGYSPEDLEEKRTS
FT                   LKKWLEKNHIPVTEQGDAQRTLCVAGVLTIDPPYAPENCSSSNEIILSRIQDLIQGHLS
FT                   ASQ"
FT   CDS             join(23903726..23903850,23904611..23904722)
FT                   /codon_start=1
FT                   /gene="Gemin6"
FT                   /locus_tag="mCG_17906"
FT                   /product="gem (nuclear organelle) associated protein 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17906.1 transcript_id=mCT172478.0
FT                   protein_id=mCP95397.0 isoform=CRA_a"
FT                   /protein_id="EDL38515.1"
FT                   /translation="MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSAKHTR
FT                   REHWIPLHMAVNHHVVAGNGTQDLWKRIGALNC"
FT   gene            complement(23916815..>23953856)
FT                   /gene="Dhx57"
FT                   /locus_tag="mCG_17913"
FT                   /note="gene_id=mCG17913.2"
FT   mRNA            complement(join(23916815..23917434,23920476..23920676,
FT                   23924199..23924333,23925609..23925683,23926771..23926905,
FT                   23928353..23928436,23928520..23928615,23929732..23930008,
FT                   23931618..23931818,23932796..23932969,23934083..23934155,
FT                   23936605..23936721,23938753..23938961,23942479..23942533,
FT                   23943607..23943740,23946046..23946170,23947283..23947478,
FT                   23948898..23949019,23951462..23951640,23953294..>23953856))
FT                   /gene="Dhx57"
FT                   /locus_tag="mCG_17913"
FT                   /product="DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57"
FT                   /note="gene_id=mCG17913.2 transcript_id=mCT17362.2 created
FT                   on 19-SEP-2002"
FT   CDS             complement(join(23917291..23917434,23920476..23920676,
FT                   23924199..23924333,23925609..23925683,23926771..23926905,
FT                   23928353..23928436,23928520..23928615,23929732..23930008,
FT                   23931618..23931818,23932796..23932969,23934083..23934155,
FT                   23936605..23936721,23938753..23938961,23942479..23942533,
FT                   23943607..23943740,23946046..23946170,23947283..23947478,
FT                   23948898..23949019,23951462..23951640,23953294..>23953855))
FT                   /codon_start=1
FT                   /gene="Dhx57"
FT                   /locus_tag="mCG_17913"
FT                   /product="DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57"
FT                   /note="gene_id=mCG17913.2 transcript_id=mCT17362.2
FT                   protein_id=mCP15303.2"
FT                   /protein_id="EDL38518.1"
FT                   /translation="KFCKSKQKESSKNVRDTSPETCKFYLKGNCKFGSKCKFKHEVPPH
FT                   QMIGRAERNVNDPHLDADDDTTFMYELQIRFSKDHKYPYQAPLVAFYSTNENLPLACRL
FT                   HISEFLYGKALEFAKTSEPVVYSLITLLEEESEIVKLLTHTQHKYSVPPVNVPPVPSET
FT                   RISKPAYRKPVVPSNTFLSNQMLEGERLSELEEDADEDEGPASIIVENESYVNLKKRSY
FT                   KRYDRPAKSLFAENSKICRQFQMKQASRQFHAILQERQLLPAWEERETILKLLSKHQVV
FT                   VISGMTGCGKTTQIPQFILDNSLNGPPERVANIICTQPRRISAISVAERVAKERAERVG
FT                   LTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDATLQGVTHIIVDEVHERTEESDFLL
FT                   LVLKDIVMQRATLQVILMSATLDAGLFSKYFSYCPVITIPGRAFPVDQFFLEDALAVTR
FT                   YVLQDGSPYMRSMKQIAKEKLKARHNRTAQEEVEEDLRLSLHLQDEEESVKDTIPDQQL
FT                   DFKQLLIRYKGVSKSVIKTMSVMDFEKVNLELIEALLEWIVDGKHAYPPGLAEIKMLYE
FT                   QLQSNSLFNNRRSHRCVIHPLHSSLSSEEQQAVFVKPPMGVTKIIISTNIAETSITIDD
FT                   VVYVIDSGKMKEKRYDAGKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYN
FT                   HQLLKQQLPEIQRVPLEQLCLRIKILEMFSTHNLQSVFSRLIEPPHIDSLRASKVRLRD
FT                   LGALTPDEKLTPLGYHLASLPVDVRIGKLMLLGSIFRCLDPALTIAASLAFKSPFVSPW
FT                   DKKEEANQKKLEFAFANSDYLALLCAYKGWQLSTKESARASYNYCRQNFLSGRTLQEMA
FT                   SLKRQFTELLSDIGFVKEGLRAKEIEKRAQGGDGVLDATGEEANTNAENPKLISAVLCA
FT                   ALYPNVVQVKTPEGKFQKTSSGVVRLQPKSAELKFVTKNDGYVHIHPSSVNYQVRHFDS
FT                   PYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQRGAFVVSLDDGWIRFVAAS
FT                   HQVAELVKELRCELDQLLQDKIKNPSMDLCSCPRGSRIISMIVKLITTQ"
FT   gene            <23969198..23976561
FT                   /gene="Morn2"
FT                   /locus_tag="mCG_125708"
FT                   /note="gene_id=mCG125708.1"
FT   mRNA            join(<23969198..23969303,23971293..23971346,
FT                   23973446..23973552,23974706..23974842,23976340..23976561)
FT                   /gene="Morn2"
FT                   /locus_tag="mCG_125708"
FT                   /product="MORN repeat containing 2, transcript variant
FT                   mCT126971"
FT                   /note="gene_id=mCG125708.1 transcript_id=mCT126971.1
FT                   created on 23-SEP-2002"
FT   mRNA            join(<23969198..23969303,23973446..23973552,
FT                   23974706..23974842,23976340..23976559)
FT                   /gene="Morn2"
FT                   /locus_tag="mCG_125708"
FT                   /product="MORN repeat containing 2, transcript variant
FT                   mCT173566"
FT                   /note="gene_id=mCG125708.1 transcript_id=mCT173566.0
FT                   created on 23-SEP-2002"
FT   CDS             join(<23969198..23969303,23971293..23971346,
FT                   23973446..23973552,23974706..23974842,23976340..23976442)
FT                   /codon_start=1
FT                   /gene="Morn2"
FT                   /locus_tag="mCG_125708"
FT                   /product="MORN repeat containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG125708.1 transcript_id=mCT126971.1
FT                   protein_id=mCP71095.1 isoform=CRA_a"
FT                   /protein_id="EDL38519.1"
FT                   /translation="TEARSVLEPSSLQPAELASLGESQSRESLSFTSPSTSSEVYKIKF
FT                   IFPNGDTYDGDCTRTTSGICERNGTGTHTTPNGIVYTGSWKDDKMNGFGRLEHFSGAVY
FT                   EGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLK
FT                   LKLYM"
FT   CDS             join(<23969198..23969303,23973446..23973552,
FT                   23974706..23974842,23976340..23976442)
FT                   /codon_start=1
FT                   /gene="Morn2"
FT                   /locus_tag="mCG_125708"
FT                   /product="MORN repeat containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG125708.1 transcript_id=mCT173566.0
FT                   protein_id=mCP96485.0 isoform=CRA_b"
FT                   /protein_id="EDL38520.1"
FT                   /translation="TEARSVLEPSSLQPAELASLGESQSRESLSFTSPSNGDCTRTTSG
FT                   ICERNGTGTHTTPNGIVYTGSWKDDKMNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFP
FT                   TGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKLYM"
FT   gene            24026967..>24049864
FT                   /locus_tag="mCG_123611"
FT                   /note="gene_id=mCG123611.1"
FT   mRNA            join(24026967..24027157,24028848..24029014,
FT                   24032108..24032167,24034408..24034632,24039789..24039918,
FT                   24044730..24044862,24046718..24046801,24047650..24047733,
FT                   24049736..>24049864)
FT                   /locus_tag="mCG_123611"
FT                   /product="mCG123611"
FT                   /note="gene_id=mCG123611.1 transcript_id=mCT124844.1
FT                   created on 23-SEP-2002"
FT   CDS             join(24027054..24027157,24028848..24029014,
FT                   24032108..24032167,24034408..24034632,24039789..24039918,
FT                   24044730..24044862,24046718..24046801,24047650..24047733,
FT                   24049736..>24049864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123611"
FT                   /product="mCG123611"
FT                   /note="gene_id=mCG123611.1 transcript_id=mCT124844.1
FT                   protein_id=mCP71290.1"
FT                   /protein_id="EDL38521.1"
FT                   /translation="MSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKAKKAQKEEHGAQ
FT                   AGPASAPAPGSAPTQGSPFRSINVPEAGLPSDDFTNMLPSQNYEKAQESRSVHVGDSNV
FT                   KGMMGPGVNPTTPESDENLKPSLSAEIQSKGHHTPGLWRQPKEGKEWGEEYVTKDHPDK
FT                   LKDAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
FT                   RNPKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYV
FT                   AYLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHP
FT                   DYYLLLVCVQRLRVFISHYTLLFQCNEDLLIQ"
FT   gene            24050646..24068309
FT                   /locus_tag="mCG_17908"
FT                   /note="gene_id=mCG17908.2"
FT   mRNA            join(24050646..24050900,24052457..24053258,
FT                   24060802..24060941,24065831..24065905,24067664..24068309)
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, transcript variant mCT173568"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT173568.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(24050646..24050900,24052457..24053258,
FT                   24060802..24060941,24067053..24067265)
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, transcript variant mCT17357"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT17357.2 created
FT                   on 23-SEP-2002"
FT   mRNA            join(24050646..24050900,24052457..24053258,
FT                   24060802..24060941,24063683..24063919)
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, transcript variant mCT173567"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT173567.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(24050743..24050900,24052457..24053258,
FT                   24060802..24060941,24067053..24067065)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, isoform CRA_c"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT17357.2
FT                   protein_id=mCP15309.2 isoform=CRA_c"
FT                   /protein_id="EDL38524.1"
FT                   /translation="MAKLYKGLASQCANAGQDASPNAGQEAVHDSGVHSEEMLQPYPSS
FT                   SSSAPAVSHLMAPAKKGQQQQSLMESMQPGKPGDWELEGRKHERPESLLAPAQFCAAEQ
FT                   DVKALAGPLQAIPEMDFEPSSAEPLGNVERSLRGPPELLPDARGFVPAGYEEFEYGGEI
FT                   FALPAPYDEEPFQAPALFDNCSPASSESSLDICFLRPVSFAMEAERPEHALQPLPKSAT
FT                   SPASSSGAYKLEAAQAQAHGKAKPLSRSLKEFPRTPPAEGVAPRLYSTRSSSGGRAPLK
FT                   VERAPAPHGPAAAAAASRGAPRTFFPQQRSQSEKQTYLEEMHLEDATRFCPKEERESEQ
FT                   TSFSDQNPRQDQKGGFRSSFRKLFKKNSSL"
FT   CDS             join(24050743..24050900,24052457..24053258,
FT                   24060802..24060941,24065831..24065882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, isoform CRA_b"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT173568.0
FT                   protein_id=mCP96487.0 isoform=CRA_b"
FT                   /protein_id="EDL38523.1"
FT                   /translation="MAKLYKGLASQCANAGQDASPNAGQEAVHDSGVHSEEMLQPYPSS
FT                   SSSAPAVSHLMAPAKKGQQQQSLMESMQPGKPGDWELEGRKHERPESLLAPAQFCAAEQ
FT                   DVKALAGPLQAIPEMDFEPSSAEPLGNVERSLRGPPELLPDARGFVPAGYEEFEYGGEI
FT                   FALPAPYDEEPFQAPALFDNCSPASSESSLDICFLRPVSFAMEAERPEHALQPLPKSAT
FT                   SPASSSGAYKLEAAQAQAHGKAKPLSRSLKEFPRTPPAEGVAPRLYSTRSSSGGRAPLK
FT                   VERAPAPHGPAAAAAASRGAPRTFFPQQRSQSEKQTYLEEMHLEDATRFCPKEERESEQ
FT                   TSFSDQNPRQDQKGGFRSSFRKLFKKKNGNSTGEDFCGPWGWW"
FT   CDS             join(24050743..24050900,24052457..24053258,
FT                   24060802..24060941,24063683..24063791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17908"
FT                   /product="mCG17908, isoform CRA_a"
FT                   /note="gene_id=mCG17908.2 transcript_id=mCT173567.0
FT                   protein_id=mCP96486.0 isoform=CRA_a"
FT                   /protein_id="EDL38522.1"
FT                   /translation="MAKLYKGLASQCANAGQDASPNAGQEAVHDSGVHSEEMLQPYPSS
FT                   SSSAPAVSHLMAPAKKGQQQQSLMESMQPGKPGDWELEGRKHERPESLLAPAQFCAAEQ
FT                   DVKALAGPLQAIPEMDFEPSSAEPLGNVERSLRGPPELLPDARGFVPAGYEEFEYGGEI
FT                   FALPAPYDEEPFQAPALFDNCSPASSESSLDICFLRPVSFAMEAERPEHALQPLPKSAT
FT                   SPASSSGAYKLEAAQAQAHGKAKPLSRSLKEFPRTPPAEGVAPRLYSTRSSSGGRAPLK
FT                   VERAPAPHGPAAAAAASRGAPRTFFPQQRSQSEKQTYLEEMHLEDATRFCPKEERESEQ
FT                   TSFSDQNPRQDQKGGFRSSFRKLFKKKGLFGWWPHTPRVLLRDEARHGTRCSRKPEKGF
FT                   SSL"
FT   gene            complement(24051322..24053008)
FT                   /locus_tag="mCG_148333"
FT                   /note="gene_id=mCG148333.0"
FT   mRNA            complement(24051322..24053008)
FT                   /locus_tag="mCG_148333"
FT                   /product="mCG148333"
FT                   /note="gene_id=mCG148333.0 transcript_id=mCT188596.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(24052022..24052195)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148333"
FT                   /product="mCG148333"
FT                   /note="gene_id=mCG148333.0 transcript_id=mCT188596.0
FT                   protein_id=mCP108812.0"
FT                   /protein_id="EDL38525.1"
FT                   /translation="MPSFQCTYRSIDTYIHTYYKKKKKQQPGKSQLPSSVTETSHGGQT
FT                   KAVTIAGAWWKL"
FT   gene            complement(24073216..>24158977)
FT                   /gene="Sos1"
FT                   /locus_tag="mCG_17903"
FT                   /note="gene_id=mCG17903.3"
FT   mRNA            complement(join(24073216..24078136,24079187..24079305,
FT                   24086153..24086420,24087708..24087824,24088030..24088202,
FT                   24093021..24093138,24094365..24094527,24098440..24098559,
FT                   24099694..24099916,24101353..24101456,24101787..24101909,
FT                   24102801..24102882,24112131..24112786,24113526..24113653,
FT                   24124093..24124191,24124265..24124375,24127921..24128064,
FT                   24130644..24130853,24132427..24132591,24133723..24133854,
FT                   24138593..24138718,24158424..24158525,24158726..>24158977))
FT                   /gene="Sos1"
FT                   /locus_tag="mCG_17903"
FT                   /product="Son of sevenless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG17903.3 transcript_id=mCT17353.3 created
FT                   on 30-NOV-2004"
FT   CDS             complement(join(24077645..24078136,24079187..24079305,
FT                   24086153..24086420,24087708..24087824,24088030..24088202,
FT                   24093021..24093138,24094365..24094527,24098440..24098559,
FT                   24099694..24099916,24101353..24101456,24101787..24101909,
FT                   24102801..24102882,24112131..24112786,24113526..24113653,
FT                   24124093..24124191,24124265..24124375,24127921..24128064,
FT                   24130644..24130853,24132427..24132591,24133723..24133854,
FT                   24138593..24138718,24158424..>24158522))
FT                   /codon_start=1
FT                   /gene="Sos1"
FT                   /locus_tag="mCG_17903"
FT                   /product="Son of sevenless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG17903.3 transcript_id=mCT17353.3
FT                   protein_id=mCP15311.2"
FT                   /protein_id="EDL38526.1"
FT                   /translation="PAGTMQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESN
FT                   DDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRR
FT                   NPLSLPAERIHHLLREVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITK
FT                   QDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRE
FT                   LNLIIKVFREPFVSNSKLFSSNDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHP
FT                   LVGSCFEDLAEELAFDPYESYARDILRPGFHGHFLSQLSKPGAALYLQSIGEGFKEAVQ
FT                   YVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSL
FT                   AKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVG
FT                   AKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHA
FT                   FEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTVLQEEKEEQMRLPSA
FT                   EVYRFAEPDSEENILFEENVQPKAGIPIIKAGTVLKLIERLTYHMYADPNFVRTFLTTY
FT                   RSFCRPQELLSLLIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVL
FT                   NVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPG
FT                   HNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSV
FT                   WTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNN
FT                   FNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPC
FT                   VPFFGIYLTNILKTEEGNPEVLRRHGKELINFSKRRRVAEITGEIQQYQNQPYCLRVEP
FT                   DIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRHPKPLPRFPKKYSYPLKSPGVRPSN
FT                   PRPGTMRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGTSSNTDVCS
FT                   VFDSDHSASPFHSRSASVSSISLSKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHL
FT                   DSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQP
FT                   PPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEMDLHSIAGPPVPP
FT                   RQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS"
FT   gene            complement(<24222099..24255888)
FT                   /locus_tag="mCG_17912"
FT                   /note="gene_id=mCG17912.1"
FT   mRNA            complement(join(<24222099..24222303,24226179..24226269,
FT                   24229314..24229386,24234803..24234924,24238854..24239078,
FT                   24255760..24255888))
FT                   /locus_tag="mCG_17912"
FT                   /product="mCG17912"
FT                   /note="gene_id=mCG17912.1 transcript_id=mCT17361.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(<24222099..24222303,24226179..24226269,
FT                   24229314..24229386,24234803..24234924,24238854..24239021))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17912"
FT                   /product="mCG17912"
FT                   /note="gene_id=mCG17912.1 transcript_id=mCT17361.2
FT                   protein_id=mCP15298.2"
FT                   /protein_id="EDL38527.1"
FT                   /translation="MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVR
FT                   KIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIK
FT                   SVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVAT
FT                   RWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGR"
FT   gene            complement(24258950..>24420826)
FT                   /locus_tag="mCG_17909"
FT                   /note="gene_id=mCG17909.2"
FT   mRNA            complement(join(24258950..24260367,24260994..24261049,
FT                   24263153..24263223,24271347..24271439,24271516..24271584,
FT                   24277580..24277751,24282104..24282207,24283894..24283952,
FT                   24285678..24285795,24285871..24285931,24290271..24290350,
FT                   24292553..24292637,24296080..24296121,24296527..24296639,
FT                   24297629..24297788,24299098..24299140,24300906..24300959,
FT                   24301169..24301207,24306662..24307592))
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, transcript variant mCT172479"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT172479.0 created
FT                   on 30-AUG-2002"
FT   mRNA            complement(join(24258955..24260367,24260994..24261049,
FT                   24263153..24263223,24271347..24271439,24271516..24271584,
FT                   24277580..24277751,24282104..24282207,24283894..24283952,
FT                   24285678..24285795,24285871..24285931,24290271..24290350,
FT                   24292553..24292637,24296080..24296121,24296527..24296639,
FT                   24297629..24297788,24299098..24299140,24300906..24300959,
FT                   24301169..24301207,24306662..24306720,24313052..24313110,
FT                   24319358..24319436,24326776..24326886,24326971..24327052,
FT                   24327136..24327198,24327358..24327489,24332167..24332239,
FT                   24333725..24333767,24336502..24336549,24337052..24337107,
FT                   24338497..24338561,24346633..24346723,24363523..24363580,
FT                   24420783..>24420826))
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, transcript variant mCT17358"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT17358.2 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(24260280..24260367,24260994..24261049,
FT                   24263153..24263223,24271347..24271439,24271516..24271584,
FT                   24277580..24277751,24282104..24282207,24283894..24283952,
FT                   24285678..24285795,24285871..24285931,24290271..24290350,
FT                   24292553..24292637,24296080..24296121,24296527..24296639,
FT                   24297629..24297788,24299098..24299140,24300906..24300959,
FT                   24301169..24301207,24306662..24306720,24313052..24313110,
FT                   24319358..24319436,24326776..24326886,24326971..24327052,
FT                   24327136..24327198,24327358..24327489,24332167..24332239,
FT                   24333725..24333767,24336502..24336549,24337052..24337107,
FT                   24338497..24338561,24346633..24346723,24363523..24363580,
FT                   24420783..>24420824))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, isoform CRA_c"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT17358.2
FT                   protein_id=mCP15304.2 isoform=CRA_c"
FT                   /protein_id="EDL38530.1"
FT                   /translation="IQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEII
FT                   MMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQ
FT                   GLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPE
FT                   VAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKL
FT                   KWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHD
FT                   FDDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELDLQLEY
FT                   GQGHQSHCFLGGNKSLLKSVEEELHQRGHVAHLEDDEGDDDDSKHSTMKAKVPPPLPPK
FT                   PKSIFIPQDTHSAEDGNQGTIKRCPSSGSPAKPSHVPPRPPPPRLPPQKPAVLGNGVNS
FT                   FQLNGERDGSLYQQQSEQRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCP
FT                   LKIHCATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLL
FT                   SVSGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFAVSAKIPETKWCQK
FT                   CCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIEFPMPCPLRMFEMLVVPEQ
FT                   EYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDAPQTSVTHVTQLERDTILVCLD
FT                   CCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQE
FT                   ISDNTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY"
FT   CDS             complement(join(24260280..24260367,24260994..24261049,
FT                   24263153..24263223,24271347..24271439,24271516..24271584,
FT                   24277580..24277751,24282104..24282207,24283894..24283952,
FT                   24285678..24285795,24285871..24285931,24290271..24290350,
FT                   24292553..24292637,24296080..24296121,24296527..24296639,
FT                   24297629..24297788,24299098..24299133))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, isoform CRA_a"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT172479.0
FT                   protein_id=mCP95398.0 isoform=CRA_a"
FT                   /protein_id="EDL38528.1"
FT                   /translation="MKAKVPPPLPPKPKSIFIPQDTHSAEDGNQGTIKRCPSSGSPAKP
FT                   SHVPPRPPPPRLPPQKPAVLGNGVNSFQLNGERDGSLYQQQSEQRGTNLSRKEKKDVPK
FT                   PISNGLPPTPKVHMGACFSKVFNGCPLKIHCATSWINPDTRDQYLIFGAEEGIYTLNLN
FT                   ELHETSMEQLFPRRCTWLYVMNNCLLSVSGKASQLYSHNLPGLFDYARQMQKLPVAIPA
FT                   HKLPDRILPRKFAVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQK
FT                   FMLIKHIEFPMPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWF
FT                   TESDAPQTSVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVC
FT                   LQDSVLAFWKHGMQGRSFRSNEVTQEISDNTRIFRLLGSDRVVVLESRPTDNPTANSNL
FT                   YILAGHENSY"
FT   mRNA            complement(join(<24306662..24306720,24311923..24311985,
FT                   24313052..24313110,24319358..24319436,24326776..24326886,
FT                   24326971..24327052,24327136..24327198,24327358..24327489,
FT                   24332167..>24332247))
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, transcript variant mCT172480"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT172480.0 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(<24306662..24306720,24311923..24311985,
FT                   24313052..24313110,24319358..24319436,24326776..24326886,
FT                   24326971..24327052,24327136..24327198,24327358..24327489,
FT                   24332167..>24332246))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17909"
FT                   /product="mCG17909, isoform CRA_b"
FT                   /note="gene_id=mCG17909.2 transcript_id=mCT172480.0
FT                   protein_id=mCP95399.0 isoform=CRA_b"
FT                   /protein_id="EDL38529.1"
FT                   /translation="LIADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLC
FT                   DLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMAL
FT                   TKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPH
FT                   RIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELPDSDGFFDSSEEIYYTARSN
FT                   LDLQLEYGQGHQSHCFLGGN"
FT   gene            <24590174..24626234
FT                   /locus_tag="mCG_145584"
FT                   /note="gene_id=mCG145584.0"
FT   mRNA            join(<24590174..24590339,24616362..24616544,
FT                   24616661..24616796,24619963..24620137,24625148..24625520,
FT                   24626131..24626234)
FT                   /locus_tag="mCG_145584"
FT                   /product="mCG145584, transcript variant mCT185008"
FT                   /note="gene_id=mCG145584.0 transcript_id=mCT185008.0
FT                   created on 05-JUN-2003"
FT   mRNA            join(<24590179..24590339,24616362..24616544,
FT                   24616661..24616796,24618137..24618215,24619963..24620653)
FT                   /locus_tag="mCG_145584"
FT                   /product="mCG145584, transcript variant mCT193674"
FT                   /note="gene_id=mCG145584.0 transcript_id=mCT193674.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<24616420..24616544,24616661..24616796,
FT                   24618137..24618215,24619963..24620222)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145584"
FT                   /product="mCG145584, isoform CRA_b"
FT                   /note="gene_id=mCG145584.0 transcript_id=mCT193674.0
FT                   protein_id=mCP114643.0 isoform=CRA_b"
FT                   /protein_id="EDL38532.1"
FT                   /translation="SSCTGLDPGIRLKRCRSSAECHVPTVRPRLMLDMFVVLGKFRPSL
FT                   HFSSCHPETICLFFVSWRLLPSVASSCQEWIFLKYQEVTNNKQSWADAIGGCFAHADAA
FT                   CRQECLTRQEHLERARENTSCHPCHPCQGCLLRAPDWPAVTTLQQDPSAHVYWESLIAE
FT                   AKRPRAQNWCCLYRPRRGVSHTRIGYALRLICMFLI"
FT   CDS             join(<24616420..24616544,24616661..24616796,
FT                   24619963..24620055)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145584"
FT                   /product="mCG145584, isoform CRA_a"
FT                   /note="gene_id=mCG145584.0 transcript_id=mCT185008.0
FT                   protein_id=mCP106306.0 isoform=CRA_a"
FT                   /protein_id="EDL38531.1"
FT                   /translation="SSCTGLDPGIRLKRCRSSAECHVPTVRPRLMLDMFVVLGKFRPSL
FT                   HFSSCHPETICLFFVSWRLLPSVASSCQEWIFLKYQEVTNNKNIWKGPERTHHVIPVIL
FT                   VKAVSCARRTGQQ"
FT   gene            complement(24631111..24631983)
FT                   /pseudo
FT                   /locus_tag="mCG_13172"
FT                   /note="gene_id=mCG13172.1"
FT   mRNA            complement(24631111..24631983)
FT                   /pseudo
FT                   /locus_tag="mCG_13172"
FT                   /note="gene_id=mCG13172.1 transcript_id=mCT11747.1 created
FT                   on 27-SEP-2002"
FT   gene            <24637819..24694932
FT                   /gene="2810417M05Rik"
FT                   /locus_tag="mCG_13171"
FT                   /note="gene_id=mCG13171.2"
FT   mRNA            join(<24637819..24638277,24679292..24679405,
FT                   24682816..24682953,24693953..24694932)
FT                   /gene="2810417M05Rik"
FT                   /locus_tag="mCG_13171"
FT                   /product="RIKEN cDNA 2810417M05"
FT                   /note="gene_id=mCG13171.2 transcript_id=mCT11746.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(<24637821..24638277,24679292..24679405,
FT                   24682816..24682953,24693953..24694194)
FT                   /codon_start=1
FT                   /gene="2810417M05Rik"
FT                   /locus_tag="mCG_13171"
FT                   /product="RIKEN cDNA 2810417M05"
FT                   /note="gene_id=mCG13171.2 transcript_id=mCT11746.2
FT                   protein_id=mCP23679.2"
FT                   /protein_id="EDL38533.1"
FT                   /translation="ALCLAAAASPPAAAAGREAMEPRALVTALSLGLSLCSLGLLVTAI
FT                   FTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRS
FT                   DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKY
FT                   HFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEE
FT                   SLTQHVAGLLFLMTGIFCTISLCTYAASVSYDLNRVPKLIYSLPHDVEHGYSWSIFCAW
FT                   CSLGFIVAAGGLCIAYPFISRTKIAHLKSGRDSTV"
FT   gene            24700950..>24702212
FT                   /locus_tag="mCG_148336"
FT                   /note="gene_id=mCG148336.0"
FT   mRNA            24700950..>24702212
FT                   /locus_tag="mCG_148336"
FT                   /product="mCG148336"
FT                   /note="gene_id=mCG148336.0 transcript_id=mCT188599.0
FT                   created on 13-JAN-2004"
FT   CDS             24701940..>24702212
FT                   /codon_start=1
FT                   /locus_tag="mCG_148336"
FT                   /product="mCG148336"
FT                   /note="gene_id=mCG148336.0 transcript_id=mCT188599.0
FT                   protein_id=mCP108816.0"
FT                   /protein_id="EDL38534.1"
FT                   /translation="MFLKYSKYHTIIARCEHRTVRLFVRSFVRSFVHSFIHSVSQSFFL
FT                   IYLFTIYLFLRQGFSGTCSVEQVWPGTGNLPASVSQMLRLKACATT"
FT   gene            complement(24719429..>24760057)
FT                   /locus_tag="mCG_15884"
FT                   /note="gene_id=mCG15884.2"
FT   mRNA            complement(join(24719429..24720069,24725731..24725839,
FT                   24730625..24730739,24731232..24731303,24737203..24737290,
FT                   24744937..24744989,24749124..24749533,24750775..24750910,
FT                   24759908..>24760043))
FT                   /locus_tag="mCG_15884"
FT                   /product="mCG15884, transcript variant mCT11675"
FT                   /note="gene_id=mCG15884.2 transcript_id=mCT11675.1 created
FT                   on 30-AUG-2002"
FT   mRNA            complement(join(24719431..24720069,24723723..24724113,
FT                   24725731..24725839,24730625..24730739,24731232..24731303,
FT                   24737203..24737290,24744937..24744989,24747895..24747972,
FT                   24749124..24749533,24750775..24750910,24759908..>24760057))
FT                   /locus_tag="mCG_15884"
FT                   /product="mCG15884, transcript variant mCT193667"
FT                   /note="gene_id=mCG15884.2 transcript_id=mCT193667.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(24719670..24720069,24725731..24725839,
FT                   24730625..24730739,24731232..24731303,24737203..24737290,
FT                   24744937..24744989,24749124..24749533,24750775..24750910,
FT                   24759908..>24760042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15884"
FT                   /product="mCG15884, isoform CRA_a"
FT                   /note="gene_id=mCG15884.2 transcript_id=mCT11675.1
FT                   protein_id=mCP23682.1 isoform=CRA_a"
FT                   /protein_id="EDL38535.1"
FT                   /translation="LSAMAVAQADPGSDPAGGARFFCTAGRGLEPFLMREVRARLEATQ
FT                   VEYISGKVFFTTCSDLPSMKKLKSAERLFVLIKKQLPIAVSSLHKGKILNEMQRFVNDD
FT                   PGSWLEAISLWKKLLEHDPKREKVSQRDANPLKRKAGENETIIAKKLKVEEKQEVAKDH
FT                   GESQEDKLLQGSPEQGEAVTRTELQDHRLNSTTEKAADAQDQEDLTFRVSCRCTGNVRK
FT                   VITGQIFMHLSDAYSVVGIPLLRMPLASRTYIQTAGLRSTIAWAMASIAEIKAGALVLD
FT                   PMCGLGTILVEAAEEWPDVFYMGADMSDAQLLGACDNLKAAGLTDRIELLKSSVTDLPL
FT                   PSQSTDVIISDIPFGKKFKLGKDIKSILQEMERVLRVGGAMVLLLSEDHHRHLTDCGGS
FT                   SIPLTSKGHIAEPEMKTLSNPDRTGAPDTASPSQRASSVQCLGRMRPCGSLVPVESFKV
FT                   SLGKTDAFICKYKKAQASGLSSAECHEPGAHTEMAAMQESPSLQDSL"
FT   CDS             complement(join(24723780..24724113,24725731..24725839,
FT                   24730625..24730739,24731232..24731303,24737203..24737290,
FT                   24744937..24744989,24747895..24747972,24749124..24749533,
FT                   24750775..24750910,24759908..>24760057))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15884"
FT                   /product="mCG15884, isoform CRA_b"
FT                   /note="gene_id=mCG15884.2 transcript_id=mCT193667.0
FT                   protein_id=mCP114649.0 isoform=CRA_b"
FT                   /protein_id="EDL38536.1"
FT                   /translation="VSGSRLSAMAVAQADPGSDPAGGARFFCTAGRGLEPFLMREVRAR
FT                   LEATQVEYISGKVFFTTCSDLPSMKKLKSAERLFVLIKKQLPIAVSSLHKGKILNEMQR
FT                   FVNDDPGSWLEAISLWKKLLEHDPKREKVSQRDANPLKRKAGENETIIAKKLKVEEKQE
FT                   VAKDHGESQEDKLLQGSPEQGEAVTRTELQDHRLNSTTEKAADAQDQEDLTFRVSCRCT
FT                   GNVRKVITGQEAGRVIGLALMRQFGWKADLRNPNIEIFMHLSDAYSVVGIPLLRMPLAS
FT                   RTYIQTAGLRSTIAWAMASIAEIKAGALVLDPMCGLGTILVEAAEEWPDVFYMGADMSD
FT                   AQLLGACDNLKAAGLTDRIELLKSSVTDLPLPSQSTDVIISDIPFGKKFKLGKDIKSIL
FT                   QEMERHVYTSWELGLQTAPVAVEVSVGVTLMNLPACLPAACLPACCLPAACLLPACCLP
FT                   ACLPACLPACLPACLPACCLPAACLLPACLPACLPACLPACLPACCLPAACPLSGN"
FT   gene            complement(24939659..24940044)
FT                   /pseudo
FT                   /locus_tag="mCG_1039297"
FT                   /note="gene_id=mCG1039297.1"
FT   mRNA            complement(24939659..24940044)
FT                   /pseudo
FT                   /locus_tag="mCG_1039297"
FT                   /note="gene_id=mCG1039297.1 transcript_id=mCT157001.1
FT                   created on 28-OCT-2002"
FT   gene            complement(25080266..25433157)
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /note="gene_id=mCG140710.0"
FT   mRNA            complement(join(25080266..25080712,25083471..25083728,
FT                   25102728..25103003,25123371..25123470,25127833..25127963,
FT                   25132934..25133002,25136837..25136851,25136958..25136975,
FT                   25137388..25137408,25140672..25140778,25342811..25344640,
FT                   25433089..25433157))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170879"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170879.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(25080684..25080712,25083471..25083728,
FT                   25102728..25103003,25123371..25123470,25127833..25127963,
FT                   25132934..25133002,25136837..25136851,25136958..25136975,
FT                   25137388..25137408,25140672..25140778,25342811..25344609))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170879.0
FT                   protein_id=mCP93797.0 isoform=CRA_a"
FT                   /protein_id="EDL38537.1"
FT                   /translation="MLRLSLPPNVSMGFRLVALVALLFSHVDHITADTEAETGGNETTE
FT                   CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVIT
FT                   SQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDL
FT                   GPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVS
FT                   SPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPA
FT                   SKTEIEMDGKVVNSHVDNFLDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIE
FT                   QLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAE
FT                   NDPVSKIFFEQGTYQCLENCGTVALTIMRRGGDLSTTVFVDFRTEDGTANAGSDYEFTE
FT                   GTVIFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVRVSSDVSEDGILESNHASSIAC
FT                   LGSPSTATITIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEG
FT                   TARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK
FT                   ALLLNELGGFTLTGKEMYGQPIFRKVHARDHPIPSTVITISEEYDDKQPLTSKEEEERR
FT                   IAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA
FT                   GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLT
FT                   AFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSN
FT                   AVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEI
FT                   GAIFGMSIIL"
FT   mRNA            complement(join(25083185..25083728,25102728..25103003,
FT                   25123371..25123470,25127833..25127963,25132934..25133002,
FT                   25136837..25136851,25136958..25136975,25137388..25137408,
FT                   25140672..25140778,25342811..25344640,25433089..25433157))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170884"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170884.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(25083352..25083728,25102728..25103003,
FT                   25123371..25123470,25127833..25127963,25132934..25133002,
FT                   25136837..25136851,25136958..25136975,25137388..25137408,
FT                   25140672..25140778,25342811..25344609))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_f"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170884.0
FT                   protein_id=mCP93802.0 isoform=CRA_f"
FT                   /db_xref="GOA:G3X9J1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002987"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR004836"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="MGI:MGI:107956"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J1"
FT                   /protein_id="EDL38542.1"
FT                   /translation="MLRLSLPPNVSMGFRLVALVALLFSHVDHITADTEAETGGNETTE
FT                   CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVIT
FT                   SQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDL
FT                   GPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVS
FT                   SPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPA
FT                   SKTEIEMDGKVVNSHVDNFLDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIE
FT                   QLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAE
FT                   NDPVSKIFFEQGTYQCLENCGTVALTIMRRGGDLSTTVFVDFRTEDGTANAGSDYEFTE
FT                   GTVIFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVRVSSDVSEDGILESNHASSIAC
FT                   LGSPSTATITIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEG
FT                   TARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK
FT                   ALLLNELGGFTLTGKEMYGQPIFRKVHARDHPIPSTVITISEEYDDKQPLTSKEEEERR
FT                   IAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA
FT                   GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLT
FT                   AFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSN
FT                   AVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEI
FT                   GGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF"
FT   mRNA            complement(join(<25083355..25083728,25102728..25103003,
FT                   25123371..25123470,25127833..25127963,25140672..>25140777))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170880"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170880.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(<25083355..25083728,25102728..25103003,
FT                   25123371..25123470,25127833..25127963,25140672..>25140777))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_b"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170880.0
FT                   protein_id=mCP93800.0 isoform=CRA_b"
FT                   /protein_id="EDL38538.1"
FT                   /translation="KTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKKEEYDDKQPLT
FT                   SKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQF
FT                   IEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVS
FT                   ILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADAS
FT                   IGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVL
FT                   LYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF"
FT   mRNA            complement(join(<25127950..25127963,25132934..25133002,
FT                   25136958..25136975,25140054..>25140159))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170883"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170883.0
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(<25127950..25127963,25136958..25136975,
FT                   25137388..25137408,25140054..>25140159))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170881"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170881.0
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(<25127950..25127978,25140052..>25140159))
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, transcript variant mCT170882"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170882.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(<25127950..25127963,25132934..25133002,
FT                   25136958..25136975,25140054..>25140159))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_d"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170883.0
FT                   protein_id=mCP93799.0 isoform=CRA_d"
FT                   /protein_id="EDL38540.1"
FT                   /translation="RKIITIRIFDREEYEKECSFSLVLEEPKWLRRGLKGGFTLTGQPI
FT                   FRKVHARDHPIPSTVITISEEYDD"
FT   CDS             complement(join(<25127950..25127963,25136958..25136975,
FT                   25137388..25137408,25140054..>25140159))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_c"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170881.0
FT                   protein_id=mCP93798.0 isoform=CRA_c"
FT                   /protein_id="EDL38539.1"
FT                   /translation="RKIITIRIFDREEYEKECSFSLVLEEPKWLRRGLKALLLNELGGF
FT                   TLTEEYDD"
FT   CDS             complement(join(<25127950..25127978,25140052..>25140159))
FT                   /codon_start=1
FT                   /gene="Slc8a1"
FT                   /locus_tag="mCG_140710"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 1, isoform CRA_e"
FT                   /note="gene_id=mCG140710.0 transcript_id=mCT170882.0
FT                   protein_id=mCP93801.0 isoform=CRA_e"
FT                   /protein_id="EDL38541.1"
FT                   /translation="RKIITIRIFDREEYEKECSFSLVLEEPKWLRRGLKGPSLYQRNMM
FT                   T"
FT   gene            complement(25486127..25486501)
FT                   /pseudo
FT                   /locus_tag="mCG_50045"
FT                   /note="gene_id=mCG50045.1"
FT   mRNA            complement(25486127..25486501)
FT                   /pseudo
FT                   /locus_tag="mCG_50045"
FT                   /note="gene_id=mCG50045.1 transcript_id=mCT50228.1 created
FT                   on 05-NOV-2002"
FT   gene            complement(25650309..25651146)
FT                   /pseudo
FT                   /locus_tag="mCG_141438"
FT                   /note="gene_id=mCG141438.0"
FT   mRNA            complement(25650309..25651146)
FT                   /pseudo
FT                   /locus_tag="mCG_141438"
FT                   /note="gene_id=mCG141438.0 transcript_id=mCT175407.0
FT                   created on 05-NOV-2002"
FT   gene            complement(25885690..25886975)
FT                   /pseudo
FT                   /locus_tag="mCG_1039298"
FT                   /note="gene_id=mCG1039298.1"
FT   mRNA            complement(25885690..25886975)
FT                   /pseudo
FT                   /locus_tag="mCG_1039298"
FT                   /note="gene_id=mCG1039298.1 transcript_id=mCT157002.1
FT                   created on 28-OCT-2002"
FT   gene            <26049672..26050367
FT                   /locus_tag="mCG_55220"
FT                   /note="gene_id=mCG55220.2"
FT   mRNA            <26049672..26050367
FT                   /locus_tag="mCG_55220"
FT                   /product="mCG55220"
FT                   /note="gene_id=mCG55220.2 transcript_id=mCT55403.1 created
FT                   on 25-OCT-2002"
FT   CDS             <26049673..26050209
FT                   /codon_start=1
FT                   /locus_tag="mCG_55220"
FT                   /product="mCG55220"
FT                   /note="gene_id=mCG55220.2 transcript_id=mCT55403.1
FT                   protein_id=mCP43053.1"
FT                   /protein_id="EDL38543.1"
FT                   /translation="FQTGKKLMAKCRMLIQENQELGMQLSQGRISQLEADLALQKKDSE
FT                   ELKSSQNELNDIIIQLEEEVECMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRT
FT                   TSPKPVDHAEATAKTAAAWQMDQVMAAPSARGRLGLDFTGRGAHLRMTFLLLQGILIRS
FT                   PAAQRRELAEEVVVT"
FT   gene            complement(26103922..26104951)
FT                   /pseudo
FT                   /locus_tag="mCG_122560"
FT                   /note="gene_id=mCG122560.0"
FT   mRNA            complement(26103922..26104951)
FT                   /pseudo
FT                   /locus_tag="mCG_122560"
FT                   /note="gene_id=mCG122560.0 transcript_id=mCT123782.0
FT                   created on 27-SEP-2002"
FT   gene            26233298..26234483
FT                   /pseudo
FT                   /locus_tag="mCG_19681"
FT                   /note="gene_id=mCG19681.1"
FT   mRNA            26233298..26234483
FT                   /pseudo
FT                   /locus_tag="mCG_19681"
FT                   /note="gene_id=mCG19681.1 transcript_id=mCT20647.2 created
FT                   on 27-SEP-2002"
FT   gene            26671777..26672702
FT                   /pseudo
FT                   /locus_tag="mCG_59972"
FT                   /note="gene_id=mCG59972.2"
FT   mRNA            join(26671777..26672036,26672418..26672702)
FT                   /pseudo
FT                   /locus_tag="mCG_59972"
FT                   /note="gene_id=mCG59972.2 transcript_id=mCT60155.2 created
FT                   on 05-NOV-2002"
FT   gene            complement(26755533..>26793849)
FT                   /locus_tag="mCG_145593"
FT                   /note="gene_id=mCG145593.0"
FT   mRNA            complement(join(26755533..26756245,26758753..26759032,
FT                   26793143..26793363,26793530..>26793849))
FT                   /locus_tag="mCG_145593"
FT                   /product="mCG145593"
FT                   /note="gene_id=mCG145593.0 transcript_id=mCT185017.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(26756167..26756245,26758753..>26758940))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145593"
FT                   /product="mCG145593"
FT                   /note="gene_id=mCG145593.0 transcript_id=mCT185017.0
FT                   protein_id=mCP106315.0"
FT                   /protein_id="EDL38544.1"
FT                   /translation="VFIPLASRHLQFLNIPRRSERPRNIKGVLSLHPDVIGVNYSTRYY
FT                   FGSRKNRRQDPPHHVLSRSKSPRKYRAPVLMRTIARDQKGLGQ"
FT   gene            <26923036..26932320
FT                   /gene="AW548124"
FT                   /locus_tag="mCG_20075"
FT                   /note="gene_id=mCG20075.2"
FT   mRNA            join(<26923036..26923340,26927270..26927392,
FT                   26928198..26928469,26929023..26929102,26929359..26929463,
FT                   26931016..26931189,26931438..26932320)
FT                   /gene="AW548124"
FT                   /locus_tag="mCG_20075"
FT                   /product="expressed sequence AW548124"
FT                   /note="gene_id=mCG20075.2 transcript_id=mCT18716.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(<26923038..26923340,26927270..26927392,
FT                   26928198..26928469,26929023..26929102,26929359..26929463,
FT                   26931016..26931189,26931438..26931523)
FT                   /codon_start=1
FT                   /gene="AW548124"
FT                   /locus_tag="mCG_20075"
FT                   /product="expressed sequence AW548124"
FT                   /note="gene_id=mCG20075.2 transcript_id=mCT18716.2
FT                   protein_id=mCP23641.2"
FT                   /protein_id="EDL38545.1"
FT                   /translation="PGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRL
FT                   PGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYG
FT                   YCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVT
FT                   LLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGM
FT                   NEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFR
FT                   SGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQC
FT                   RAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG"
FT   gene            26992279..26992843
FT                   /pseudo
FT                   /locus_tag="mCG_20068"
FT                   /note="gene_id=mCG20068.1"
FT   mRNA            26992279..26992843
FT                   /pseudo
FT                   /locus_tag="mCG_20068"
FT                   /note="gene_id=mCG20068.1 transcript_id=mCT18251.1 created
FT                   on 27-SEP-2002"
FT   gene            27054036..27183363
FT                   /gene="Eml4"
FT                   /locus_tag="mCG_124075"
FT                   /note="gene_id=mCG124075.0"
FT   mRNA            join(27054036..27054186,27113084..27113267,
FT                   27124666..27124795,27130282..27130410,27131057..27131082,
FT                   27143126..27143243,27144391..27144540,27147717..27147786,
FT                   27149033..27149143,27151247..27151342,27153733..27153867,
FT                   27154057..27154192,27157517..27157668,27159167..27159292,
FT                   27159377..27159508,27160132..27160199,27164670..27164758,
FT                   27166638..27166735,27176187..27176274,27176791..27176889,
FT                   27180233..27180363,27180735..27183363)
FT                   /gene="Eml4"
FT                   /locus_tag="mCG_124075"
FT                   /product="echinoderm microtubule associated protein like 4,
FT                   transcript variant mCT125313"
FT                   /note="gene_id=mCG124075.0 transcript_id=mCT125313.1
FT                   created on 10-SEP-2002"
FT   CDS             join(27113255..27113267,27124666..27124795,
FT                   27130282..27130410,27131057..27131082,27143126..27143243,
FT                   27144391..27144540,27147717..27147786,27149033..27149143,
FT                   27151247..27151342,27153733..27153867,27154057..27154192,
FT                   27157517..27157668,27159167..27159292,27159377..27159508,
FT                   27160132..27160199,27164670..27164758,27166638..27166735,
FT                   27176187..27176274,27176791..27176889,27180233..27180363,
FT                   27180735..27181196)
FT                   /codon_start=1
FT                   /gene="Eml4"
FT                   /locus_tag="mCG_124075"
FT                   /product="echinoderm microtubule associated protein like 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG124075.0 transcript_id=mCT125313.1
FT                   protein_id=mCP70962.1 isoform=CRA_a"
FT                   /protein_id="EDL38546.1"
FT                   /translation="MPSKGQPSLREAISMSCITNGSGISRKQNHTSSVSIARKETLSSA
FT                   AKSIKRPPTAEKSHNSWENSDDSRNKLMKTVSTSKLISKVIKNADKHKDVIVNQEGEYI
FT                   KMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEYGYRGKDCRANVYLLPTGEIVYFI
FT                   ASVVVLFNYEERTQRHYLGHTDCVRCLAVHPDKIRIATGQIAGVDKDGRPLQPHVRVWD
FT                   SVSLTTLHVIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKIAEIK
FT                   TTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFL
FT                   GNGDVLTGDSGGVMLIWSKTMVEPPPGKGPKGVYQINRQIKAHDGSVFTLCQMRNGMLL
FT                   TGGGKDRKIILWDHDLNLEREIEVPDQYGTIRAVAEGRAEQFLVGTSRNFILRGTFNDG
FT                   FQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFH
FT                   PSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYL
FT                   YTVLENGRKYSRYGKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNR
FT                   SDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYP
FT                   CSKAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPVPQNEVITD
FT                   ASVTKTPASSSETARPSNSPPLPPSLPLTGTAEEESRMGSSPTLVENSLEQIAEPSEEQ
FT                   SEWGSEDLGVVIDEEPASELSETQGATELPEEERGITPLC"
FT   mRNA            join(27127648..27128490,27130282..27130410,
FT                   27131057..27131082,27131273..27131305,27143126..27143243,
FT                   27144391..27144540,27147717..27147786,27149033..27149143,
FT                   27151247..27151342,27153733..27153867,27154057..27154192,
FT                   27157517..27157668,27159167..27159292,27159377..27159508,
FT                   27160132..27160199,27164670..27164758,27166638..27166735,
FT                   27176187..27176274,27176791..27176889,27180233..27180363,
FT                   27180735..27183363)
FT                   /gene="Eml4"
FT                   /locus_tag="mCG_124075"
FT                   /product="echinoderm microtubule associated protein like 4,
FT                   transcript variant mCT172963"
FT                   /note="gene_id=mCG124075.0 transcript_id=mCT172963.0
FT                   created on 10-SEP-2002"
FT   CDS             join(27130355..27130410,27131057..27131082,
FT                   27131273..27131305,27143126..27143243,27144391..27144540,
FT                   27147717..27147786,27149033..27149143,27151247..27151342,
FT                   27153733..27153867,27154057..27154192,27157517..27157668,
FT                   27159167..27159292,27159377..27159508,27160132..27160199,
FT                   27164670..27164758,27166638..27166735,27176187..27176274,
FT                   27176791..27176889,27180233..27180363,27180735..27181196)
FT                   /codon_start=1
FT                   /gene="Eml4"
FT                   /locus_tag="mCG_124075"
FT                   /product="echinoderm microtubule associated protein like 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG124075.0 transcript_id=mCT172963.0
FT                   protein_id=mCP95882.0 isoform=CRA_b"
FT                   /protein_id="EDL38547.1"
FT                   /translation="MKTVSTSKLISKVIKNADKHKDVIVNQAKMSTREKNSQEGEYIKM
FT                   FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEYGYRGKDCRANVYLLPTGEIVYFIAS
FT                   VVVLFNYEERTQRHYLGHTDCVRCLAVHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
FT                   SLTTLHVIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKIAEIKTT
FT                   NEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGN
FT                   GDVLTGDSGGVMLIWSKTMVEPPPGKGPKGVYQINRQIKAHDGSVFTLCQMRNGMLLTG
FT                   GGKDRKIILWDHDLNLEREIEVPDQYGTIRAVAEGRAEQFLVGTSRNFILRGTFNDGFQ
FT                   IEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPS
FT                   GTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYT
FT                   VLENGRKYSRYGKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNRSD
FT                   CKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCS
FT                   KAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPVPQNEVITDAS
FT                   VTKTPASSSETARPSNSPPLPPSLPLTGTAEEESRMGSSPTLVENSLEQIAEPSEEQSE
FT                   WGSEDLGVVIDEEPASELSETQGATELPEEERGITPLC"
FT   gene            complement(27204696..27217236)
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /note="gene_id=mCG20067.2"
FT   mRNA            complement(join(27204696..27205509,27206864..27206992,
FT                   27217108..>27217205))
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, transcript variant mCT18250"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT18250.1 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(27204699..27205494,27206685..27206763,
FT                   27206864..27206992,27217108..27217236))
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, transcript variant mCT170896"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170896.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(27204800..27205033,27206969..27206992,
FT                   27217108..27217229))
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, transcript variant mCT170895"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170895.0 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(27204995..27205033,27206969..27206992,
FT                   27217108..27217179))
FT                   /codon_start=1
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, isoform CRA_a"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170895.0
FT                   protein_id=mCP93813.0 isoform=CRA_a"
FT                   /protein_id="EDL38548.1"
FT                   /translation="MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTERSARSLLECRCD"
FT   CDS             complement(join(27205256..27205494,27206685..27206763,
FT                   27206864..27206992,27217108..27217179))
FT                   /codon_start=1
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, isoform CRA_d"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170896.0
FT                   protein_id=mCP93815.0 isoform=CRA_d"
FT                   /protein_id="EDL38551.1"
FT                   /translation="MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLT
FT                   SSVTAYDYSGKNKVPELQKFFQPPFLKENSLLQFGPLANNGTFVQVDAAHPPETRPSRP
FT                   NALPDHHGSDTGRDHLLPDRPLHGLAAQKQMSLPVEDWFTLWHKPFESSRFMFSTWIVY
FT                   LTFCKQRKR"
FT   CDS             complement(join(27205369..27205509,27206864..27206992,
FT                   27217108..>27217203))
FT                   /codon_start=1
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, isoform CRA_c"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT18250.1
FT                   protein_id=mCP23694.1 isoform=CRA_c"
FT                   /protein_id="EDL38550.1"
FT                   /translation="GAKRASANMYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPII
FT                   FATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGVPIHLKRGLPDQMLYRTTMALTLGG
FT                   TIYCLIALYMASQPRNK"
FT   mRNA            complement(join(<27205440..27205509,27206864..27206992,
FT                   27216791..27216921,27217077..>27217168))
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, transcript variant mCT170897"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170897.0 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(<27205440..27205509,27206864..27206992,
FT                   27216791..27216921,27217077..>27217167))
FT                   /codon_start=1
FT                   /gene="Cox7a2l"
FT                   /locus_tag="mCG_20067"
FT                   /product="cytochrome c oxidase subunit VIIa polypeptide
FT                   2-like, isoform CRA_b"
FT                   /note="gene_id=mCG20067.2 transcript_id=mCT170897.0
FT                   protein_id=mCP93814.0 isoform=CRA_b"
FT                   /protein_id="EDL38549.1"
FT                   /translation="FSSFTQKLAGAWASEAYTPQVHFCRVALGRKQQPEAGSREVRAVR
FT                   GFCRPTGPACWCPLVSLTTQAWSGRRGFWGLKPVSTEAPPIIFATPTKLTSSVTAYDYS
FT                   GKNKVPELQKFFQKADGVPIHLKRGLPDQMLYRTTM"
FT   gene            complement(27289794..>27337510)
FT                   /gene="Kcng3"
FT                   /locus_tag="mCG_20071"
FT                   /note="gene_id=mCG20071.2"
FT   mRNA            complement(join(27289794..27292213,27337102..>27337510))
FT                   /gene="Kcng3"
FT                   /locus_tag="mCG_20071"
FT                   /product="potassium voltage-gated channel, subfamily G,
FT                   member 3, transcript variant mCT173569"
FT                   /note="gene_id=mCG20071.2 transcript_id=mCT173569.0 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(27289794..27292213,27337135..>27337493))
FT                   /gene="Kcng3"
FT                   /locus_tag="mCG_20071"
FT                   /product="potassium voltage-gated channel, subfamily G,
FT                   member 3, transcript variant mCT18712"
FT                   /note="gene_id=mCG20071.2 transcript_id=mCT18712.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(27291568..27292213,27337102..>27337508))
FT                   /codon_start=1
FT                   /gene="Kcng3"
FT                   /locus_tag="mCG_20071"
FT                   /product="potassium voltage-gated channel, subfamily G,
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG20071.2 transcript_id=mCT173569.0
FT                   protein_id=mCP96488.0 isoform=CRA_b"
FT                   /protein_id="EDL38553.1"
FT                   /translation="RFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTHTFHA
FT                   ADELGREQPRPAGPEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCA
FT                   STLPDWRAAVADNRSLDDRSRYSASPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEF
FT                   VKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVIKLARHFIG
FT                   LQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFASIPAACWWV
FT                   IISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARY
FT                   SRSLSAEFLN"
FT   CDS             complement(join(27291568..27292213,27337135..27337493))
FT                   /codon_start=1
FT                   /gene="Kcng3"
FT                   /locus_tag="mCG_20071"
FT                   /product="potassium voltage-gated channel, subfamily G,
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG20071.2 transcript_id=mCT18712.2
FT                   protein_id=mCP23709.1 isoform=CRA_a"
FT                   /protein_id="EDL38552.1"
FT                   /translation="MCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTHTFHAADELG
FT                   REQPRPAGPEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPD
FT                   WRAAVADNRSLDDRSRIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPY
FT                   YISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMV
FT                   MLLVFICVAMAIFSALSQLLEHGLDLETSNKDFASIPAACWWVIISMTTVGYGDMYPIT
FT                   VPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARYSRSLSAEFLN"
FT   gene            <27419843..27530958
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /note="gene_id=mCG20073.2"
FT   mRNA            join(<27419843..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479120..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504923..27505047,27507658..27507806,27508547..27508881)
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, transcript variant
FT                   mCT18714"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT18714.1 created
FT                   on 26-JUL-2002"
FT   CDS             join(<27419843..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479120..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504923..27505047,27507658..27507806,27508547..27508792)
FT                   /codon_start=1
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, isoform CRA_c"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT18714.1
FT                   protein_id=mCP23717.1 isoform=CRA_c"
FT                   /protein_id="EDL38556.1"
FT                   /translation="QRRRSRLRRRRRAGLGSGSAGGRADMAANMYRVGDYVYFENSSSN
FT                   PYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLT
FT                   EKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDP
FT                   SVKTLLADKGEIRVGPKYQADIPDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFL
FT                   VVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLV
FT                   PLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKT
FT                   TDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISSSNGKAGTVNGAVGTQFQPQSAL
FT                   LGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEEKSPSPTAE
FT                   DPRARSHMSRQALQGMPVRNTGSPKSAVKTRQAFFLRTTYFTKIARQVCKSTLRLRQAA
FT                   RRPFVAINYAAIRAECKTLFNS"
FT   mRNA            join(27419844..27419945,27428330..27428423,
FT                   27452148..27452274,27469967..27470030,27471672..27471789,
FT                   27479120..27479222,27482716..>27482817)
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, transcript variant
FT                   mCT170899"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170899.0 created
FT                   on 26-JUL-2002"
FT   mRNA            join(<27419859..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479120..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504926..27505047,27507658..27507806,27508547..27508878)
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, transcript variant
FT                   mCT193654"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT193654.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<27419861..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479120..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504926..27505047,27507658..27507806,27508547..27508792)
FT                   /codon_start=1
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, isoform CRA_d"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT193654.0
FT                   protein_id=mCP114654.0 isoform=CRA_d"
FT                   /protein_id="EDL38557.1"
FT                   /translation="LRRRRRAGLGSGSAGGRADMAANMYRVGDYVYFENSSSNPYLIRR
FT                   IEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQ
FT                   LKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLL
FT                   ADKGEIRVGPKYQADIPDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAV
FT                   GTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPV
FT                   LCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQ
FT                   QKRLKAAEAESKLKQVYIPTYKPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACES
FT                   CYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEEKSPSPTAEDPRARSH
FT                   MSRQALQGMPVRNTGSPKSAVKTRQAFFLRTTYFTKIARQVCKSTLRLRQAARRPFVAI
FT                   NYAAIRAECKTLFNS"
FT   mRNA            join(<27419869..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479123..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504926..27505047,27507658..27507806,27508547..27508769,
FT                   27516056..27516142,27520459..27520605,27530675..27530958)
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, transcript variant
FT                   mCT170898"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170898.0 created
FT                   on 26-JUL-2002"
FT   CDS             join(<27419870..27419945,27422094..27422161,
FT                   27428330..27428423,27452148..27452274,27469967..27470030,
FT                   27471672..27471789,27479123..27479222,27482716..27482815,
FT                   27491760..27491948,27497913..27497987,27500288..27500346,
FT                   27504926..27505047,27507658..27507806,27508547..27508769,
FT                   27516056..27516142,27520459..27520605,27530675..27530700)
FT                   /codon_start=1
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, isoform CRA_e"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170898.0
FT                   protein_id=mCP93817.0 isoform=CRA_e"
FT                   /protein_id="EDL38558.1"
FT                   /translation="RRRAGLGSGSAGGRADMAANMYRVGDYVYFENSSSNPYLIRRIEE
FT                   LNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKH
FT                   RELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADK
FT                   GEIRVGPKYQADIPDMLPEDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFA
FT                   RALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRD
FT                   EMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRL
FT                   KAAEAESKLKQVYIPTYKPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYAT
FT                   QSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEEKSPSPTAEDPRARSHMSRQ
FT                   ALQGMPVRNTGSPKSAVKTRQAFFLRTTYFTKIARQVCKSTLRLRQAARRPFVAINYAA
FT                   IRAEYADRHAELSGSPLKSRSTRKPLSCIIGYLEIHPAKKPNVIRSPPSLQTPATKRML
FT                   AAPNHTSLSILGKRNYSHHNGLDGPERWLSR"
FT   CDS             join(27428402..27428423,27452148..27452274,
FT                   27469967..27470030,27471672..27471789,27479120..27479222,
FT                   27482716..>27482817)
FT                   /codon_start=1
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, isoform CRA_a"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170899.0
FT                   protein_id=mCP93818.0 isoform=CRA_a"
FT                   /protein_id="EDL38554.1"
FT                   /translation="MLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLP
FT                   ATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADI
FT                   PDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQP
FT                   SLHMSAAAASRDITLV"
FT   mRNA            join(<27471672..27471789,27479120..27479222,
FT                   27482716..27482815,27491760..27491948,27497913..27497987,
FT                   27500288..27500346,27504926..27505047,27516056..>27516154)
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, transcript variant
FT                   mCT170900"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170900.0 created
FT                   on 26-JUL-2002"
FT   CDS             join(<27471672..27471789,27479120..27479222,
FT                   27482716..27482815,27491760..27491948,27497913..27497987,
FT                   27500288..27500346,27504926..27505047,27516056..>27516154)
FT                   /codon_start=1
FT                   /gene="Mta3"
FT                   /locus_tag="mCG_20073"
FT                   /product="metastasis associated 3, isoform CRA_b"
FT                   /note="gene_id=mCG20073.2 transcript_id=mCT170900.0
FT                   protein_id=mCP93816.0 isoform=CRA_b"
FT                   /protein_id="EDL38555.1"
FT                   /translation="DTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEGDSDER
FT                   EQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRD
FT                   ITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDF
FT                   NDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYKPNPNQI
FT                   SSSNGKAGTVNGAVGTQFQPQSALLGRACESCYDADRHAELSGSPLKSRSTRKPLSCII
FT                   GYLGRYR"
FT   gene            complement(27547590..27566509)
FT                   /locus_tag="mCG_124077"
FT                   /note="gene_id=mCG124077.0"
FT   mRNA            complement(join(27547590..27548217,27548323..27548402,
FT                   27548819..27548891,27551255..27551400,27551667..27551710,
FT                   27551951..27552040,27556151..27556257,27556480..27556563,
FT                   27560852..27560930,27565296..27565481,27566430..27566509))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT125315"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT125315.2
FT                   created on 27-MAR-2003"
FT   mRNA            complement(join(27547652..27548217,27548323..27548402,
FT                   27548819..27548891,27551951..27552040,27556151..27556257,
FT                   27556480..27556563,27560852..27560930,27565296..27565564))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT181415"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181415.0
FT                   created on 27-MAR-2003"
FT   mRNA            complement(join(27547652..27548217,27548323..27548402,
FT                   27548819..27548891,27551255..27551395,27556178..27556257,
FT                   27556480..27556563,27560852..27560930,27565296..27565461))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT181417"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181417.0
FT                   created on 27-MAR-2003"
FT   mRNA            complement(join(27547652..27548217,27548323..27548402,
FT                   27548819..27548891,27551255..27551400,27551667..27551710,
FT                   27551951..27552443))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT181418"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181418.0
FT                   created on 27-MAR-2003"
FT   mRNA            complement(join(27547848..27548217,27548323..27548402,
FT                   27548819..27548891,27560852..27560930,27565296..27565471))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT170885"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT170885.1
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(27548139..27548217,27548323..27548402,
FT                   27548819..27548891,27551951..27552040,27556151..27556257,
FT                   27556480..27556563,27560852..27560930,27565296..27565375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_f"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181415.0
FT                   protein_id=mCP104337.0 isoform=CRA_f"
FT                   /protein_id="EDL38564.1"
FT                   /translation="MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKD
FT                   YHIEEGEEVFYQLEGDMILRVLEQGQHRDVPIRQGEIFLLPARVPHSPQRFANTMGLVI
FT                   ERRRLESELDGLRYYVGDTEDVLFEKWFHCKDLGTQLAPIIQESLPTDKVAAKAQGRMW
FT                   MCGCGNRQGSSKVTMGGQCIALAPDDSLLVPAGTSYVWERAQGSVALSVTQDPARKKPW
FT                   W"
FT   CDS             complement(join(27548392..27548402,27548819..27548891,
FT                   27560852..27560930,27565296..27565375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_a"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT170885.1
FT                   protein_id=mCP93803.1 isoform=CRA_a"
FT                   /protein_id="EDL38559.1"
FT                   /translation="MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKD
FT                   YHIEEGEEVIAHGQGSSKGPRQDVDVWLWQQARLL"
FT   CDS             complement(join(27548392..27548402,27548819..27548891,
FT                   27551255..27551400,27551667..27551710,27551951..27552040,
FT                   27556151..27556257,27556480..27556563,27560852..27560930,
FT                   27565296..27565375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_d"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT125315.2
FT                   protein_id=mCP71022.2 isoform=CRA_d"
FT                   /protein_id="EDL38562.1"
FT                   /translation="MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKD
FT                   YHIEEGEEVFYQLEGDMILRVLEQGQHRDVPIRQGEIFLLPARVPHSPQRFANTMGLVI
FT                   ERRRLESELDGLRYYVGDTEDVLFEKWFHCKDLGTQLAPIIQEFFHSEQYRTGKPNPDQ
FT                   LLKELPFPLNTRSIMKPMSLKAWLDGHSRELQAGTSLSLFGDSYETQVIAHGQGSSKGP
FT                   RQDVDVWLWQQARLL"
FT   CDS             complement(join(27548392..27548402,27548819..27548891,
FT                   27551255..27551400,27551667..27551710,27551951..27552150))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_c"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181418.0
FT                   protein_id=mCP104339.0 isoform=CRA_c"
FT                   /protein_id="EDL38561.1"
FT                   /translation="MQCLDSAGGLQAEPSLNQAAPKLPRWRVGSLDLCFHRYYVGDTED
FT                   VLFEKWFHCKDLGTQLAPIIQEFFHSEQYRTGKPNPDQLLKELPFPLNTRSIMKPMSLK
FT                   AWLDGHSRELQAGTSLSLFGDSYETQVIAHGQGSSKGPRQDVDVWLWQQARLL"
FT   CDS             complement(join(27551368..27551395,27556178..27556257,
FT                   27556480..27556563,27560852..27560930,27565296..27565375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_e"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181417.0
FT                   protein_id=mCP104340.0 isoform=CRA_e"
FT                   /protein_id="EDL38563.1"
FT                   /translation="MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKD
FT                   YHIEEGEEVFYQLEGDMILRVLEQGQHRDVPIRQGEIFLLPARVPHSPQRFANTMGLVI
FT                   ERRRCSRSCHSR"
FT   mRNA            complement(join(27556531..27556563,27560507..27560603,
FT                   27560852..27560930,27565296..27565415))
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, transcript variant mCT181416"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181416.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(27560568..27560603,27560852..27560930,
FT                   27565296..27565375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124077"
FT                   /product="mCG124077, isoform CRA_b"
FT                   /note="gene_id=mCG124077.0 transcript_id=mCT181416.0
FT                   protein_id=mCP104338.0 isoform=CRA_b"
FT                   /protein_id="EDL38560.1"
FT                   /translation="MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKD
FT                   YHIEEGEEETRTLRDSIIL"
FT   gene            complement(27570300..>27573999)
FT                   /locus_tag="mCG_148330"
FT                   /note="gene_id=mCG148330.1"
FT   mRNA            complement(join(27570300..27571742,27573795..27573972))
FT                   /locus_tag="mCG_148330"
FT                   /product="mCG148330, transcript variant mCT188593"
FT                   /note="gene_id=mCG148330.1 transcript_id=mCT188593.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(27570329..27570703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148330"
FT                   /product="mCG148330, isoform CRA_a"
FT                   /note="gene_id=mCG148330.1 transcript_id=mCT188593.0
FT                   protein_id=mCP108808.0 isoform=CRA_a"
FT                   /protein_id="EDL38565.1"
FT                   /translation="MKNPKQDISIGATSNICRRPRTRSGVQHLLSTPSECRESSKAGPA
FT                   NHWLLETLKWTEQLTIISVCVCQFSCSADTFRIQRWLPFLEPVLFLELRHCCIVFFVQL
FT                   NSTSYDRTKEFFLSSTQLYQ"
FT   mRNA            complement(join(<27570376..27571603,27573795..>27573999))
FT                   /locus_tag="mCG_148330"
FT                   /product="mCG148330, transcript variant mCT193686"
FT                   /note="gene_id=mCG148330.1 transcript_id=mCT193686.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(<27570376..>27570706)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148330"
FT                   /product="mCG148330, isoform CRA_b"
FT                   /note="gene_id=mCG148330.1 transcript_id=mCT193686.0
FT                   protein_id=mCP114645.0 isoform=CRA_b"
FT                   /protein_id="EDL38566.1"
FT                   /translation="SMKNPKQDISIGATSNICRRPRTRSGVQHLLSTPSECRESSKAGP
FT                   ANHWLLETLKWTEQLTIISVCVCQFSCSADTFRIQRWLPFLEPVLFLELRHCCIVFFVQ
FT                   LNSTSY"
FT   gene            27637798..27641479
FT                   /locus_tag="mCG_1039406"
FT                   /note="gene_id=mCG1039406.0"
FT   mRNA            join(27637798..27637965,27639791..27641479)
FT                   /locus_tag="mCG_1039406"
FT                   /product="mCG1039406"
FT                   /note="gene_id=mCG1039406.0 transcript_id=mCT157110.0
FT                   created on 31-OCT-2002"
FT   CDS             27640585..27640854
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039406"
FT                   /product="mCG1039406"
FT                   /note="gene_id=mCG1039406.0 transcript_id=mCT157110.0
FT                   protein_id=mCP70967.1"
FT                   /protein_id="EDL38567.1"
FT                   /translation="MPLYGACCLSPLLPELGGRSYRCFHKGLCVCVKCVEGLFQVQSFE
FT                   ATDSFSLQLPLCHIFPAVNWKWNWEHLGDLTPQNLIQNCAEYEE"
FT   gene            27719323..27734184
FT                   /locus_tag="mCG_1039592"
FT                   /note="gene_id=mCG1039592.1"
FT   mRNA            join(27719323..27719477,27733905..27734184)
FT                   /locus_tag="mCG_1039592"
FT                   /product="mCG1039592, transcript variant mCT174987"
FT                   /note="gene_id=mCG1039592.1 transcript_id=mCT174987.0
FT                   created on 31-OCT-2002"
FT   CDS             join(27719463..27719477,27733905..27734000)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039592"
FT                   /product="mCG1039592, isoform CRA_a"
FT                   /note="gene_id=mCG1039592.1 transcript_id=mCT174987.0
FT                   protein_id=mCP97906.0 isoform=CRA_a"
FT                   /protein_id="EDL38568.1"
FT                   /translation="MSTIKVLHMPRAPTRQIHAHMTPMEKEGLRSRLSSF"
FT   mRNA            join(27729672..27729746,27732475..27732577,
FT                   27733905..27734166)
FT                   /locus_tag="mCG_1039592"
FT                   /product="mCG1039592, transcript variant mCT157296"
FT                   /note="gene_id=mCG1039592.1 transcript_id=mCT157296.0
FT                   created on 31-OCT-2002"
FT   CDS             27733914..27734000
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039592"
FT                   /product="mCG1039592, isoform CRA_b"
FT                   /note="gene_id=mCG1039592.1 transcript_id=mCT157296.0
FT                   protein_id=mCP70826.1 isoform=CRA_b"
FT                   /protein_id="EDL38569.1"
FT                   /translation="MPRAPTRQIHAHMTPMEKEGLRSRLSSF"
FT   gene            complement(27741444..>27746794)
FT                   /locus_tag="mCG_145005"
FT                   /note="gene_id=mCG145005.0"
FT   mRNA            complement(join(27741444..27742227,27743644..27743836,
FT                   27746705..>27746794))
FT                   /locus_tag="mCG_145005"
FT                   /product="mCG145005"
FT                   /note="gene_id=mCG145005.0 transcript_id=mCT184429.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(27741976..>27742188)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145005"
FT                   /product="mCG145005"
FT                   /note="gene_id=mCG145005.0 transcript_id=mCT184429.0
FT                   protein_id=mCP106297.0"
FT                   /protein_id="EDL38570.1"
FT                   /translation="GISSCHQHVQSNIPSLTRKKTVDTEVSDLCLNKCTLSHPHTKYTN
FT                   PFPSSKPTRFHPIITATSSKPGPSW"
FT   gene            27800199..>27811273
FT                   /locus_tag="mCG_1039593"
FT                   /note="gene_id=mCG1039593.0"
FT   mRNA            join(27800199..27800594,27802047..27802144,
FT                   27806442..27806531,27807303..27808215,27809551..27809689,
FT                   27811120..>27811273)
FT                   /locus_tag="mCG_1039593"
FT                   /product="mCG1039593"
FT                   /note="gene_id=mCG1039593.0 transcript_id=mCT157297.0
FT                   created on 31-OCT-2002"
FT   CDS             join(27809636..27809689,27811120..>27811273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039593"
FT                   /product="mCG1039593"
FT                   /note="gene_id=mCG1039593.0 transcript_id=mCT157297.0
FT                   protein_id=mCP70833.1"
FT                   /protein_id="EDL38571.1"
FT                   /translation="MLQRCHWDSPPAHFLLGNLKTPSVIILTEATGRYTSFSMKSLCQK
FT                   SLCHLLHLENFWCTHIPIQVEKRE"
FT   gene            complement(27855437..>27861260)
FT                   /locus_tag="mCG_145011"
FT                   /note="gene_id=mCG145011.0"
FT   mRNA            complement(join(27855437..27856084,27856241..27856406,
FT                   27856756..27856956,27861140..>27861260))
FT                   /locus_tag="mCG_145011"
FT                   /product="mCG145011"
FT                   /note="gene_id=mCG145011.0 transcript_id=mCT184435.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(27855942..27856084,27856241..27856406,
FT                   27856756..>27856854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145011"
FT                   /product="mCG145011"
FT                   /note="gene_id=mCG145011.0 transcript_id=mCT184435.0
FT                   protein_id=mCP106303.0"
FT                   /protein_id="EDL38572.1"
FT                   /translation="AIWGPANSMLKKTRNSKADEPTTLGTVGSTLLKPRPVLCHCWCEA
FT                   VNSDPACIQVAGQSQTLQGRETLKLTARSCSDYGPEGRSKTETGAGDYIQVAGLGGEQY
FT                   PCLPPSLLTNPDALYTGLGMEGVELRRSQRT"
FT   gene            complement(27905664..>27908758)
FT                   /locus_tag="mCG_15594"
FT                   /note="gene_id=mCG15594.2"
FT   mRNA            complement(27905664..>27908758)
FT                   /locus_tag="mCG_15594"
FT                   /product="mCG15594"
FT                   /note="gene_id=mCG15594.2 transcript_id=mCT18732.2 created
FT                   on 30-JUL-2002"
FT   CDS             complement(27907752..>27908756)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15594"
FT                   /product="mCG15594"
FT                   /note="gene_id=mCG15594.2 transcript_id=mCT18732.2
FT                   protein_id=mCP23704.1"
FT                   /protein_id="EDL38573.1"
FT                   /translation="LNLNNMLDKKAVGTPVAAAPSSSFTPGFLRRHSASNLHALAHPVP
FT                   SPGSCSPKFPGAPNGGGSSCGPAGGGGLASYGQLKEPSGGSGTALVTKESKFRDRSFSE
FT                   NGERSQHLLHLQQQQKGGSGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRS
FT                   LTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGGGASGDLRAFGARDAL
FT                   HLGFAREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSSSASSCSSS
FT                   ASSCSSASAASTPSGAPTCCATAAAAALLLRPRGRGGPAEPRSAVRLLLVLRR"
FT   gene            complement(<27913573..>28165160)
FT                   /locus_tag="mCG_15592"
FT                   /note="gene_id=mCG15592.2"
FT   mRNA            complement(join(<27913573..27913953,27914922..27915091,
FT                   27944917..27945048,27948131..27948284,27953034..27953407,
FT                   27974469..27974563,27994515..27994633,28038989..28039157,
FT                   28063471..28063602,28066238..28066327,28115861..28115952,
FT                   28121770..28121892,28123473..28123586,28126605..28126737,
FT                   28144706..28144815,28151459..28151616,28154603..28154761,
FT                   28157150..28157286,28157533..28157668,28160627..28160834,
FT                   28164004..28164158,28165043..>28165160))
FT                   /locus_tag="mCG_15592"
FT                   /product="mCG15592"
FT                   /note="gene_id=mCG15592.2 transcript_id=mCT18710.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(27913573..27913953,27914922..27915091,
FT                   27944917..27945048,27948131..27948284,27953034..27953407,
FT                   27974469..27974563,27994515..27994633,28038989..28039157,
FT                   28063471..28063602,28066238..28066327,28115861..28115952,
FT                   28121770..28121892,28123473..28123586,28126605..28126737,
FT                   28144706..28144815,28151459..28151616,28154603..28154761,
FT                   28157150..28157286,28157533..28157668,28160627..28160834,
FT                   28164004..28164158,28165043..28165160))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15592"
FT                   /product="mCG15592"
FT                   /note="gene_id=mCG15592.2 transcript_id=mCT18710.2
FT                   protein_id=mCP23701.2"
FT                   /protein_id="EDL38574.1"
FT                   /translation="MSSVCNILFEALFPGSSYSTRFSALTILGSVAEVFPDPEGNIQTV
FT                   YQLSHDIDAGRYQILMECFTSTFEEVKTLAFDLLMKLSSVTAGQFQDSEKLQDLFQAAL
FT                   ELSTSTKPYDCVTASYLLNLLIRQDALPAVLSASSPQQLTRGAGETSAVLERNTLVVIK
FT                   CLMENLEDEISQAENSLLQAASSFPMYGRVHCITRAFQRLPLNDLRLASEWRPLLGRLL
FT                   LLSYRLSTVVAPVIQSSSPEGLIPVDTDSASASRLQLILNEIQPRDTNDYFNHTKILKE
FT                   CDSFDLEDLSTSVSNIDSSAEVKGKEEKACDVTAQMVLACCWRSMKEVALLLGTLCQLL
FT                   PVQPGPESSNVFLTVQQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEILNRCSNVS
FT                   LQKLPEQWLRSVLEEIKGSDPSSKLCATRRSAGIPFYIQALLASEPKKSRMDLLKITMR
FT                   ELISLALSADDSKGRVPQVHALNILRALFRDTRLGENIIPYVAGGAKAAILGFTSPVWA
FT                   VRNSSTLLFSSLITRVFGVKRGKDEVSKTNRMTGREFFSRFPELYPFLLKQLETVASTV
FT                   DSELGEPDRHPGMFLLLLVLERLYPSPMDGTSSALSLAPFVPFIIRCGRSPIYRSREMA
FT                   ARALVPFIMIDQIPSTLCALLNSLPNSTDQCFRQNHIHGTLLQVFHLLQAYITDCRHRT
FT                   NADFLQELSDVTACTKAKLWLAMRQNPCLVTRAVYIDILFLLTNCLDRPEEGKQTALES
FT                   LGFWEDVRRIILESELIKGFPWTFKVPGLPQYLQSLTKLAIPEVWASLAEAKGQATAVP
FT                   LSFSRLLKSSFPEVRLLALDTLLERARSSEQEQKEPLPLLCSMGEELLLLAMKEDHPGC
FT                   FCRNKDSLAPELRQWVQLVVWSCGDHLPTASRLAVAEVLTSTAPLFLTSPQPILELQGT
FT                   LSLWRCVLTLLQSEEQTVREAATEIVTTAMSQGNTCQSTEFAFCQVDASIALTLALAVL
FT                   CDLLQQWDQLEPGLPILLGWLLEEGDDLEGHVQSPHQGEEEHIFEKSEVNFWAETLTFV
FT                   KSLCRQLFHLLCQSGWQSPHSQKLCHLQRIASEQSHLISQLFRELPLSAEFLKTVEYTR
FT                   LRIQEERTLAVLRLLACLEGKEGLRAEDCPREWRQVMAPRTEAAC"
FT   gene            complement(<28183194..>28192487)
FT                   /locus_tag="mCG_1039345"
FT                   /note="gene_id=mCG1039345.1"
FT   mRNA            complement(join(<28183194..28183351,28186023..28186153,
FT                   28186989..28187083,28190636..28190733,28192373..>28192487))
FT                   /locus_tag="mCG_1039345"
FT                   /product="mCG1039345"
FT                   /note="gene_id=mCG1039345.1 transcript_id=mCT157049.1
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(<28183194..28183351,28186023..28186153,
FT                   28186989..28187083,28190636..28190733,28192373..>28192485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039345"
FT                   /product="mCG1039345"
FT                   /note="gene_id=mCG1039345.1 transcript_id=mCT157049.1
FT                   protein_id=mCP71178.1"
FT                   /protein_id="EDL38575.1"
FT                   /translation="TGFWIAHHVTSRRDAVDLTGFRVSSRGGDALQTSSGTRALFILCK
FT                   MGVKKKREMQVAALTVCHQDMETLRSFADMEGKNLASLLLHCVQLTDGVSQIHSIKQIV
FT                   PLLEKVDKNGVCDPAIQSCLDILAGIYFSLTLKNPLKKVLASSLNGLPEVFLTQATHSF
FT                   TFHLQEELDTADLYSYRKVMDNISSCMENFNLGKP"
FT   gene            <28238690..>28347985
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /note="gene_id=mCG124965.1"
FT   mRNA            join(<28238690..28238721,28248410..28248539,
FT                   28274390..28274452,28283817..28283966,28285935..28286018,
FT                   28286533..28286614,28290263..28290442,28292416..28293380,
FT                   28296317..28296392,28297483..28297577,28298109..28298253,
FT                   28301366..28301545,28301612..28301712,28302152..28302238,
FT                   28303602..28303760,28309831..28309911,28315468..28315647,
FT                   28318487..28318664,28319931..28320043,28320708..28320887,
FT                   28325450..28325478,28327070..28327247,28328417..28328572,
FT                   28329967..28330064,28336096..28336237,28340031..28340176,
FT                   28340911..28341040,28344352..28344438,28346107..28346241,
FT                   28347800..>28347985)
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, transcript variant mCT126217"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT126217.1
FT                   created on 22-OCT-2002"
FT   CDS             join(<28238690..28238721,28248410..28248539,
FT                   28274390..28274452,28283817..28283966,28285935..28286018,
FT                   28286533..28286614,28290263..28290442,28292416..28293380,
FT                   28296317..28296392,28297483..28297577,28298109..28298253,
FT                   28301366..28301545,28301612..28301712,28302152..28302238,
FT                   28303602..28303760,28309831..28309911,28315468..28315647,
FT                   28318487..28318664,28319931..28320043,28320708..28320887,
FT                   28325450..28325478,28327070..28327247,28328417..28328572,
FT                   28329967..28330064,28336096..28336237,28340031..28340176,
FT                   28340911..28341040,28344352..28344438,28346107..28346241,
FT                   28347800..28347985)
FT                   /codon_start=1
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, isoform CRA_c"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT126217.1
FT                   protein_id=mCP71151.1 isoform=CRA_c"
FT                   /protein_id="EDL38578.1"
FT                   /translation="GEPEHQAPPQRRTMEEPSEPEGLIDWKERCVALEAQLMKFRVQAS
FT                   KIRELLADKMQQLERQVIDAERQAEKAFQEVQVMEEKLKAANIQTSESETRLYKKCQDL
FT                   ESVMQEKDDIIQNLALRLEEQKQVRIQEAKIIEEKAAKIKEWVTVKLNELEVENQNLRF
FT                   INQTQTEEIRAIQSKLQELQEKKISCVSSPKTSEGQRNLTFGCFLSRAKSPPCVVRCEE
FT                   VSKMASNEPEITEGRCVEEMEIAEKPADNQVQENSRSQRKLHETSCSSEQNQKTRASFA
FT                   MDGGTSQNSGVPVSDWSSDEDDGSKGRSKSRCTSTLSSHTSEEGGQCGRLGSEAYLTAS
FT                   DDSSSIFEEETFDGNRPEQKKLCSWQQKAPWKAQGNLAKGRSQSGVKEQDSSSDELNKK
FT                   FHSQRLDYTSSSSEANTPSPILTPALTPRYPNSLPGKGGAPLVPPPFQPPPKLRVPNVF
FT                   SISVALTKRHLSQPQLCSDRMFGTNRNAISMIRPLRPQETDLDVVDGDGAEAVNRMDTG
FT                   CDDGLFSYDSQDPPPCADDQENSEAPKKAPCNKPPTPPLHRFPSWESRIYAVAKSGIRV
FT                   SEAFNMEHANKNSADILSYSAASLYTSLIYKNMTTPVYTTLKGKATQISSSPFLDDSSG
FT                   SDEEDSSRSSSRLSESDARSRSGPSSPRAMKRGVSDSSAASESDYAIPPDAYPIDAECS
FT                   QPEQKLLKTCLASCDNGKNVNEQSDSEKKNESVKKSGYLLKMSVRVKTWKRRWFVLKGG
FT                   ELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLATEKHTYYLTADSPNILEEWI
FT                   KVLQSVLRVQAANPLCLQPEGKPAVKGLLTKVKHGYSKRVWCMLVGKVLYYFRNQEDKF
FT                   PLGQLKLWEAKVEEVDRSCDSDEDYETRGCYLLSTHYTIIVHPKDQGPTYLLIGSKHEK
FT                   VVPSGEMNGTSWLTFLLTCSLLKEAWLYHLTVAAGSNNINVGSEFEQLVCKLLNIEGEP
FT                   SSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISL
FT                   AQSALQVCLTHPELQNEICCQLIKQTRRRQLQNQPGPLQLHLQRNADSRTEFGKYAIYC
FT                   QRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTV
FT                   EEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQP
FT                   GKCEGSRTVRLTYKNRLYFSVQARGETDREKTLLLYQTNDQIINGLFPLNKDLALEMAA
FT                   LLAQVDIGDFERPFSTPAGPVTNQCKANQTLKQVIERFYPKRYREGCSEEQLRQLYQRL
FT                   STKWMALRGHSAADCIRIYLTVARKWPFFGAKLFFAKPIAPSSLGNNCVWLAVHENGLS
FT                   ILEYTSMRLVTSYMYKGLMTFGGYQEDFMVVVSTQSKDRPTEKLLFAMAKHKILEITLL
FT                   IASYINSFHQQKTTFHHLSAPALLSPRTQAPQARVMGSQPPLSNSRPTKGPTLL"
FT   mRNA            join(<28238690..28238721,28248410..28248539,
FT                   28274390..28274452,28283817..28283966,28285935..28286018,
FT                   28286533..28286614,28290263..28290442,28292416..28293380,
FT                   28296317..28296392,28297483..28298488)
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, transcript variant mCT174657"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT174657.0
FT                   created on 22-OCT-2002"
FT   CDS             join(<28238690..28238721,28248410..28248539,
FT                   28274390..28274452,28283817..28283966,28285935..28286018,
FT                   28286533..28286614,28290263..28290442,28292416..28293380,
FT                   28296317..28296392,28297483..28297682)
FT                   /codon_start=1
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, isoform CRA_a"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT174657.0
FT                   protein_id=mCP97576.0 isoform=CRA_a"
FT                   /protein_id="EDL38576.1"
FT                   /translation="GEPEHQAPPQRRTMEEPSEPEGLIDWKERCVALEAQLMKFRVQAS
FT                   KIRELLADKMQQLERQVIDAERQAEKAFQEVQVMEEKLKAANIQTSESETRLYKKCQDL
FT                   ESVMQEKDDIIQNLALRLEEQKQVRIQEAKIIEEKAAKIKEWVTVKLNELEVENQNLRF
FT                   INQTQTEEIRAIQSKLQELQEKKISCVSSPKTSEGQRNLTFGCFLSRAKSPPCVVRCEE
FT                   VSKMASNEPEITEGRCVEEMEIAEKPADNQVQENSRSQRKLHETSCSSEQNQKTRASFA
FT                   MDGGTSQNSGVPVSDWSSDEDDGSKGRSKSRCTSTLSSHTSEEGGQCGRLGSEAYLTAS
FT                   DDSSSIFEEETFDGNRPEQKKLCSWQQKAPWKAQGNLAKGRSQSGVKEQDSSSDELNKK
FT                   FHSQRLDYTSSSSEANTPSPILTPALTPRYPNSLPGKGGAPLVPPPFQPPPKLRVPNVF
FT                   SISVALTKRHLSQPQLCSDRMFGTNRNAISMIRPLRPQETDLDVVDGDGAEAVNRMDTG
FT                   CDDGLFSYDSQDPPPCADDQENSEAPKKAPCNKPPTPPLHRFPSWESRIYAVAKSGIRV
FT                   SEAFNMEHANKNSADILSYSAASLYTSLIYKNMTTPVYTTLKGVMSAFLVVRPMVFSRI
FT                   VRDSTLGILTSIPLFVEL"
FT   mRNA            join(<28248417..28248539,28274390..28274452,
FT                   28283817..28283966,28285935..28286018,28286533..28286614,
FT                   28290263..28290442,28292416..28293380,28296317..28296392,
FT                   28297483..28297577,28298109..28298253,28301366..28301502,
FT                   28301602..28301712,28302152..28302238,28303602..28303760,
FT                   28309831..28309911,28315468..28315647,28318556..28318664,
FT                   28319931..28320043,28320708..28320887,28325381..28325478,
FT                   28327070..28327247,28328417..28328572,28329967..28330064,
FT                   28336096..28336237,28340031..28340176,28340911..28341040,
FT                   28344352..28344438,28346107..28346241,28347800..>28347985)
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, transcript variant mCT193666"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT193666.0
FT                   created on 09-MAR-2004"
FT   CDS             join(28248417..28248539,28274390..28274452,
FT                   28283817..28283966,28285935..28286018,28286533..28286614,
FT                   28290263..28290442,28292416..28293380,28296317..28296392,
FT                   28297483..28297577,28298109..28298253,28301366..28301502,
FT                   28301602..28301712,28302152..28302238,28303602..28303760,
FT                   28309831..28309911,28315468..28315647,28318556..28318664,
FT                   28319931..28320043,28320708..28320887,28325381..28325478,
FT                   28327070..28327247,28328417..28328572,28329967..28330064,
FT                   28336096..28336237,28340031..28340176,28340911..28341040,
FT                   28344352..28344438,28346107..28346241,28347800..28347985)
FT                   /codon_start=1
FT                   /gene="Plekhh2"
FT                   /locus_tag="mCG_124965"
FT                   /product="pleckstrin homology domain containing, family H
FT                   (with MyTH4 domain) member 2, isoform CRA_b"
FT                   /note="gene_id=mCG124965.1 transcript_id=mCT193666.0
FT                   protein_id=mCP114636.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C115"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:2146813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C115"
FT                   /protein_id="EDL38577.1"
FT                   /translation="MEEPSEPEGLIDWKERCVALEAQLMKFRVQASKIRELLADKMQQL
FT                   ERQVIDAERQAEKAFQEVQVMEEKLKAANIQTSESETRLYKKCQDLESVMQEKDDIIQN
FT                   LALRLEEQKQVRIQEAKIIEEKAAKIKEWVTVKLNELEVENQNLRFINQTQTEEIRAIQ
FT                   SKLQELQEKKISCVSSPKTSEGQRNLTFGCFLSRAKSPPCVVRCEEVSKMASNEPEITE
FT                   GRCVEEMEIAEKPADNQVQENSRSQRKLHETSCSSEQNQKTRASFAMDGGTSQNSGVPV
FT                   SDWSSDEDDGSKGRSKSRCTSTLSSHTSEEGGQCGRLGSEAYLTASDDSSSIFEEETFD
FT                   GNRPEQKKLCSWQQKAPWKAQGNLAKGRSQSGVKEQDSSSDELNKKFHSQRLDYTSSSS
FT                   EANTPSPILTPALTPRYPNSLPGKGGAPLVPPPFQPPPKLRVPNVFSISVALTKRHLSQ
FT                   PQLCSDRMFGTNRNAISMIRPLRPQETDLDVVDGDGAEAVNRMDTGCDDGLFSYDSQDP
FT                   PPCADDQENSEAPKKAPCNKPPTPPLHRFPSWESRIYAVAKSGIRVSEAFNMEHANKNS
FT                   ADILSYSAASLYTSLIYKNMTTPVYTTLKGKATQISSSPFLDDSSGSDEEDSSRSSSRL
FT                   SESDARSRSGPSSPRAMKRGVSDSSAASESDYAIPPDAYPIDAECSQPEQKLLKTCLAS
FT                   CDNGKNEPLEKSGYLLKMSVRVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSAS
FT                   CSILRGDNKQTVQLATEKHTYYLTADSPNILEEWIKVLQSVLRVQAANPLCLQPEGKPA
FT                   VKGLLTKVKHGYSKRVWCMLVGKVLYYFRNQEDKFPLGQLKLWEAKVEEVDRSCDSDED
FT                   YETRGCYLLSTHYTIIVHPKDQGPTYLLIGSKHEKEAWLYHLTVAAGSNNINVGSEFEQ
FT                   LVCKLLNIEGEPSSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKTCQLFINAA
FT                   VDSPAIDYHISLAQSALQVCLTHPELQNEICCQLIKQTRRRQLQNQPGPLQGWQLLALC
FT                   VGLFLPHHPFLWLLQLHLQRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILS
FT                   TLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALF
FT                   TDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKCEGSRTVRLTYKNRLYFSVQAR
FT                   GETDREKTLLLYQTNDQIINGLFPLNKDLALEMAALLAQVDIGDFERPFSTPAGPVTNQ
FT                   CKANQTLKQVIERFYPKRYREGCSEEQLRQLYQRLSTKWMALRGHSAADCIRIYLTVAR
FT                   KWPFFGAKLFFAKPIAPSSLGNNCVWLAVHENGLSILEYTSMRLVTSYMYKGLMTFGGY
FT                   QEDFMVVVSTQSKDRPTEKLLFAMAKHKILEITLLIASYINSFHQQKTTFHHLSAPALL
FT                   SPRTQAPQARVMGSQPPLSNSRPTKGPTLL"
FT   gene            <28354827..28383542
FT                   /gene="Dync2li1"
FT                   /locus_tag="mCG_15601"
FT                   /note="gene_id=mCG15601.2"
FT   mRNA            join(<28354827..28354927,28356571..28356688,
FT                   28359922..28359956,28361805..28361874,28364593..28364681,
FT                   28372491..28372559,28373105..28373182,28375439..28375515,
FT                   28375840..28375910,28377410..28377507,28377903..28377995,
FT                   28383261..28383542)
FT                   /gene="Dync2li1"
FT                   /locus_tag="mCG_15601"
FT                   /product="dynein cytoplasmic 2 light intermediate chain 1"
FT                   /note="gene_id=mCG15601.2 transcript_id=mCT18739.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(<28361811..28361874,28364593..28364681,
FT                   28372491..28372559,28373105..28373182,28375439..28375515,
FT                   28375840..28375910,28377410..28377507,28377903..28377995,
FT                   28383261..28383323)
FT                   /codon_start=1
FT                   /gene="Dync2li1"
FT                   /locus_tag="mCG_15601"
FT                   /product="dynein cytoplasmic 2 light intermediate chain 1"
FT                   /note="gene_id=mCG15601.2 transcript_id=mCT18739.2
FT                   protein_id=mCP23712.2"
FT                   /protein_id="EDL38579.1"
FT                   /translation="VSKADLSVGVHVRKEDQGAQHAKRHCSLLGTGWRNLLAGLNQHTN
FT                   HSRHLKDRELIDPFPIPLVIIGSKYDIFQDFDPEKRKVICKTLRFVAHYYGASLMFTSK
FT                   SEALLLKIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQ
FT                   AHSPMELWKKVYDKLFPPKSTGTLKAVQDPARDPQYAESEVDEMRVQKDQELEHYKRSS
FT                   SKTWKQIELDS"
FT   gene            complement(28386199..28411663)
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /note="gene_id=mCG124964.1"
FT   mRNA            complement(join(28386199..28386646,28388087..28388199,
FT                   28392437..28392622,28397433..28397571,28398408..28398613,
FT                   28398713..28398926,28399613..28399742,28400639..28400778,
FT                   28402008..28402140,28404539..28404637,28404723..28404859,
FT                   28410663..28410784,28411380..28411663))
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, transcript variant mCT126216"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT126216.1
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(28386453..28386646,28388087..28388199,
FT                   28392437..28392622,28397433..28397571,28398408..28398613,
FT                   28398713..28398926,28399613..28399742,28400639..28400778,
FT                   28402008..28402140,28404539..28404637,28404723..28404859,
FT                   28410663..28410784,28411380..28411525))
FT                   /codon_start=1
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, isoform CRA_a"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT126216.1
FT                   protein_id=mCP70867.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q540E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1351659"
FT                   /db_xref="UniProtKB/TrEMBL:Q540E8"
FT                   /protein_id="EDL38580.1"
FT                   /translation="MGELPFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVS
FT                   YSVSNRVGPWWNIKSCQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRL
FT                   RRTGTLEGEVFVNGCELRRDQFQDCFSYVLQSDVFLSSLTVRETLRYTAMLALCRSSAD
FT                   FYNKKVEAVMTELSLSHVADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTT
FT                   GLDCMTANQIVLLLAELARRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEM
FT                   LGFFNNCGYPCPEHSNPFDFYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKIL
FT                   ENIERARYLKTLPTVPFKTKDPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGL
FT                   FLIFYLLRVQNNTLKGAVQDRVGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGL
FT                   YHKWQMLLAYVLHVLPFSVIATVIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFL
FT                   TLVLLGIVQNPNIVNSIVALLSISGLLIGSGFIRNIQEMPIPLKILGYFTFQKYCCEIL
FT                   VVNEFYGLNFTCGGSNTSMLNHPMCAITQGVQFIEKTCPGATSRFTANFLILYGFIPAL
FT                   VILGIVIFKVRDYLISR"
FT   mRNA            complement(join(28386625..28386646,28388087..28388199,
FT                   28392437..28392463,28404776..28404859,28410663..28410784,
FT                   28411380..>28411514))
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, transcript variant mCT170890"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT170890.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(28388171..28388199,28392437..28392463,
FT                   28404776..28404859,28410663..28410784,28411380..>28411513))
FT                   /codon_start=1
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, isoform CRA_b"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT170890.0
FT                   protein_id=mCP93807.0 isoform=CRA_b"
FT                   /protein_id="EDL38581.1"
FT                   /translation="PFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVSYSVS
FT                   NRVGPWWNIKSCQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTG
FT                   TLEGEVFVNGCLLDLDLSETYKKCPFL"
FT   mRNA            complement(join(<28398709..28398926,28399613..28399742,
FT                   28400639..28400778,28402008..28402140,28402736..>28402858))
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, transcript variant mCT170889"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT170889.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(28398709..28398926,28399613..28399742,
FT                   28400639..28400778,28402008..28402140,28402736..>28402858))
FT                   /codon_start=1
FT                   /gene="Abcg5"
FT                   /locus_tag="mCG_124964"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 5, isoform CRA_c"
FT                   /note="gene_id=mCG124964.1 transcript_id=mCT170889.0
FT                   protein_id=mCP93808.0 isoform=CRA_c"
FT                   /protein_id="EDL38582.1"
FT                   /translation="AAVNRSSGGRKGSLLSKPVSTVLECYGVESRNKKRTAGSRRVEAV
FT                   MTELSLSHVADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQ
FT                   IVLLLAELARRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEMLGFFNNCGY
FT                   PCPEHSNPFDFYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKILENIERARYL
FT                   KTLPTVPFKTKDPPGMFGKLGVLLR"
FT   gene            28411709..28429268
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /note="gene_id=mCG15590.2"
FT   mRNA            join(28411709..28411946,28415274..28415375,
FT                   28417194..28417350,28420462..28420700,28421148..28421280,
FT                   28421375..28421644,28423732..28423894,28423982..28424062,
FT                   28424814..28425013,28425536..28425612,28426157..28426424,
FT                   28427385..28427512,28427598..28429267)
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, transcript variant mCT18709"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT18709.2 created
FT                   on 26-JUL-2002"
FT   mRNA            join(<28411816..28411946,28415271..28415375,
FT                   28417194..28417350,28420462..28420700,28421148..28421280,
FT                   28421375..28421644,28423732..28423894,28423982..28424062,
FT                   28424814..28425013,28425536..28425612,28426157..28426424,
FT                   28427385..28427512,28427598..28429268)
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, transcript variant mCT193652"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT193652.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<28411818..28411946,28415271..28415375,
FT                   28417194..28417350,28420462..28420700,28421148..28421280,
FT                   28421375..28421644,28423732..28423894,28423982..28424062,
FT                   28424814..28425013,28425536..28425612,28426157..28426424,
FT                   28427385..28427512,28427598..28427735)
FT                   /codon_start=1
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, isoform CRA_b"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT193652.0
FT                   protein_id=mCP114646.0 isoform=CRA_b"
FT                   /protein_id="EDL38584.1"
FT                   /translation="RSKDRESPTAGEATQRAQTALVMAEKTKEETQLWNGTVLQDASQG
FT                   LQDSLFSSESDNSLYFTYSGQSNTLEVRDLTYQVDIASQVPWFEQLAQFKIPWRSHSSQ
FT                   DSCELGIRNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKMKSGQIWINGQPST
FT                   PQLVRKCVAHVRQHDQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQ
FT                   CANTRVGNTYVRGVSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVTTLSRL
FT                   AKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQQMVQYFTSIGHPCPRYSNP
FT                   ADFYVDLTSIDRRSKEREVATVEKAQSLAALFLEKVQGFDDFLWKAEAKELNTSTHTVS
FT                   LTLTQDTDCGTAAELPGMIEQFSTLIRRQISNDFRDLPTLLIHGSEACLMSLIIGFLYY
FT                   GHGAKQLSFMDTAALLFMIGALIPFNVILDVVSKCHSERSMLYYELEDGLYTAGPYFFA
FT                   KILGELPEHCAYVIIYAMPIYWLTNLRPVPELFLLHFLLVWLVVFCCRTMALAASAMLP
FT                   TFHMSSFFCNALYNSFYLTAGFMINLDNLWIVPAWISKLSFLRWCFSGLMQIQFNGHLY
FT                   TTQIGNFTFSILGDTMISAMDLNSHPLYAIYLIVIGISYGFLFLYYLSLKLIKQKSIQD
FT                   W"
FT   mRNA            join(28411883..28411946,28415274..28415375,
FT                   28417194..28417302,28426260..>28426419)
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, transcript variant mCT170891"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT170891.0 created
FT                   on 26-JUL-2002"
FT   CDS             join(28411884..28411946,28415274..28415375,
FT                   28417194..28417350,28420462..28420700,28421148..28421280,
FT                   28421375..28421644,28423732..28423894,28423982..28424062,
FT                   28424814..28425013,28425536..28425612,28426157..28426424,
FT                   28427385..28427512,28427598..28427735)
FT                   /codon_start=1
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, isoform CRA_a"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT18709.2
FT                   protein_id=mCP23643.2 isoform=CRA_a"
FT                   /protein_id="EDL38583.1"
FT                   /translation="MAEKTKEETQLWNGTVLQDASGLQDSLFSSESDNSLYFTYSGQSN
FT                   TLEVRDLTYQVDIASQVPWFEQLAQFKIPWRSHSSQDSCELGIRNLSFKVRSGQMLAII
FT                   GSSGCGRASLLDVITGRGHGGKMKSGQIWINGQPSTPQLVRKCVAHVRQHDQLLPNLTV
FT                   RETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCANTRVGNTYVRGVSGGERRRVS
FT                   IGVQLLWNPGILILDEPTSGLDSFTAHNLVTTLSRLAKGNRLVLISLHQPRSDIFRLFD
FT                   LVLLMTSGTPIYLGAAQQMVQYFTSIGHPCPRYSNPADFYVDLTSIDRRSKEREVATVE
FT                   KAQSLAALFLEKVQGFDDFLWKAEAKELNTSTHTVSLTLTQDTDCGTAAELPGMIEQFS
FT                   TLIRRQISNDFRDLPTLLIHGSEACLMSLIIGFLYYGHGAKQLSFMDTAALLFMIGALI
FT                   PFNVILDVVSKCHSERSMLYYELEDGLYTAGPYFFAKILGELPEHCAYVIIYAMPIYWL
FT                   TNLRPVPELFLLHFLLVWLVVFCCRTMALAASAMLPTFHMSSFFCNALYNSFYLTAGFM
FT                   INLDNLWIVPAWISKLSFLRWCFSGLMQIQFNGHLYTTQIGNFTFSILGDTMISAMDLN
FT                   SHPLYAIYLIVIGISYGFLFLYYLSLKLIKQKSIQDW"
FT   CDS             join(28411884..28411946,28415274..28415375,
FT                   28417194..28417302,28426260..>28426419)
FT                   /codon_start=1
FT                   /gene="Abcg8"
FT                   /locus_tag="mCG_15590"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 8, isoform CRA_c"
FT                   /note="gene_id=mCG15590.2 transcript_id=mCT170891.0
FT                   protein_id=mCP93809.0 isoform=CRA_c"
FT                   /protein_id="EDL38585.1"
FT                   /translation="MAEKTKEETQLWNGTVLQDASGLQDSLFSSESDNSLYFTYSGQSN
FT                   TLEVRDLTYQVDIASQVPWFEQLAQFKIPWRSHSSQDSCELGIRNLNFLLVWLVVFCCR
FT                   TMALAASAMLPTFHMSSFFCNALYNSFYLTAGFMINLDNL"
FT   gene            complement(28434421..28519575)
FT                   /gene="Lrpprc"
FT                   /locus_tag="mCG_15600"
FT                   /note="gene_id=mCG15600.1"
FT   mRNA            complement(join(28434421..28434647,28435074..28435216,
FT                   28436269..28436353,28437270..28437344,28439456..28439571,
FT                   28439700..28439839,28441863..28442064,28445905..28445993,
FT                   28451975..28452101,28455585..28455693,28455812..28455954,
FT                   28460435..28460525,28461039..28461107,28469330..28469436,
FT                   28469804..28469928,28478261..28478468,28479808..28479893,
FT                   28480524..28480654,28481609..28481722,28482029..28482073,
FT                   28482414..28482491,28482705..28482811,28483841..28483898,
FT                   28485558..28485585,28491258..28491324,28493764..28493857,
FT                   28496306..28496424,28498908..28499015,28499313..28499418,
FT                   28499667..28499812,28500156..28500300,28500737..28500863,
FT                   28501406..28501492,28502357..28502415,28502521..28502642,
FT                   28504702..28504824,28506057..28506250,28519412..28519575))
FT                   /gene="Lrpprc"
FT                   /locus_tag="mCG_15600"
FT                   /product="leucine-rich PPR-motif containing"
FT                   /note="gene_id=mCG15600.1 transcript_id=mCT18738.2 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(28434591..28434647,28435074..28435216,
FT                   28436269..28436353,28437270..28437344,28439456..28439571,
FT                   28439700..28439839,28441863..28442064,28445905..28445993,
FT                   28451975..28452101,28455585..28455693,28455812..28455954,
FT                   28460435..28460525,28461039..28461107,28469330..28469436,
FT                   28469804..28469928,28478261..28478468,28479808..28479893,
FT                   28480524..28480654,28481609..28481722,28482029..28482073,
FT                   28482414..28482491,28482705..28482811,28483841..28483898,
FT                   28485558..28485585,28491258..28491324,28493764..28493857,
FT                   28496306..28496424,28498908..28499015,28499313..28499418,
FT                   28499667..28499812,28500156..28500300,28500737..28500863,
FT                   28501406..28501492,28502357..28502415,28502521..28502642,
FT                   28504702..28504824,28506057..28506250,28519412..28519560))
FT                   /codon_start=1
FT                   /gene="Lrpprc"
FT                   /locus_tag="mCG_15600"
FT                   /product="leucine-rich PPR-motif containing"
FT                   /note="gene_id=mCG15600.1 transcript_id=mCT18738.2
FT                   protein_id=mCP23647.2"
FT                   /protein_id="EDL38586.1"
FT                   /translation="MAALLRPARWLLGAAAAPRLPLSLRLPAGVPGRLSSVVRVAAVGS
FT                   RPAAGERLSQARLYAIVAEKRDLQEEPAPVRKNSSQFDWALMRLDNSVRRTGRITKGLL
FT                   QRVFESTCSSGSPGSNQALLLLRSCGSLLPELSLAERTEFAHKIWDKLQQLGVVYDVSH
FT                   YNALLKVYLQNEYKFSPTDFLAKMEGANIQPNRVTYQRLIAAYCNVGDIEGASKILGFM
FT                   KTKDLPITEAVFSALVTGHARAGDMENAENILTVMKQAGIEPGPDTYLALLNAHAERGD
FT                   IGQVRQILEKVEKSDHYFMDRDFLQVIFSFSKAGYPQYVSEILEKITYERRSIPDAMNL
FT                   ILFLATEKLEDTAFQVLLALPLSKDESSDNFGSFFLRHCVTLDLPPEKLIDYCRRLRDA
FT                   KLHSSSLQFTLHCALQANRTALAKAVMEALREEGFPIRPHYFWPLLAGHQKTKNVQGII
FT                   DILKIMNKVGVDPDQETYINYVFPCFDSAQSVRAALQENECLLASSTFAQAEVKNEAIN
FT                   GNLQNILSFLESNTLPFSFSSLRNSLILGFRRSMNIDLWSKITELLYKDERYCSKPPGP
FT                   AEAVGYFLYNLIDSMSDSEVQAKEERLRQYFHQLQEMNVKVPENIYKGICNLLNTYHVP
FT                   ELIKDIKVLVDREKVDSQKTSQVTSSDLESTLEKLKAEGQPVGSALKQLLLLLCSEENM
FT                   QKALEVKAKYESDMVIGGYAALINLCCRHDNAEDAWNLKQEVDRLDASAILDTAKYVAL
FT                   VKVLGKHSRLQDAINILKEMKEKDVVIKDATVLSFFHILNGAALRGEIETVKQLHEAIV
FT                   TLGLAKPSSNISFPLVTVHLEKGDLPAALEASIACHKKYKVLPRIHDVLCKLVEKGETD
FT                   LIQKAMDFVSQEQGEMTMLYDLFFAFLQTGNYKEAKKIIETPGIRARPTRLQWFCDRCI
FT                   ASNQVEALEKLVELTEKLFECDRDQMYYNLLKLYKISSDWQRADAAWTKMQEENIIPRE
FT                   RTLRLLAEILKTSNQEVPFDVPELWFGDDRPSLSPSSRSAGEDVTEKTLLSNCKLKKSK
FT                   DAYNIFLKAEKQNVVFSSETYSTLIGLLLSKDDFTQAMHVKDFAETHIKGFTLNDAANS
FT                   LLIIRQVRRDYLKGALATLRAALDLKQVPSQIAVTRLIQALALKGDVESIEAIQRMVAG
FT                   LDTIGLSKMVFINNIALAQMKNNKLDAAIENIEHLLASENQAIEPQYFGLSYLFRKVIE
FT                   EQMEPALEKLSIMSERMANQFALYKPVTDLFLQLVDSGKVDEARALLERCGAIAEQSSL
FT                   LSVFCLRTSQKPKKAPVLKTLLELIPELRDNDKVYSCSMKSYALDKDVASAKALYEYLT
FT                   AKNLKLDDLFLKRYAALLKDVGEPVPFPEPPESFAFYIKQLKEARESPS"
FT   gene            28582084..28583009
FT                   /pseudo
FT                   /locus_tag="mCG_141335"
FT                   /note="gene_id=mCG141335.0"
FT   mRNA            join(28582084..28582516,28582852..28583009)
FT                   /pseudo
FT                   /locus_tag="mCG_141335"
FT                   /note="gene_id=mCG141335.0 transcript_id=mCT174663.0
FT                   created on 25-OCT-2002"
FT   gene            <28634913..28636002
FT                   /locus_tag="mCG_141334"
FT                   /note="gene_id=mCG141334.0"
FT   mRNA            <28634913..28636002
FT                   /locus_tag="mCG_141334"
FT                   /product="mCG141334"
FT                   /note="gene_id=mCG141334.0 transcript_id=mCT174662.0
FT                   created on 25-OCT-2002"
FT   CDS             <28634915..28635592
FT                   /codon_start=1
FT                   /locus_tag="mCG_141334"
FT                   /product="mCG141334"
FT                   /note="gene_id=mCG141334.0 transcript_id=mCT174662.0
FT                   protein_id=mCP97581.0"
FT                   /protein_id="EDL38587.1"
FT                   /translation="LESRFHHLSSSSRTGAETLLEGSTAMAAQGEPQVQFKLILASDGG
FT                   TGKTTFVKRHLTGKFEKKYVGTLGVEVHLLVFHTNRGPIKFNVWDTAHQEKFGGLRDGC
FT                   YIQAQGAIIMFDVTSRVTYKNVPNWHRDLVRVCGNIPIVLCGNKVDIKDRKVKAKPILF
FT                   HQKKNLQYYDISARSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAHT
FT                   SMI"
FT   gene            complement(28641305..28681838)
FT                   /locus_tag="mCG_148339"
FT                   /note="gene_id=mCG148339.0"
FT   mRNA            complement(join(28641305..28641516,28643850..28643921,
FT                   28673397..28673478,28681612..28681838))
FT                   /locus_tag="mCG_148339"
FT                   /product="mCG148339"
FT                   /note="gene_id=mCG148339.0 transcript_id=mCT188602.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(28641375..28641516,28643850..28643921,
FT                   28673397..28673449))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148339"
FT                   /product="mCG148339"
FT                   /note="gene_id=mCG148339.0 transcript_id=mCT188602.0
FT                   protein_id=mCP108814.0"
FT                   /protein_id="EDL38588.1"
FT                   /translation="MCIERRKVDEHQHATAMRSVRIFWARRLKTMLQLPDLLVLYRNVL
FT                   PSRLCAWQSMLVEVRGSLVDRLPPSISTWAPGIRLTPSGLRDT"
FT   gene            <28682619..28747420
FT                   /locus_tag="mCG_15599"
FT                   /note="gene_id=mCG15599.2"
FT   mRNA            join(<28682619..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28747123..28747420)
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, transcript variant mCT172474"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172474.0 created
FT                   on 30-AUG-2002"
FT   mRNA            join(<28682619..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28738837..28740549)
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, transcript variant mCT172476"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172476.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(<28682619..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28738837..28738875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, isoform CRA_c"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172476.0
FT                   protein_id=mCP95394.0 isoform=CRA_c"
FT                   /protein_id="EDL38591.1"
FT                   /translation="RGRLCGGRARETSLSTFAPDSLLNMGAFLDKPKTEKHNAHGAGNG
FT                   LRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHIT
FT                   TNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMV
FT                   SPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAV
FT                   SRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEF
FT                   VKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHL
FT                   ESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKD
FT                   NDGGAGDLEDSLVAL"
FT   mRNA            join(<28682619..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28736994..28738116)
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, transcript variant mCT18737"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT18737.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(<28682619..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28736994..28737293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, isoform CRA_e"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT18737.2
FT                   protein_id=mCP23642.1 isoform=CRA_e"
FT                   /protein_id="EDL38593.1"
FT                   /translation="RGRLCGGRARETSLSTFAPDSLLNMGAFLDKPKTEKHNAHGAGNG
FT                   LRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHIT
FT                   TNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMV
FT                   SPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAV
FT                   SRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEF
FT                   VKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHL
FT                   ESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKD
FT                   NDGASDEAEEGGSQGKLVEALRQMRVNHRGNYRQLLEEMLTSYRLAKVEGEESPADPAA
FT                   AAASSNSDGGNPVAMQERDTEGGPAGLDSRNEDAGTKRSAENI"
FT   CDS             join(<28682658..28682676,28717811..28718670,
FT                   28726666..28726783,28728312..28728423,28728909..28728966,
FT                   28747123..28747161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, isoform CRA_a"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172474.0
FT                   protein_id=mCP95395.0 isoform=CRA_a"
FT                   /protein_id="EDL38589.1"
FT                   /translation="LSTFAPDSLLNMGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRV
FT                   EMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGS
FT                   ALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDS
FT                   RAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVD
FT                   GKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLEN
FT                   VCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGE
FT                   EGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDNDGMADLSTSICK
FT                   PS"
FT   mRNA            join(<28689170..28689202,28698151..28698252,
FT                   28717811..28718670,28726666..28726783,28728312..28728423,
FT                   28728909..28728966,28746459..28746506,28747123..28747420)
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, transcript variant mCT172475"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172475.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(<28689172..28689202,28698151..28698252,
FT                   28717811..28718670,28726666..28726783,28728312..28728423,
FT                   28728909..28728966,28746459..28746506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, isoform CRA_b"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172475.0
FT                   protein_id=mCP95393.0 isoform=CRA_b"
FT                   /protein_id="EDL38590.1"
FT                   /translation="ASVLHVVRTTGCQKQSAVDLPWASKFRKLRTNKACWRRFLGGPFY
FT                   SLLNMGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSF
FT                   FAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKID
FT                   EYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCN
FT                   PVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRA
FT                   EEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVV
FT                   LVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNL
FT                   PPGGGLAGKRHVIEAVYSRLNPHKDNDGFYQPSIAYSDNVFLL"
FT   mRNA            join(<28717825..28718670,28726666..28726783,
FT                   28728312..28728423,28728909..28728966,28738837..28738863,
FT                   28746459..28746506,28747123..28747206)
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, transcript variant mCT172477"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172477.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(28717825..28718670,28726666..28726783,
FT                   28728312..28728423,28728909..28728966,28738837..28738863,
FT                   28746459..28746506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15599"
FT                   /product="mCG15599, isoform CRA_d"
FT                   /note="gene_id=mCG15599.2 transcript_id=mCT172477.0
FT                   protein_id=mCP95396.0 isoform=CRA_d"
FT                   /protein_id="EDL38592.1"
FT                   /translation="MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVG
FT                   IPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKT
FT                   GIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVC
FT                   FSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSP
FT                   EPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLH
FT                   KGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMR
FT                   ILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDNDGGAGDLEDSLFYQPSIAYSDNV
FT                   FLL"
FT   gene            28751785..28787133
FT                   /gene="Slc3a1"
FT                   /locus_tag="mCG_15593"
FT                   /note="gene_id=mCG15593.3"
FT   mRNA            join(28751785..28752285,28755886..28756065,
FT                   28756202..28756356,28760606..28760731,28769923..28770042,
FT                   28772131..28772255,28775168..28775363,28782607..28782774,
FT                   28783694..28783810,28786524..28787133)
FT                   /gene="Slc3a1"
FT                   /locus_tag="mCG_15593"
FT                   /product="solute carrier family 3, member 1"
FT                   /note="gene_id=mCG15593.3 transcript_id=mCT18711.3 created
FT                   on 30-NOV-2004"
FT   CDS             join(28751859..28752285,28755886..28756065,
FT                   28756202..28756356,28760606..28760731,28769923..28770042,
FT                   28772131..28772255,28775168..28775363,28782607..28782774,
FT                   28783694..28783810,28786524..28786967)
FT                   /codon_start=1
FT                   /gene="Slc3a1"
FT                   /locus_tag="mCG_15593"
FT                   /product="solute carrier family 3, member 1"
FT                   /note="gene_id=mCG15593.3 transcript_id=mCT18711.3
FT                   protein_id=mCP23697.3"
FT                   /db_xref="GOA:Q91WV7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="MGI:MGI:1195264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91WV7"
FT                   /protein_id="EDL38594.1"
FT                   /translation="MDEDKGKRDPIQMSLKGCRTNNGFVQNEDIPEQDPDPGSRDTPQP
FT                   NAVSIPAPEEPHLKAVRPYAGMPKEVLFQFSGQARYRVPREILFWLTVVSVFLLIGATI
FT                   AIIVISPKCLDWWQAGPIYQIYPRSFKDSDKDGNGDLKGIQEKLDYITALNIKTLWITS
FT                   FYKSSLKDFRYAVEDFKEIDPIFGTMKDFENLVAAIHDKGLKLIIDFIPNHTSDKHPWF
FT                   QSSRTRSGKYTDYYIWHNCTHVNGVTTPPNNWLSVYGNSSWHFDEVRKQCYFHQFLKEQ
FT                   PDLNFRNPAVQEEIKEIITFWLSKGVDGFSFDAVKFLLEAKDLRNEIQVNTSQIPDTVT
FT                   HYSELYHDFTTTQVGMHDIVRDFRQTMNQYSREPGRYRFMGAEASAESIERTMMYYGLP
FT                   FIQEADFPFNKYFTTIGTLSGHTVYEVITSWMENMPEGKWPNWMTGGPETPRLTSRVGS
FT                   EYVNAMHMLLFTLPGTPITYYGEEIGMGDISVTNFNESYDSTTLVSKSPMQWDNSSNAG
FT                   FTEANHTWLPTNSDYHTVNVDVQKTQPSSALRLYQDLSLLHATELVLSRGWFCLLRDDS
FT                   HSVVYTRELDGIDNVFLVVLNFGESSTVLNLQGIISDLPPELRIRLSTNSASKGSAVDT
FT                   RAISLEKGEGLVLEHSTKAPLHQQAAFRDRCFVSSRACYSSALDILYSSC"
FT   gene            complement(28786368..28813109)
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /note="gene_id=mCG15598.3"
FT   mRNA            complement(join(28786368..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806145,28813071..28813109))
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, transcript variant
FT                   mCT194655"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT194655.0 created
FT                   on 30-NOV-2004"
FT   mRNA            complement(join(28786368..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806145,28812932..28813082))
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, transcript variant
FT                   mCT18736"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT18736.3 created
FT                   on 30-NOV-2004"
FT   mRNA            complement(join(28786368..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806145,28811166..28811265,
FT                   28812932..28813082))
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, transcript variant
FT                   mCT193663"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT193663.1 created
FT                   on 30-NOV-2004"
FT   mRNA            complement(join(28786368..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806145,28811166..28811701,
FT                   28812932..28813082))
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, transcript variant
FT                   mCT193664"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT193664.1 created
FT                   on 30-NOV-2004"
FT   CDS             complement(join(28787532..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806145,28811166..28811378))
FT                   /codon_start=1
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, isoform CRA_b"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT193664.1
FT                   protein_id=mCP114648.1 isoform=CRA_b"
FT                   /protein_id="EDL38596.1"
FT                   /translation="MLQTAKFSLRALKHSIPHLGNCMQKQSYRNVAGPYYSRVRLKKYH
FT                   LTKCLQNKPRIAGLARNIPSRSFSCKDLLPIKPESEKPISENMDAFEKVRTRLETQPQE
FT                   EYEVVNAEIKHGGFVYYQEGCCLVRSKDEEADSDNYEVLFNLEELKLDQPFIDCIRVAP
FT                   DEKYVAAKIRTEDSETSTLVVVKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRN
FT                   LRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGL
FT                   SPWDPPVLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFKLMRTAADAPAIMNWDLFFT
FT                   MKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDP
FT                   KNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRIEAKSKDGKLVPMTV
FT                   FHKTDSEDLQRKPLLVHVYGAYGMDLKMNFRPEKRVLVDDGWILAYCHVRGGGELGLQW
FT                   HADGRLTKKLNGLADLVACIKTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRA
FT                   VTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNIKPQHYPSV
FT                   HITAYENDERVPLKGIVNYTEKLKEAVAEHTKGAGEGYQPPNIILDIQPGGNHVIEDSH
FT                   KKITTQMKFLYEELGLDSTDAFEALKKYLKF"
FT   CDS             complement(join(28787532..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806097))
FT                   /codon_start=1
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT194655.0
FT                   protein_id=mCP115684.0 isoform=CRA_a"
FT                   /protein_id="EDL38595.1"
FT                   /translation="MDAFEKVRTRLETQPQEEYEVVNAEIKHGGFVYYQEGCCLVRSKD
FT                   EEADSDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKLSDQP
FT                   VMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSY
FT                   FVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGMLYYVEHRDDELY
FT                   ILTNVGEPTEFKLMRTAADAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLY
FT                   VNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFE
FT                   ETGHEDPITKTSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKM
FT                   NFRPEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLVACIKTLHSQGF
FT                   SQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVLNTMLDTTLPLTLEELEE
FT                   WGNPSSDEKHKNYIKRYCPCQNIKPQHYPSVHITAYENDERVPLKGIVNYTEKLKEAVA
FT                   EHTKGAGEGYQPPNIILDIQPGGNHVIEDSHKKITTQMKFLYEELGLDSTDAFEALKKY
FT                   LKF"
FT   CDS             complement(join(28787532..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806097))
FT                   /codon_start=1
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT193663.1
FT                   protein_id=mCP114647.1 isoform=CRA_a"
FT                   /protein_id="EDL38597.1"
FT                   /translation="MDAFEKVRTRLETQPQEEYEVVNAEIKHGGFVYYQEGCCLVRSKD
FT                   EEADSDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKLSDQP
FT                   VMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSY
FT                   FVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGMLYYVEHRDDELY
FT                   ILTNVGEPTEFKLMRTAADAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLY
FT                   VNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFE
FT                   ETGHEDPITKTSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKM
FT                   NFRPEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLVACIKTLHSQGF
FT                   SQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVLNTMLDTTLPLTLEELEE
FT                   WGNPSSDEKHKNYIKRYCPCQNIKPQHYPSVHITAYENDERVPLKGIVNYTEKLKEAVA
FT                   EHTKGAGEGYQPPNIILDIQPGGNHVIEDSHKKITTQMKFLYEELGLDSTDAFEALKKY
FT                   LKF"
FT   CDS             complement(join(28787532..28787621,28787930..28788003,
FT                   28788520..28788643,28789036..28789185,28791772..28791988,
FT                   28793315..28793490,28794798..28794995,28798751..28798936,
FT                   28799522..28799738,28801354..28801489,28803928..28804134,
FT                   28804843..28804909,28806023..28806097))
FT                   /codon_start=1
FT                   /gene="Prepl"
FT                   /locus_tag="mCG_15598"
FT                   /product="prolyl endopeptidase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15598.3 transcript_id=mCT18736.3
FT                   protein_id=mCP23707.3 isoform=CRA_a"
FT                   /protein_id="EDL38598.1"
FT                   /translation="MDAFEKVRTRLETQPQEEYEVVNAEIKHGGFVYYQEGCCLVRSKD
FT                   EEADSDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKLSDQP
FT                   VMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSY
FT                   FVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGMLYYVEHRDDELY
FT                   ILTNVGEPTEFKLMRTAADAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLY
FT                   VNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFE
FT                   ETGHEDPITKTSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKM
FT                   NFRPEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLVACIKTLHSQGF
FT                   SQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVLNTMLDTTLPLTLEELEE
FT                   WGNPSSDEKHKNYIKRYCPCQNIKPQHYPSVHITAYENDERVPLKGIVNYTEKLKEAVA
FT                   EHTKGAGEGYQPPNIILDIQPGGNHVIEDSHKKITTQMKFLYEELGLDSTDAFEALKKY
FT                   LKF"
FT   gene            28813429..29181372
FT                   /locus_tag="mCG_15596"
FT                   /note="gene_id=mCG15596.2"
FT   mRNA            join(28813429..28813689,28819314..28819486,
FT                   28836608..28836672,28925487..28925731)
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, transcript variant mCT18734"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT18734.1 created
FT                   on 30-AUG-2002"
FT   mRNA            join(28813430..28813689,28819314..28819486,
FT                   28836608..28836672,29114382..29114442,29116267..29116321,
FT                   29117409..29117472,29124948..29125014,29162184..29162247,
FT                   29174924..29175055,29180853..29181372)
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, transcript variant mCT172471"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172471.0 created
FT                   on 30-AUG-2002"
FT   mRNA            join(28813432..28813689,28819314..28819486,
FT                   28836608..28836672,29114382..29114442,29116267..29116321,
FT                   29117409..29117472,29124948..29125014,29154034..29154108,
FT                   29162184..29162247,29174924..29175055,29180853..29181372)
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, transcript variant mCT172472"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172472.0 created
FT                   on 30-AUG-2002"
FT   mRNA            join(28813436..28813689,28819314..28819486,
FT                   28836608..28836672,28849292..>28849386)
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, transcript variant mCT172473"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172473.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(28813552..28813689,28819314..28819486,
FT                   28836608..28836672,29114382..29114442,29116267..29116321,
FT                   29117409..29117472,29124948..29125014,29154034..29154108,
FT                   29162184..29162247,29174924..29175055,29180853..29180930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, isoform CRA_b"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172472.0
FT                   protein_id=mCP95392.0 isoform=CRA_b"
FT                   /db_xref="GOA:B9EHP1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR025800"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1920832"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHP1"
FT                   /protein_id="EDL38600.1"
FT                   /translation="MESQVAAAGAAETEAEAGKRPAMGSASQGSLVSAPKGAVRWQLLR
FT                   QVLKQKQLDDHLRHVSVRRFESFNLFSVTEATKKGTEKEAGVWVQYTSIFYPKYSISVR
FT                   HNSGSLNVEDVLTSFDNTGNVCIWPSEEVLAHYCLKHSHIFRDLAVCELGGGMTCLAGL
FT                   MVAISADVKEVLLTDGNEKAIRNVDSIIACNKKTGVFKTPKISSRVLRWDNETDVSQLE
FT                   GHFDIVMCADCLFLDQYRASLVDAIKRLLQPTGKAVVFAPRRGNTFNQFCNLAEKAGFS
FT                   LQRHENYDEPISNFHSKLKKEGSDIYEENLHYPLLLILTKTG"
FT   CDS             join(28813552..28813689,28819314..28819486,
FT                   28836608..28836672,29114382..29114442,29116267..29116321,
FT                   29117409..29117472,29124948..29125014,29162184..29162247,
FT                   29174924..29175055,29180853..29180930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, isoform CRA_a"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172471.0
FT                   protein_id=mCP95391.0 isoform=CRA_a"
FT                   /protein_id="EDL38599.1"
FT                   /translation="MESQVAAAGAAETEAEAGKRPAMGSASQGSLVSAPKGAVRWQLLR
FT                   QVLKQKQLDDHLRHVSVRRFESFNLFSVTEATKKGTEKEAGVWVQYTSIFYPKYSISVR
FT                   HNSGSLNVEDVLTSFDNTGNVCIWPSEEVLAHYCLKHSHIFRDLAVCELGGGMTCLAGL
FT                   MVAISADVKEVLLTDGNEKAIRNVDSIIACNKKTGVFKTPKISSRLFLDQYRASLVDAI
FT                   KRLLQPTGKAVVFAPRRGNTFNQFCNLAEKAGFSLQRHENYDEPISNFHSKLKKEGSDI
FT                   YEENLHYPLLLILTKTG"
FT   CDS             join(28813552..28813689,28819314..28819486,
FT                   28836608..28836672,28925487..28925548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, isoform CRA_d"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT18734.1
FT                   protein_id=mCP23705.2 isoform=CRA_d"
FT                   /protein_id="EDL38602.1"
FT                   /translation="MESQVAAAGAAETEAEAGKRPAMGSASQGSLVSAPKGAVRWQLLR
FT                   QVLKQKQLDDHLRHVSVRRFESFNLFSVTEATKKGTEKEAGVWVQYTSIFYPKYSISVR
FT                   HNSGSLNVEDVLTSFDNTGNVCDPPPAPHTGGVDGDVFLTT"
FT   CDS             join(28813552..28813689,28819314..28819486,
FT                   28836608..28836672,28849292..>28849386)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15596"
FT                   /product="mCG15596, isoform CRA_c"
FT                   /note="gene_id=mCG15596.2 transcript_id=mCT172473.0
FT                   protein_id=mCP95390.0 isoform=CRA_c"
FT                   /protein_id="EDL38601.1"
FT                   /translation="MESQVAAAGAAETEAEAGKRPAMGSASQGSLVSAPKGAVRWQLLR
FT                   QVLKQKQLDDHLRHVSVRRFESFNLFSVTEATKKGTEKEAGVWVQYTSIFYPKYSISVR
FT                   HNSGSLNVEDVLTSFDNTGNVYWKRKSRCLLSPLCAVLHLSAHVISPLCLSCC"
FT   gene            29221266..29221699
FT                   /pseudo
FT                   /locus_tag="mCG_1039301"
FT                   /note="gene_id=mCG1039301.1"
FT   mRNA            29221266..29221699
FT                   /pseudo
FT                   /locus_tag="mCG_1039301"
FT                   /note="gene_id=mCG1039301.1 transcript_id=mCT157005.1
FT                   created on 25-OCT-2002"
FT   gene            complement(29264492..29265569)
FT                   /pseudo
FT                   /locus_tag="mCG_49444"
FT                   /note="gene_id=mCG49444.2"
FT   mRNA            complement(29264492..29265569)
FT                   /pseudo
FT                   /locus_tag="mCG_49444"
FT                   /note="gene_id=mCG49444.2 transcript_id=mCT49627.2 created
FT                   on 27-SEP-2002"
FT   gene            complement(29332760..29341843)
FT                   /locus_tag="mCG_21292"
FT                   /note="gene_id=mCG21292.2"
FT   mRNA            complement(join(29332760..29334185,29338019..29338168,
FT                   29340489..29341843))
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, transcript variant mCT172970"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT172970.0 created
FT                   on 12-SEP-2002"
FT   mRNA            complement(join(29333531..29335264,29337073..29337117,
FT                   29338019..29338168,29340489..>29340829))
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, transcript variant mCT193668"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT193668.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(29333673..>29334077)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, isoform CRA_c"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT193668.0
FT                   protein_id=mCP114655.0 isoform=CRA_c"
FT                   /protein_id="EDL38605.1"
FT                   /translation="RCVEGMDGMHEHIHLVVQMQTKATMSAWSDAQTCTEMYRKPRRVG
FT                   STRVQYKYRVQCKMPSGPGEKPSLTLLYGKFLKKGPRNDLPQRLPLGSHTCSVWRHPEE
FT                   ASTAKTLFGLVISVACCLFFILCLGNCALE"
FT   CDS             complement(join(29334117..29334185,29338019..29338144))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, isoform CRA_b"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT172970.0
FT                   protein_id=mCP95888.0 isoform=CRA_b"
FT                   /protein_id="EDL38604.1"
FT                   /translation="MLTSPPSYAGQSEIANLKTPFNASFQLLLKTNVGPGIEELQSIPK
FT                   VSSSSGMCVHRRYSVREHT"
FT   mRNA            complement(join(29335147..29335264,29337073..29337152,
FT                   29338019..29338168,29340489..29341843))
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, transcript variant mCT20949"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT20949.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(29335240..29335264,29337073..29337152,
FT                   29338019..29338144))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, isoform CRA_d"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT20949.2
FT                   protein_id=mCP23687.2 isoform=CRA_d"
FT                   /protein_id="EDL38606.1"
FT                   /translation="MLTSPPSYAGQSEIANLKTPFNASFQLLLKTNVGPGIEELQSLGF
FT                   CFCVSTSSRSGAGRPQTDSQQVAGLPNSLDF"
FT   gene            29335881..29347782
FT                   /gene="Six3"
FT                   /locus_tag="mCG_50120"
FT                   /note="gene_id=mCG50120.1"
FT   mRNA            join(29335881..29335987,29343937..29344594,
FT                   29346320..29347782)
FT                   /gene="Six3"
FT                   /locus_tag="mCG_50120"
FT                   /product="sine oculis-related homeobox 3 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG50120.1 transcript_id=mCT50303.2 created
FT                   on 12-SEP-2002"
FT   CDS             join(29335933..29335987,29343937..29344594,
FT                   29346320..29346512)
FT                   /codon_start=1
FT                   /gene="Six3"
FT                   /locus_tag="mCG_50120"
FT                   /product="sine oculis-related homeobox 3 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG50120.1 transcript_id=mCT50303.2
FT                   protein_id=mCP43040.2"
FT                   /protein_id="EDL38607.1"
FT                   /translation="MNIYPPLLHAPGFSYLSAGNRAGGGGAGGAGGGSGGGGSRAPPEE
FT                   LSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRAR
FT                   AVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVR
FT                   KKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNW
FT                   FKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTE
FT                   RADTGTSILSVTSSDSECDV"
FT   mRNA            complement(join(29336058..29336152,29337070..29337117,
FT                   29338019..29338168,29339710..29340062,29340489..29341843))
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, transcript variant mCT172969"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT172969.0 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(29337091..29337117,29338019..29338144))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21292"
FT                   /product="mCG21292, isoform CRA_a"
FT                   /note="gene_id=mCG21292.2 transcript_id=mCT172969.0
FT                   protein_id=mCP95889.0 isoform=CRA_a"
FT                   /protein_id="EDL38603.1"
FT                   /translation="MLTSPPSYAGQSEIANLKTPFNASFQLLLKTNVGPGIEELQSIRS
FT                   WPTPD"
FT   gene            complement(29408091..29411839)
FT                   /gene="Six2"
FT                   /locus_tag="mCG_21293"
FT                   /note="gene_id=mCG21293.2"
FT   mRNA            complement(join(29408091..29409315,29411195..29411839))
FT                   /gene="Six2"
FT                   /locus_tag="mCG_21293"
FT                   /product="sine oculis-related homeobox 2 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG21293.2 transcript_id=mCT21073.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(29408985..29409315,29411195..29411754))
FT                   /codon_start=1
FT                   /gene="Six2"
FT                   /locus_tag="mCG_21293"
FT                   /product="sine oculis-related homeobox 2 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG21293.2 transcript_id=mCT21073.2
FT                   protein_id=mCP23688.1 partial"
FT                   /protein_id="EDL38608.1"
FT                   /translation="MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHK
FT                   NESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLG
FT                   AVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGL
FT                   TTTQVSNWFKNRRQRDRAAEAKERENSENSNSSSHNPLASSLNGSGKSVLGSSEDEKTP
FT                   SGTPDHSSSSPALLLSPPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHSLQD
FT                   SILNPMSANLVDLGS"
FT   gene            29414710..29419426
FT                   /locus_tag="mCG_145587"
FT                   /note="gene_id=mCG145587.0"
FT   mRNA            29414710..29419426
FT                   /locus_tag="mCG_145587"
FT                   /product="mCG145587"
FT                   /note="gene_id=mCG145587.0 transcript_id=mCT185011.0
FT                   created on 24-JUN-2003"
FT   CDS             29416829..29417155
FT                   /codon_start=1
FT                   /locus_tag="mCG_145587"
FT                   /product="mCG145587"
FT                   /note="gene_id=mCG145587.0 transcript_id=mCT185011.0
FT                   protein_id=mCP106309.0 partial"
FT                   /protein_id="EDL38609.1"
FT                   /translation="MASSSYLLLYNPSIFFKTPILFVGKSSNELGVLLQRAELECHGLG
FT                   SHRLKIQGSLPTTSGHSLQSQESFLSDFNRCVCVCVCVCVRARVCVSACSVFSCTFSIF
FT                   KNSL"
FT   gene            <29543026..29544318
FT                   /locus_tag="mCG_50438"
FT                   /note="gene_id=mCG50438.2"
FT   mRNA            join(<29543026..29543059,29543704..29543911,
FT                   29544093..29544318)
FT                   /locus_tag="mCG_50438"
FT                   /product="mCG50438"
FT                   /note="gene_id=mCG50438.2 transcript_id=mCT50621.2 created
FT                   on 25-OCT-2002"
FT   CDS             join(<29543027..29543059,29543704..29543748)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50438"
FT                   /product="mCG50438"
FT                   /note="gene_id=mCG50438.2 transcript_id=mCT50621.2
FT                   protein_id=mCP43018.2"
FT                   /protein_id="EDL38610.1"
FT                   /translation="LESPQGTTSKQLLAVGIFIYQSEIS"
FT   gene            29640658..29641307
FT                   /pseudo
FT                   /locus_tag="mCG_141333"
FT                   /note="gene_id=mCG141333.0"
FT   mRNA            29640658..29641307
FT                   /pseudo
FT                   /locus_tag="mCG_141333"
FT                   /note="gene_id=mCG141333.0 transcript_id=mCT174661.0
FT                   created on 25-OCT-2002"
FT   gene            complement(29717909..29878916)
FT                   /gene="Srbd1"
FT                   /locus_tag="mCG_21294"
FT                   /note="gene_id=mCG21294.2"
FT   mRNA            complement(join(29717909..29718726,29721568..29721752,
FT                   29730760..29730801,29733574..29733726,29734562..29734738,
FT                   29736973..29737079,29784060..29784142,29790650..29790741,
FT                   29831978..29832085,29832671..29832761,29836309..29836466,
FT                   29842693..29842800,29848786..29848889,29853488..29853623,
FT                   29854227..29854323,29859696..29859834,29861323..29861440,
FT                   29863715..29863881,29869756..29870127,29872757..29872937,
FT                   29876048..29876127,29878809..29878916))
FT                   /gene="Srbd1"
FT                   /locus_tag="mCG_21294"
FT                   /product="S1 RNA binding domain 1"
FT                   /note="gene_id=mCG21294.2 transcript_id=mCT21074.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(29718437..29718726,29721568..29721752,
FT                   29730760..29730801,29733574..29733726,29734562..29734738,
FT                   29736973..29737079,29784060..29784142,29790650..29790741,
FT                   29831978..29832085,29832671..29832761,29836309..29836466,
FT                   29842693..29842800,29848786..29848889,29853488..29853623,
FT                   29854227..29854323,29859696..29859834,29861323..29861440,
FT                   29863715..29863881,29869756..29870127,29872757..29872937,
FT                   29876048..29876127))
FT                   /codon_start=1
FT                   /gene="Srbd1"
FT                   /locus_tag="mCG_21294"
FT                   /product="S1 RNA binding domain 1"
FT                   /note="gene_id=mCG21294.2 transcript_id=mCT21074.2
FT                   protein_id=mCP23689.2"
FT                   /protein_id="EDL38611.1"
FT                   /translation="MPSLRKRVKIQAENAEPKDECSFFSELSSGSEEDNKEDSIWEPQK
FT                   KVPRNRRQPASKGSKRKQGPRAKKSSQQVDDESKDVAVKEELNSPVAIVDADLEEKSHK
FT                   LQTTKTLKTAAKKQKKPVPRAKKRLKVDEETSQASPLEGGGSNVETPSTSACGNVCKKE
FT                   ESEDSFTFGQSPVKRIRTESCPQGRPARVPDGVSDIKEEVEMNWDVVQVLSERTNIEPW
FT                   VCANIIRLFNDDNTIPFIVRYRKELINNLDADFLREVRQTLDELRDVAKKVHSRIQKIK
FT                   KEGKMSECLLQALLNCKTFEELEHVSAPYKMGSKGTKAQRAKQLGLEGAAWTLLENPGQ
FT                   LNLLSYIKPDVKGLSELNDIETGVQHILADMIAKDKDTLDFIRGLCKHRYICIQSSLAK
FT                   VSSKKVNEKEVDKFQLYQNFSCNIRTIHHHQILAINRGENLKILTVKVNISDGVKNEFC
FT                   RWCIQNRWRPRGFARPELMKILHNSLDDSFKRLIVPLLCREFRAKLTSDAEKQSVMMFG
FT                   QNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGFREAEKI
FT                   KRLLLHFNCRTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYCIVSEAGASIYSVSPE
FT                   ANKEMPGLDPNLRSAVSIARRVQDPLAELVKFDPKHIGVGMYQHDVSQTLLKATLDSVV
FT                   EECVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKS
FT                   FQQCAGFVRINQDYIRTFCSQHTDSSGQSQETAMVTNEKLGKKKNKADATLIPNPLDQT
FT                   CIHPESYDIAVSKRDTNFWSLYILYWFLSFIGGTMCEIGKPEMQQKINVSLGKEGIEET
FT                   AERLQTTVHTLQVIIDGLSQPKTFDIRTDFDKPDFKRSIVCLEDLQVGTVLTGKVENAT
FT                   LFGVFVDIGVGKAGLIPIRFITEAKLSKTKRRRSLGLGPGEKVEVKVLNVDIPRSRISL
FT                   DLLRVL"
FT   gene            <29902410..30397900
FT                   /gene="Prkce"
FT                   /locus_tag="mCG_20408"
FT                   /note="gene_id=mCG20408.2"
FT   mRNA            join(<29902410..29902757,30092469..30092532,
FT                   30213018..30213177,30214216..30214250,30215507..30215592,
FT                   30220814..30220943,30226852..30226994,30229439..30229535,
FT                   30231909..30232108,30234935..30235108,30298555..30298709,
FT                   30361343..30361481,30366663..30366851,30371874..30372020,
FT                   30396413..30397900)
FT                   /gene="Prkce"
FT                   /locus_tag="mCG_20408"
FT                   /product="protein kinase C, epsilon"
FT                   /note="gene_id=mCG20408.2 transcript_id=mCT21077.2 created
FT                   on 26-JUL-2002"
FT   CDS             join(29902410..29902757,30092469..30092532,
FT                   30213018..30213177,30214216..30214250,30215507..30215592,
FT                   30220814..30220943,30226852..30226994,30229439..30229535,
FT                   30231909..30232108,30234935..30235108,30298555..30298709,
FT                   30361343..30361481,30366663..30366851,30371874..30372020,
FT                   30396413..30396559)
FT                   /codon_start=1
FT                   /gene="Prkce"
FT                   /locus_tag="mCG_20408"
FT                   /product="protein kinase C, epsilon"
FT                   /note="gene_id=mCG20408.2 transcript_id=mCT21077.2
FT                   protein_id=mCP23696.2"
FT                   /protein_id="EDL38612.1"
FT                   /translation="MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALN
FT                   VDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEE
FT                   LLQNGSRHFEDWIDLEPEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRR
FT                   VHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAG
FT                   LKKQETPDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVH
FT                   RRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSE
FT                   DDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRASSATDGQLASPGENGEVRPGQ
FT                   AKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKR
FT                   ILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVT
FT                   SALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIMNGVTTTTFCGTPDYIAP
FT                   EILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAV
FT                   SILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRD
FT                   VNNFDQDFTREEPILTLVDEAIIKQINQEEFKGFSYFGEDLMP"
FT   gene            complement(30022334..30024357)
FT                   /locus_tag="mCG_59983"
FT                   /note="gene_id=mCG59983.1"
FT   mRNA            complement(join(30022334..30022615,30023376..30023472,
FT                   30024078..30024357))
FT                   /locus_tag="mCG_59983"
FT                   /product="mCG59983"
FT                   /note="gene_id=mCG59983.1 transcript_id=mCT60166.1 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(30023432..30023472,30024078..30024246))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59983"
FT                   /product="mCG59983"
FT                   /note="gene_id=mCG59983.1 transcript_id=mCT60166.1
FT                   protein_id=mCP43070.2"
FT                   /protein_id="EDL38613.1"
FT                   /translation="MEFRWFQKPRPDCLPGPVTRKQPWLAATFRTACSVRSHTGSCLPS
FT                   DILLTPDQRQSASPCPRPKPSSPG"
FT   gene            complement(30236740..30244244)
FT                   /locus_tag="mCG_125396"
FT                   /note="gene_id=mCG125396.1"
FT   mRNA            complement(join(30236740..30238089,30243582..30244244))
FT                   /locus_tag="mCG_125396"
FT                   /product="mCG125396"
FT                   /note="gene_id=mCG125396.1 transcript_id=mCT126656.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(join(30237733..30238089,30243582..30243584))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125396"
FT                   /product="mCG125396"
FT                   /note="gene_id=mCG125396.1 transcript_id=mCT126656.1
FT                   protein_id=mCP70779.1"
FT                   /db_xref="GOA:Q8C648"
FT                   /db_xref="MGI:MGI:3641941"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C648"
FT                   /protein_id="EDL38614.1"
FT                   /translation="MSLRKKTTAHHQGQNSLEERNLKSLFEFSLVLQQAAAGKLNWAIM
FT                   VVTNGSAWPSLLDARKGTGPYFTLSQALPANLYMAPSLKFCIIDQDALKAASRRAIPPC
FT                   ILKPESVSDFSNCCN"
FT   gene            30495072..30574476
FT                   /gene="Epas1"
FT                   /locus_tag="mCG_20417"
FT                   /note="gene_id=mCG20417.2"
FT   mRNA            join(30495072..30495567,30538513..30538703,
FT                   30547443..30547594,30548005..30548089,30551607..30551725,
FT                   30551833..30552038,30561445..30561551,30566739..30566886,
FT                   30567467..30567681,30568642..30568832,30569567..30569677,
FT                   30570555..30571060,30571753..30571879,30572049..30572163,
FT                   30572373..30572546,30574015..30574476)
FT                   /gene="Epas1"
FT                   /locus_tag="mCG_20417"
FT                   /product="endothelial PAS domain protein 1"
FT                   /note="gene_id=mCG20417.2 transcript_id=mCT21086.2 created
FT                   on 26-JUL-2002"
FT   CDS             join(30495542..30495567,30538513..30538703,
FT                   30547443..30547594,30548005..30548089,30551607..30551725,
FT                   30551833..30552038,30561445..30561551,30566739..30566886,
FT                   30567467..30567681,30568642..30568832,30569567..30569677,
FT                   30570555..30571060,30571753..30571879,30572049..30572163,
FT                   30572373..30572546,30574015..30574166)
FT                   /codon_start=1
FT                   /gene="Epas1"
FT                   /locus_tag="mCG_20417"
FT                   /product="endothelial PAS domain protein 1"
FT                   /note="gene_id=mCG20417.2 transcript_id=mCT21086.2
FT                   protein_id=mCP23683.1"
FT                   /db_xref="GOA:Q6PEU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001067"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014887"
FT                   /db_xref="InterPro:IPR021537"
FT                   /db_xref="MGI:MGI:109169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PEU2"
FT                   /protein_id="EDL38615.1"
FT                   /translation="MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPH
FT                   SVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQ
FT                   DGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVS
FT                   TERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCL
FT                   IIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFY
FT                   HALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCV
FT                   NYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSDDVAVTEKSNYLFTKLKEEPEE
FT                   LAQLAPTPGDAIISLDFGSQNFDEPSAYGKAILPPGQPWAAGLRSHSAQSESGSLPAFT
FT                   VPQAGTPGNTTPSASSSSSCSTPSSPEDYYSSLENPLKIEVIEKLFAMDTEPRDPGSTQ
FT                   TDFSELDLETLAPYIPMDGEDFQLSPICPEEPLMPESPQPTPQHCFSTMTSIFQPLTPG
FT                   ATHGPFFLDKYPQQLESRKTESEHWPMSSIFFDAGSKGSLSPCCGQASTPLSSMGGRSN
FT                   TQWPPDPPLHFGPTKWPVGDQSAESLGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGAR
FT                   GPYMMSPAMIALSNKLKLKRQLEYEEQAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCP
FT                   LMPDKTISANMAPDEFTQKSMRGLGQPLRHLPPPQPPSTRNSGENAKTGFPPQCYASQF
FT                   QDYGPPGAQKVSGVASRLLGPSFEPYLLPELTRYDCEVNVPVPGSSTLLQGRDLLRALD
FT                   QAT"
FT   gene            <30664910..>30669858
FT                   /locus_tag="mCG_20409"
FT                   /note="gene_id=mCG20409.2"
FT   mRNA            join(<30664910..30665077,30665744..30666079,
FT                   30669679..>30669858)
FT                   /locus_tag="mCG_20409"
FT                   /product="mCG20409"
FT                   /note="gene_id=mCG20409.2 transcript_id=mCT21078.2 created
FT                   on 12-SEP-2002"
FT   CDS             join(<30664910..30665077,30665744..30666079,
FT                   30669679..>30669858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20409"
FT                   /product="mCG20409"
FT                   /note="gene_id=mCG20409.2 transcript_id=mCT21078.2
FT                   protein_id=mCP23708.2"
FT                   /protein_id="EDL38616.1"
FT                   /translation="CLKRCPVALVRSTVVIWMAMEDREVMEARGAGESCPTLSKVAPVD
FT                   SMPEGKPKASLDAEVPKLELPTLEENGICEDRDCPGPPRSLPPKSGPNAKGQAGDGPGL
FT                   ESVELPLPLETEHRNAMELEKVRMEFELTLLKYLHQENERQRQHEEVMEQLQQQQQQQQ
FT                   ALPHQFSGSLQDLLLPQNQFAMFFYCFIFIHIIYVAKETVFFLFSKHYLFCLAAILLCL
FT                   IKTLWS"
FT   gene            complement(30684037..>30687798)
FT                   /gene="Atp6v1e2"
FT                   /locus_tag="mCG_20416"
FT                   /note="gene_id=mCG20416.1"
FT   mRNA            complement(join(30684037..30685000,30687768..>30687798))
FT                   /gene="Atp6v1e2"
FT                   /locus_tag="mCG_20416"
FT                   /product="ATPase, H+ transporting, lysosomal V1 subunit E2"
FT                   /note="gene_id=mCG20416.1 transcript_id=mCT21085.0 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(30684219..30685000,30687768..>30687798))
FT                   /codon_start=1
FT                   /gene="Atp6v1e2"
FT                   /locus_tag="mCG_20416"
FT                   /product="ATPase, H+ transporting, lysosomal V1 subunit E2"
FT                   /note="gene_id=mCG20416.1 transcript_id=mCT21085.0
FT                   protein_id=mCP23681.0"
FT                   /protein_id="EDL38617.1"
FT                   /translation="QTKGSSWHGSGREQTLATPWKLCSTLKTPEGPQALPLPPFLRAAM
FT                   ALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKK
FT                   EKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKL
FT                   VLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAA
FT                   GGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFFT"
FT   gene            <30703482..30740266
FT                   /gene="Rhoq"
FT                   /locus_tag="mCG_20410"
FT                   /note="gene_id=mCG20410.2"
FT   mRNA            join(<30703482..30703861,30704411..30704469,
FT                   30734756..30734920,30735201..30735296,30737102..30740266)
FT                   /gene="Rhoq"
FT                   /locus_tag="mCG_20410"
FT                   /product="ras homolog gene family, member Q"
FT                   /note="gene_id=mCG20410.2 transcript_id=mCT21079.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(<30703483..30703861,30704411..30704469,
FT                   30734756..30734920,30735201..30735296,30737102..30737257)
FT                   /codon_start=1
FT                   /gene="Rhoq"
FT                   /locus_tag="mCG_20410"
FT                   /product="ras homolog gene family, member Q"
FT                   /note="gene_id=mCG20410.2 transcript_id=mCT21079.2
FT                   protein_id=mCP23646.2"
FT                   /protein_id="EDL38618.1"
FT                   /translation="GRGEPGQGGERGRDRSGGGCAPGPPHLLLRSGEPLHGAGRAALLR
FT                   RAAATADPPSGLGLSPGPGRGLRGDHAPRPAGRSMAHGPGALMLKCVVVGDGAVGKTCL
FT                   LMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVF
FT                   LICFSVVNPASFQNVKEEWVPELKEYAPNIPFLLIGTQIDLRDDPKTLARLNDMKEKPV
FT                   CVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCC
FT                   LIT"
FT   gene            complement(30737456..30764112)
FT                   /gene="Pigf"
FT                   /locus_tag="mCG_20415"
FT                   /note="gene_id=mCG20415.1"
FT   mRNA            complement(join(30737456..30737764,30748971..30749079,
FT                   30759106..30759222,30760560..30760651,30762382..30762630,
FT                   30764009..30764112))
FT                   /gene="Pigf"
FT                   /locus_tag="mCG_20415"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class F"
FT                   /note="gene_id=mCG20415.1 transcript_id=mCT21084.0 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(30737651..30737764,30748971..30749079,
FT                   30759106..30759222,30760560..30760651,30762382..30762609))
FT                   /codon_start=1
FT                   /gene="Pigf"
FT                   /locus_tag="mCG_20415"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class F"
FT                   /note="gene_id=mCG20415.1 transcript_id=mCT21084.0
FT                   protein_id=mCP23675.1"
FT                   /protein_id="EDL38619.1"
FT                   /translation="MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLC
FT                   ICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAP
FT                   LIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSF
FT                   TGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN"
FT   gene            30764307..30774504
FT                   /gene="Cript"
FT                   /locus_tag="mCG_20414"
FT                   /note="gene_id=mCG20414.1"
FT   mRNA            join(30764307..30764387,30766411..30766476,
FT                   30769712..30769766,30772950..30773053,30773672..30774504)
FT                   /gene="Cript"
FT                   /locus_tag="mCG_20414"
FT                   /product="cysteine-rich PDZ-binding protein"
FT                   /note="gene_id=mCG20414.1 transcript_id=mCT21083.1 created
FT                   on 30-JUL-2002"
FT   CDS             join(30764372..30764387,30766411..30766476,
FT                   30769712..30769766,30772950..30773053,30773672..30773736)
FT                   /codon_start=1
FT                   /gene="Cript"
FT                   /locus_tag="mCG_20414"
FT                   /product="cysteine-rich PDZ-binding protein"
FT                   /note="gene_id=mCG20414.1 transcript_id=mCT21083.1
FT                   protein_id=mCP23672.2"
FT                   /protein_id="EDL38620.1"
FT                   /translation="MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKA
FT                   RFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV"
FT   gene            <30816806..30818849
FT                   /locus_tag="mCG_49815"
FT                   /note="gene_id=mCG49815.1"
FT   mRNA            join(<30816806..30818087,30818208..30818849)
FT                   /locus_tag="mCG_49815"
FT                   /product="mCG49815"
FT                   /note="gene_id=mCG49815.1 transcript_id=mCT49998.1 created
FT                   on 25-OCT-2002"
FT   CDS             <30816806..30817702
FT                   /codon_start=1
FT                   /locus_tag="mCG_49815"
FT                   /product="mCG49815"
FT                   /note="gene_id=mCG49815.1 transcript_id=mCT49998.1
FT                   protein_id=mCP42999.1"
FT                   /protein_id="EDL38621.1"
FT                   /translation="AGKMAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKL
FT                   PPICNGLPTQREDGNPCDFDWREVEILMFLSAIVMMKNRRSITVEQHVGNIFMFSKVAN
FT                   AILFFRLDIRMGLLYLTLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIV
FT                   EFFANWSNDCQSFAPIYADLSLKYNCSGLNFGKVDVGRYTDVSTRYKVSTSPLTRQLPT
FT                   LILFQGGKEVIRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKP
FT                   VDPAPTTVPDGENKKDK"
FT   gene            30846249..>30873653
FT                   /gene="Socs5"
FT                   /locus_tag="mCG_20412"
FT                   /note="gene_id=mCG20412.1"
FT   mRNA            join(30846249..30846446,30872031..>30873653)
FT                   /gene="Socs5"
FT                   /locus_tag="mCG_20412"
FT                   /product="suppressor of cytokine signaling 5, transcript
FT                   variant mCT21081"
FT                   /note="gene_id=mCG20412.1 transcript_id=mCT21081.2 created
FT                   on 30-JUL-2002"
FT   mRNA            join(30846262..30846446,30859162..30859222,
FT                   30859476..30859632,30859794..>30860013)
FT                   /gene="Socs5"
FT                   /locus_tag="mCG_20412"
FT                   /product="suppressor of cytokine signaling 5, transcript
FT                   variant mCT171250"
FT                   /note="gene_id=mCG20412.1 transcript_id=mCT171250.0 created
FT                   on 30-JUL-2002"
FT   CDS             30859833..>30860013
FT                   /codon_start=1
FT                   /gene="Socs5"
FT                   /locus_tag="mCG_20412"
FT                   /product="suppressor of cytokine signaling 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20412.1 transcript_id=mCT171250.0
FT                   protein_id=mCP94169.0 isoform=CRA_a"
FT                   /protein_id="EDL38622.1"
FT                   /translation="MITNLPSASGVLDWGALWQAPRAKEHSVSLPKKSDQAFKQLAIQT
FT                   QHVLCSVSRDLEAVF"
FT   CDS             30872043..30873653
FT                   /codon_start=1
FT                   /gene="Socs5"
FT                   /locus_tag="mCG_20412"
FT                   /product="suppressor of cytokine signaling 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20412.1 transcript_id=mCT21081.2
FT                   protein_id=mCP23671.1 isoform=CRA_b"
FT                   /db_xref="GOA:O54928"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR022252"
FT                   /db_xref="InterPro:IPR028413"
FT                   /db_xref="InterPro:IPR028420"
FT                   /db_xref="MGI:MGI:2385459"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54928"
FT                   /protein_id="EDL38623.1"
FT                   /translation="MDKVGKMWNNLKYRCQNLFSHEGGSRNENVEMNPNRCPSVKEKSI
FT                   SLGEAAPQQESSPLRENVALQLGLSPSKTFSRRNQNCAAEIPQVVEISIEKDSDSGATP
FT                   GTRLARRDSYSRHAPWGGKKKHSCSTKTQSSLDTEKKFGRTRSGLQRRERRYGVSSMQD
FT                   MDSVSSRAVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPA
FT                   GSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPN
FT                   AQIHTFEATAQVNPLYKLGPKLAPGMTEISGDGSAIPQTNCDSEEDSTTLCLQSRRQKQ
FT                   RQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKP
FT                   EGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEH
FT                   YKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEY
FT                   HYKQKVRVRWLEREPVKAK"
FT   gene            complement(30937994..>30940711)
FT                   /locus_tag="mCG_145006"
FT                   /note="gene_id=mCG145006.0"
FT   mRNA            complement(join(30937994..30938305,30938399..30938629,
FT                   30938726..30938900,30940033..>30940711))
FT                   /locus_tag="mCG_145006"
FT                   /product="mCG145006"
FT                   /note="gene_id=mCG145006.0 transcript_id=mCT184430.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(30938236..30938305,30938399..30938629,
FT                   30938726..>30938829))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145006"
FT                   /product="mCG145006"
FT                   /note="gene_id=mCG145006.0 transcript_id=mCT184430.0
FT                   protein_id=mCP106298.0"
FT                   /protein_id="EDL38624.1"
FT                   /translation="RPCRDQQPSCDSLVTDVCRATCAPPDKGEGAEHRHYRRWGWILKY
FT                   PFLWRGLVKRHEIDVVYELTAQWRFLVSLETQLRLMKGCFAENRRVFRACDVLLADTWE
FT                   GTWCLGRLEKRTKELLEVSWILLAASEDLC"
FT   gene            complement(31006768..31018537)
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /note="gene_id=mCG15895.2"
FT   mRNA            complement(join(31006768..31008382,31009472..31009631,
FT                   31010253..31010414,31016749..31016973,31018452..31018537))
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2,
FT                   transcript variant mCT10386"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT10386.2 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(31006768..31008382,31009472..31009631,
FT                   31010253..31010414,31011106..31011232,31018452..31018532))
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2,
FT                   transcript variant mCT172967"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT172967.1 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(31006992..31008382,31009472..31009631,
FT                   31010253..31010414,31018452..31018532))
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2,
FT                   transcript variant mCT181430"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT181430.0 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(31008251..31008382,31009472..31009631,
FT                   31010253..31010414,31011106..31011116))
FT                   /codon_start=1
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT172967.1
FT                   protein_id=mCP95886.0 isoform=CRA_b"
FT                   /protein_id="EDL38626.1"
FT                   /translation="MGSRYPPGSMATLQLLRAPLLCVLLWVFCAPGARAHDHGADVHHG
FT                   SVGLDKSTVHDQEHIMEHLEGVIDQPEAEMSPQELQLHYFKMHDYDGNSLLDGLELSIA
FT                   ITHVHKEEGSEQAPVMSEDELVSIIDGVLRDDDKNNDGYIDYAEFAKSLQ"
FT   CDS             complement(join(31008251..31008382,31009472..31009631,
FT                   31010253..31010398))
FT                   /codon_start=1
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT10386.2
FT                   protein_id=mCP23657.2 isoform=CRA_a"
FT                   /db_xref="GOA:D0EW11"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2183439"
FT                   /db_xref="UniProtKB/TrEMBL:D0EW11"
FT                   /protein_id="EDL38625.1"
FT                   /translation="MATLQLLRAPLLCVLLWVFCAPGARAHDHGADVHHGSVGLDKSTV
FT                   HDQEHIMEHLEGVIDQPEAEMSPQELQLHYFKMHDYDGNSLLDGLELSIAITHVHKEEG
FT                   SEQAPVMSEDELVSIIDGVLRDDDKNNDGYIDYAEFAKSLQ"
FT   CDS             complement(join(31008251..31008382,31009472..31009631,
FT                   31010253..31010398))
FT                   /codon_start=1
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT181430.0
FT                   protein_id=mCP104351.0 isoform=CRA_a"
FT                   /db_xref="GOA:D0EW11"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2183439"
FT                   /db_xref="UniProtKB/TrEMBL:D0EW11"
FT                   /protein_id="EDL38627.1"
FT                   /translation="MATLQLLRAPLLCVLLWVFCAPGARAHDHGADVHHGSVGLDKSTV
FT                   HDQEHIMEHLEGVIDQPEAEMSPQELQLHYFKMHDYDGNSLLDGLELSIAITHVHKEEG
FT                   SEQAPVMSEDELVSIIDGVLRDDDKNNDGYIDYAEFAKSLQ"
FT   mRNA            complement(join(31009083..31009631,31010253..31010414,
FT                   31018452..31018532))
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2,
FT                   transcript variant mCT181429"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT181429.0 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(31009415..31009631,31010253..31010398))
FT                   /codon_start=1
FT                   /gene="Mcfd2"
FT                   /locus_tag="mCG_15895"
FT                   /product="multiple coagulation factor deficiency 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG15895.2 transcript_id=mCT181429.0
FT                   protein_id=mCP104352.0 isoform=CRA_c"
FT                   /protein_id="EDL38628.1"
FT                   /translation="MATLQLLRAPLLCVLLWVFCAPGARAHDHGADVHHGSVGLDKSTV
FT                   HDQEHIMEHLEGVIDQPEAEMSPQELQLHYFKMHDYDGNSLLDGLELSIAITHVHKEVG
FT                   QGGGRVGHLSRQCSRW"
FT   gene            complement(31030429..>31038197)
FT                   /locus_tag="mCG_145010"
FT                   /note="gene_id=mCG145010.0"
FT   mRNA            complement(join(31030429..31030878,31031964..31031992,
FT                   31032761..31032931,31035924..31036127,31037555..>31038197))
FT                   /locus_tag="mCG_145010"
FT                   /product="mCG145010"
FT                   /note="gene_id=mCG145010.0 transcript_id=mCT184434.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(31037779..>31038084)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145010"
FT                   /product="mCG145010"
FT                   /note="gene_id=mCG145010.0 transcript_id=mCT184434.0
FT                   protein_id=mCP106302.0"
FT                   /protein_id="EDL38629.1"
FT                   /translation="CCGEPGSPGAPRSPFPPHPVRTLGLGSSARTARLCVVAPSPPQPE
FT                   ARHKSEERPTGQSWSRALGGSGSDATRPPAGLRIDRPGQVPKLFGCPQLGEGLCLF"
FT   gene            <31038248..31140490
FT                   /gene="Ttc7"
FT                   /locus_tag="mCG_128225"
FT                   /note="gene_id=mCG128225.1"
FT   mRNA            join(<31038248..31038791,31045574..31045737,
FT                   31048196..31048364,31062161..31062291,31063961..31064076,
FT                   31076819..31076897,31077854..31078011,31078540..31078603,
FT                   31087495..31087632,31088197..31088280,31092475..31092579,
FT                   31098099..31098216,31099096..31099153,31100275..31100347,
FT                   31104749..31104909,31117315..31117431,31119986..31120080,
FT                   31121593..31121727,31128596..31128798,31137966..31140490)
FT                   /gene="Ttc7"
FT                   /locus_tag="mCG_128225"
FT                   /product="tetratricopeptide repeat domain 7"
FT                   /note="gene_id=mCG128225.1 transcript_id=mCT129521.1
FT                   created on 12-SEP-2002"
FT   CDS             join(<31038248..31038791,31045574..31045737,
FT                   31048196..31048364,31062161..31062291,31063961..31064076,
FT                   31076819..31076897,31077854..31078011,31078540..31078603,
FT                   31087495..31087632,31088197..31088280,31092475..31092579,
FT                   31098099..31098216,31099096..31099153,31100275..31100347,
FT                   31104749..31104909,31117315..31117431,31119986..31120080,
FT                   31121593..31121727,31128596..31128798,31137966..31138187)
FT                   /codon_start=1
FT                   /gene="Ttc7"
FT                   /locus_tag="mCG_128225"
FT                   /product="tetratricopeptide repeat domain 7"
FT                   /note="gene_id=mCG128225.1 transcript_id=mCT129521.1
FT                   protein_id=mCP71088.1"
FT                   /protein_id="EDL38630.1"
FT                   /translation="LLETPGHGAGAVAAAAAQEETAASGAAAAAAEAASGRLGVAQPQP
FT                   QSRGSRRCGGRCRRRCCCCCCGPLAVTRAPSATRAPDAVCTPVKPAGECSPAWTPPPAW
FT                   SPLLRRTSHDSSCSKMAAKGAHGTHLKVESEVERCRAEGQWDRMFELARHLQMLGISGG
FT                   GSSNRRNSPSGRFTTLDTDDFVKLLLAEALLEQCLKDNHDKIKNSIPLLEKTDHRLNEA
FT                   KDHLSSLLNNGKLPPQYMCEAMLILGKLHYVEGSYRDAVSMYARAGIDDISVENKPLYQ
FT                   MRLLSEAFVIKGLSLERLPNSVASHIRLTEREEEVVACFERASWVAQVFLQELEKTSNN
FT                   STSRHLKGSLSPDYELSYFLEAALQSAYVKNLKKGNIVKGMRELREILRTVETKATQNF
FT                   KVVAAKHLAGVLLHSLSEDCYWSPLSHPLPEFMNKEENSFVTQTLRKPHLYEGDNLYCP
FT                   KDNIEEALLLLLISESMATRDVVLSRAPEQAEDRKVSLQNASAIYDLLSITLGRRGQYV
FT                   MLSECLERAMKCAFGEFHLWYQVALSMVACGKSAYAVSLLRECMKLQPSDPTVPLMAAK
FT                   VCIGSLHWLEEAEHFATVVIGLGEEAGESLPKGYLALGLTYSLQATDATLKSKQDELHR
FT                   KALQTLERARELAPDDPQIIFYVALQLALVRQISSAMERLQEALTMCRDDANALHLLAL
FT                   LFSAQKYYQHALDVINMAITEHPENFNLMFTKVKLEQVLKGPEEALVTCRQMLRLWQTL
FT                   YNFSQLGGLEKDGSFEGLTVKKQNGIHLTLPDAHDADSGSRRASSIAASRLEEAMSELT
FT                   LTTSVLKQGPMQLWTTLEQIWLQAAELFMEQRQLKEAGFCIQEAAGLFPTSHSVLYMRG
FT                   RLAEVKGSFEEAKQLYKEALTVNPDGVRIMHSLGLMLSQLGHKSLAQKVLRDAVERQST
FT                   FHEAWQGLGEVLQDQGQNEAAVDCFLTALELEASSPVLPFSIIAREL"
FT   gene            complement(31120376..31122600)
FT                   /locus_tag="mCG_148347"
FT                   /note="gene_id=mCG148347.0"
FT   mRNA            complement(join(31120376..31120775,31122469..31122600))
FT                   /locus_tag="mCG_148347"
FT                   /product="mCG148347"
FT                   /note="gene_id=mCG148347.0 transcript_id=mCT188610.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(31120474..31120629)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148347"
FT                   /product="mCG148347"
FT                   /note="gene_id=mCG148347.0 transcript_id=mCT188610.0
FT                   protein_id=mCP108825.0"
FT                   /protein_id="EDL38631.1"
FT                   /translation="MCLWSQGLGLAGETHSIPQTAEYSLPQVPGSVGIKKPVLPSPTPL
FT                   LSPLCD"
FT   gene            complement(31147947..31186983)
FT                   /locus_tag="mCG_15891"
FT                   /note="gene_id=mCG15891.3"
FT   mRNA            complement(join(31147947..31148088,31153546..31153650,
FT                   31170251..31170305,31170550..31170614,31181737..31181994,
FT                   31184873..31184932,31186817..31186983))
FT                   /locus_tag="mCG_15891"
FT                   /product="mCG15891"
FT                   /note="gene_id=mCG15891.3 transcript_id=mCT10382.3 created
FT                   on 01-JUL-2003"
FT   CDS             complement(join(31147972..31148088,31153546..31153650,
FT                   31170251..31170305,31170550..31170614,31181737..31181994,
FT                   31184873..31184932,31186817..31186900))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15891"
FT                   /product="mCG15891"
FT                   /note="gene_id=mCG15891.3 transcript_id=mCT10382.3
FT                   protein_id=mCP23690.3"
FT                   /protein_id="EDL38632.1"
FT                   /translation="MAEPTVVIAPTTVPREDLGHGEPLLMTAKQVKKTPGLEREGWWRL
FT                   TITDTPIPGTYHLRTFIEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLPQYSPPD
FT                   FLELLKKQTASYSFKDKPRADPSTLVDKDESLHLCPGQYEVLPAPVPKSPARSFVFRSS
FT                   VQRFPPNYFTPHEGPGPGDYELKASPKGSITSCFRSKVPRFLPVSSKTPGPGAYTSSRQ
FT                   FPKQSSTIAKMGREHSLFFNNTIGF"
FT   gene            complement(31192672..>31206068)
FT                   /locus_tag="mCG_15892"
FT                   /note="gene_id=mCG15892.4"
FT   mRNA            complement(join(31192672..31193309,31194330..31194465,
FT                   31194858..31194964,31195045..31195192,31205997..>31206068))
FT                   /locus_tag="mCG_15892"
FT                   /product="mCG15892"
FT                   /note="gene_id=mCG15892.4 transcript_id=mCT172966.0 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(31193281..31193309,31194330..31194465,
FT                   31194858..31194964,31195045..31195192,31205997..>31206065))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15892"
FT                   /product="mCG15892"
FT                   /note="gene_id=mCG15892.4 transcript_id=mCT172966.0
FT                   protein_id=mCP95885.0"
FT                   /protein_id="EDL38633.1"
FT                   /translation="SEWSERVERLSGRVSETRSPCSMAEFKEAFSLFDKDGDGTITTKE
FT                   LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFR
FT                   VFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK"
FT   gene            <31404878..31419280
FT                   /gene="Tacstd1"
FT                   /locus_tag="mCG_15890"
FT                   /note="gene_id=mCG15890.3"
FT   mRNA            join(<31404878..31405064,31408057..31408164,
FT                   31408449..31408689,31409595..31409660,31410269..31410332,
FT                   31411709..31411810,31414296..31414499,31417769..31417813,
FT                   31418583..31419280)
FT                   /gene="Tacstd1"
FT                   /locus_tag="mCG_15890"
FT                   /product="tumor-associated calcium signal transducer 1"
FT                   /note="gene_id=mCG15890.3 transcript_id=mCT12856.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(<31404878..31405064,31408057..31408164,
FT                   31408449..31408689,31409595..31409660,31410269..31410332,
FT                   31411709..31411810,31414296..31414499,31417769..31417813,
FT                   31418583..31418624)
FT                   /codon_start=1
FT                   /gene="Tacstd1"
FT                   /locus_tag="mCG_15890"
FT                   /product="tumor-associated calcium signal transducer 1"
FT                   /note="gene_id=mCG15890.3 transcript_id=mCT12856.1
FT                   protein_id=mCP23686.1"
FT                   /protein_id="EDL38634.1"
FT                   /translation="ASPRAQRSVRPPPRSATVLRAVPRRTSASRPRRSARSMAGPQALA
FT                   FGLLLAVVTATLAAAQRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCL
FT                   AMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRR
FT                   TDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIM
FT                   YENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLD
FT                   PGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVSLAVIAGIVVLVISTRKKSAKYEKAEI
FT                   KEMGEIHRELNA"
FT   gene            31440683..31491339
FT                   /gene="Msh2"
FT                   /locus_tag="mCG_15888"
FT                   /note="gene_id=mCG15888.2"
FT   mRNA            join(31440683..31440971,31446249..31446403,
FT                   31447845..31448123,31450476..31450622,31453395..31453544,
FT                   31454253..31454386,31456926..31457125,31464504..31464613,
FT                   31475254..31475377,31476524..31476674,31480698..31480795,
FT                   31485100..31485345,31486246..31486450,31486933..31487180,
FT                   31488528..31488703,31490956..31491339)
FT                   /gene="Msh2"
FT                   /locus_tag="mCG_15888"
FT                   /product="mutS homolog 2 (E. coli)"
FT                   /note="gene_id=mCG15888.2 transcript_id=mCT10380.2 created
FT                   on 01-JUL-2003"
FT   CDS             join(31440761..31440971,31446249..31446403,
FT                   31447845..31448123,31450476..31450622,31453395..31453544,
FT                   31454253..31454386,31456926..31457125,31464504..31464613,
FT                   31475254..31475377,31476524..31476674,31480698..31480795,
FT                   31485100..31485345,31486246..31486450,31486933..31487180,
FT                   31488528..31488703,31490956..31491129)
FT                   /codon_start=1
FT                   /gene="Msh2"
FT                   /locus_tag="mCG_15888"
FT                   /product="mutS homolog 2 (E. coli)"
FT                   /note="gene_id=mCG15888.2 transcript_id=mCT10380.2
FT                   protein_id=mCP23668.2"
FT                   /db_xref="GOA:Q3TZI5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:101816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZI5"
FT                   /protein_id="EDL38635.1"
FT                   /translation="MAVQPKETLQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTA
FT                   HGEDALLAAREVFKTQGVIKYMGPAGSKTLQSVVLSKMNFESFVKDLLLVRQYRVEVYK
FT                   NKAGNKASKENEWYLAFKASPGNLSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGV
FT                   GYVDSTQRKLGLCEFPENDQFSNLEALLIQIGPKECVLPGGETTGDMGKLRQVIQRGGI
FT                   LITERKRADFSTKDIYQDLNRLLKGKKGEQINSAALPEMENQVAVSSLSAVIKFLELLS
FT                   DDSNFGQFELATFDFSQYMKLDMAAVRALNLFQGSVEDTTGSQSLAALLNKCKTAQGQR
FT                   LVNQWIKQPLMDRNRIEERLNLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAA
FT                   NLQDCYRLYQGINQLPSVIQALEKYEGRHQALLLAVFVTPLIDLRSDFSKFQEMIETTL
FT                   DMDQVENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLINAARGLGLDPGKQIKLDSSA
FT                   QFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDA
FT                   IVKEIVNISSGYVEPMQTLNDVLAHLDAIVSFAHVSNAAPVPYVRPVILEKGKGRIILK
FT                   ASRHACVEVQDEVAFIPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCF
FT                   VPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRG
FT                   TSTYDGFGLAWAISDYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLT
FT                   MLYQVKKGVCDQSFGIHVAELANFPRHVIACAKQKALELEEFQNIGTSLGCDEAEPAAK
FT                   RRCLEREQGEKIILEFLSKVKQVPFTAMSEESISAKLKQLKAEVVAKNNSFVNEIISRI
FT                   KAPAP"
FT   gene            31692807..31693133
FT                   /pseudo
FT                   /locus_tag="mCG_15897"
FT                   /note="gene_id=mCG15897.2"
FT   mRNA            31692807..31693133
FT                   /pseudo
FT                   /locus_tag="mCG_15897"
FT                   /note="gene_id=mCG15897.2 transcript_id=mCT10388.2 created
FT                   on 04-OCT-2002"
FT   gene            31721645..31722266
FT                   /pseudo
FT                   /locus_tag="mCG_15893"
FT                   /note="gene_id=mCG15893.2"
FT   mRNA            31721645..31722266
FT                   /pseudo
FT                   /locus_tag="mCG_15893"
FT                   /note="gene_id=mCG15893.2 transcript_id=mCT10384.2 created
FT                   on 04-OCT-2002"
FT   gene            complement(31740153..>31740702)
FT                   /locus_tag="mCG_141434"
FT                   /note="gene_id=mCG141434.0"
FT   mRNA            complement(31740153..>31740702)
FT                   /locus_tag="mCG_141434"
FT                   /product="mCG141434"
FT                   /note="gene_id=mCG141434.0 transcript_id=mCT175400.0
FT                   created on 07-NOV-2002"
FT   CDS             complement(31740319..>31740702)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141434"
FT                   /product="mCG141434"
FT                   /note="gene_id=mCG141434.0 transcript_id=mCT175400.0
FT                   protein_id=mCP98319.0"
FT                   /protein_id="EDL38636.1"
FT                   /translation="RNARVLRGSLSGATANKASQNRTRALQSHSSPECKEEPEPLSPEL
FT                   EYIPRNRGKNPMKAVGLAWAICFPCGILFFVLTKQEVDKDRLKQMKAHQNMWVSNTGEY
FT                   ESQRFRASPQQAQFPEVGSGAQT"
FT   gene            <31746582..31762564
FT                   /locus_tag="mCG_15886"
FT                   /note="gene_id=mCG15886.1"
FT   mRNA            join(<31746582..31746903,31751689..31751888,
FT                   31754946..31755115,31755947..31758482,31759687..31759955,
FT                   31760645..31760762,31760928..31761017,31761695..31761849,
FT                   31761932..31762131,31762225..31762564)
FT                   /locus_tag="mCG_15886"
FT                   /product="mCG15886"
FT                   /note="gene_id=mCG15886.1 transcript_id=mCT12854.0 created
FT                   on 30-JUL-2002"
FT   CDS             join(<31746584..31746903,31751689..31751888,
FT                   31754946..31755115,31755947..31758482,31759687..31759955,
FT                   31760645..31760762,31760928..31761017,31761695..31761849,
FT                   31761932..31762131,31762225..31762306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15886"
FT                   /product="mCG15886"
FT                   /note="gene_id=mCG15886.1 transcript_id=mCT12854.0
FT                   protein_id=mCP23660.0"
FT                   /protein_id="EDL38637.1"
FT                   /translation="AVDAILVGARSRGPVCPSAFIMSRQSTLYSFFPKSPALGDTKKAA
FT                   AEASRQGAAASGASASRGGDAAWSEAEPGSRSAAVSASSPEAKDLNGGLRRASSSAQAV
FT                   PPSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIRKKGKSVRVHVQFFDDSPTRGW
FT                   VSKRMLKPYTGSKSKEAQKGGHFYSSKSEILRAMQRADEALSKDTAERLQLAVCDEPSE
FT                   PEEEEETEVHEAYLSDKSEEDNYNESEEEAQPSVQGPRRSSRQVKKRRVISDSESDIGG
FT                   SDVEFKPDTKQEGSSDDASSGVGDSDSEDLGTFGKGAPKRKRAMVAQGGLRRKSLKKET
FT                   GSAKRATPILSETKSTLSAFSAPQNSESQTHVSGGGNDSSGPTVWYHETLEWLKPEKRR
FT                   DEHRRRPDHPEFNPTTLYVPEEFLNSCTPGMRKWWQLKSQNFDLVIFYKVGKFYELYHM
FT                   DAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCR
FT                   KMAHVSKFDRVVRREICRIITKGTQTYSVLDGDPSENYSRYLLSLKEKEEETSGHTRVY
FT                   GVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSS
FT                   CLQEGLIPGSQFWDATKTLRTLLEGGYFTGNGDSSTVLPLVLKGMTSESDSVGLTPGEE
FT                   SELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVSTVKPGAVFTKASQRMVL
FT                   DAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPSAISDRLDA
FT                   VEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKK
FT                   KIIDFLSALEGFKVMCKVSGLLEEVAGGFTSKTLKQVVTLQSKSPKGRFPDLTAELQRW
FT                   DTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLGCKSIVYWG
FT                   IGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDTSLK
FT                   DCMRRLFCNFDKNHKDWQSAVECIAVLDVLLCLANYSQGGDGPMCRPEIVLPGEDTHPF
FT                   LEFKGSRHPCITKTFFGDDFIPNDILIGCEEEAEEHGKAYCVLVTGPNMGGKSTLIRQA
FT                   GLLAVMAQLGCYVPAEKCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRHATA
FT                   HSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKSVCVRLG
FT                   HMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE
FT                   RMNQSLQLFREVCLATEKPTINGEAIHRLLALINGL"
FT   gene            complement(31762364..>31864268)
FT                   /locus_tag="mCG_128222"
FT                   /note="gene_id=mCG128222.1"
FT   mRNA            complement(join(31762364..31763676,31763759..31763857,
FT                   31764320..31764428,31764648..31764755,31765238..31765348,
FT                   31767537..31767680,31767768..31767844,31768832..31768917,
FT                   31769014..31769136,31771034..31771128,31772273..31772358,
FT                   31774245..31774462,31780063..31780200,31780285..31780391,
FT                   31780479..31780590,31780673..31780779,31782405..31782537,
FT                   31782762..31782845,31784026..31784155,31785875..31786016,
FT                   31786862..31786943,31787051..31787176,31864247..>31864268))
FT                   /locus_tag="mCG_128222"
FT                   /product="mCG128222"
FT                   /note="gene_id=mCG128222.1 transcript_id=mCT129518.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(join(31763547..31763676,31763759..31763857,
FT                   31764320..31764428,31764648..31764755,31765238..31765348,
FT                   31767537..31767680,31767768..31767844,31768832..31768917,
FT                   31769014..31769136,31771034..31771128,31772273..31772358,
FT                   31774245..31774462,31780063..31780200,31780285..31780391,
FT                   31780479..31780590,31780673..31780779,31782405..31782537,
FT                   31782762..31782845,31784026..31784155,31785875..31786016,
FT                   31786862..31786943,31787051..31787176,31864247..>31864267))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128222"
FT                   /product="mCG128222"
FT                   /note="gene_id=mCG128222.1 transcript_id=mCT129518.1
FT                   protein_id=mCP71042.1"
FT                   /protein_id="EDL38638.1"
FT                   /translation="LHSSSSSDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTK
FT                   SSMEGASTSTTENFGHRAKRARVSGKSQDLSAPAEQYLQEKLPDEVVLKIFSYLLEQDL
FT                   CRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKES
FT                   FQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGI
FT                   YTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDK
FT                   SAQHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVG
FT                   LYITDHAQGIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFES
FT                   CNIHRNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWI
FT                   TSNSDPTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKI
FT                   HDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDN
FT                   GHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDN
FT                   AMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHP
FT                   VLRKNRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDA
FT                   IEKAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHD
FT                   RFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN"
FT   gene            31902081..31902598
FT                   /pseudo
FT                   /locus_tag="mCG_15896"
FT                   /note="gene_id=mCG15896.2"
FT   mRNA            31902081..31902598
FT                   /pseudo
FT                   /locus_tag="mCG_15896"
FT                   /note="gene_id=mCG15896.2 transcript_id=mCT10387.2 created
FT                   on 25-OCT-2002"
FT   gene            complement(<31917471..31931146)
FT                   /locus_tag="mCG_148334"
FT                   /note="gene_id=mCG148334.0"
FT   mRNA            complement(join(<31917471..31918446,31931068..31931146))
FT                   /locus_tag="mCG_148334"
FT                   /product="mCG148334"
FT                   /note="gene_id=mCG148334.0 transcript_id=mCT188597.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<31917471..31917625)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148334"
FT                   /product="mCG148334"
FT                   /note="gene_id=mCG148334.0 transcript_id=mCT188597.0
FT                   protein_id=mCP108813.0"
FT                   /protein_id="EDL38639.1"
FT                   /translation="MWQLTTVCNFRSKRPNALYCTWQSQSLQMVRRQTHGQNTHAHKVK
FT                   NKYFLR"
FT   gene            32218205..32267092
FT                   /gene="Foxn2"
FT                   /locus_tag="mCG_19365"
FT                   /note="gene_id=mCG19365.2"
FT   mRNA            join(32218205..32218329,32242573..32243123,
FT                   32255646..32255732,32266239..32267092)
FT                   /gene="Foxn2"
FT                   /locus_tag="mCG_19365"
FT                   /product="forkhead box N2, transcript variant mCT18610"
FT                   /note="gene_id=mCG19365.2 transcript_id=mCT18610.2 created
FT                   on 27-SEP-2002"
FT   mRNA            join(<32218219..32218329,32242573..32243123,
FT                   32253477..32253561,32255646..32255740,32259075..32259139,
FT                   32264238..32264306,32266239..32267074)
FT                   /gene="Foxn2"
FT                   /locus_tag="mCG_19365"
FT                   /product="forkhead box N2, transcript variant mCT193687"
FT                   /note="gene_id=mCG19365.2 transcript_id=mCT193687.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(32242587..32243123,32255646..32255732,
FT                   32266239..32266598)
FT                   /codon_start=1
FT                   /gene="Foxn2"
FT                   /locus_tag="mCG_19365"
FT                   /product="forkhead box N2, isoform CRA_a"
FT                   /note="gene_id=mCG19365.2 transcript_id=mCT18610.2
FT                   protein_id=mCP23645.2 isoform=CRA_a"
FT                   /protein_id="EDL38640.1"
FT                   /translation="MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKAT
FT                   LVGSESADDELTNLNWLHESSNLLTNLRLGSEGLPMVSPLYDIEGDEMPSFGPSCYQNP
FT                   EKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYSWILDRFPYFATAPTGWKNSVRHN
FT                   LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLMQALKKQPFSSVRSHCLLKHHCRRR
FT                   GVTAARSVPPVLCDCRRARLQPPASTQKPTITTVPTAWRPSAAHPGRACLLCPLWMRCM
FT                   NSSQRAATAGATVAKASTATRRRMRRTRRILWETVATHRKLVDTVL"
FT   CDS             join(<32253520..32253561,32255646..32255740,
FT                   32259075..32259139,32264238..32264306,32266239..32266762)
FT                   /codon_start=1
FT                   /gene="Foxn2"
FT                   /locus_tag="mCG_19365"
FT                   /product="forkhead box N2, isoform CRA_b"
FT                   /note="gene_id=mCG19365.2 transcript_id=mCT193687.0
FT                   protein_id=mCP114653.0 isoform=CRA_b"
FT                   /protein_id="EDL38641.1"
FT                   /translation="FMIVKRRMHIFCFPVNGKGSLWCVDPEYKPNLMQALKKQPFSSPQ
FT                   SAALSPHCLSSALKQSQVQTLQESDIDAATAMILLNTSIEQEILECEKPLPLKTSLQKK
FT                   RSYGSAFSAPGAVRLQESPSPTAGIDPKADHNYSANSVAAQRCASRASMSSLSSVDEVY
FT                   EFIPKSSHGGSDGSEGFHSDEETDAEDEEDPLGDSGYAPQARGHSTLKGQPGKKIPKQS
FT                   CQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKAQSQKHREK"
FT   gene            32268261..32270347
FT                   /locus_tag="mCG_1039350"
FT                   /note="gene_id=mCG1039350.1"
FT   mRNA            32268261..32270347
FT                   /locus_tag="mCG_1039350"
FT                   /product="mCG1039350"
FT                   /note="gene_id=mCG1039350.1 transcript_id=mCT157054.1
FT                   created on 31-OCT-2002"
FT   CDS             32268817..32269101
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039350"
FT                   /product="mCG1039350"
FT                   /note="gene_id=mCG1039350.1 transcript_id=mCT157054.1
FT                   protein_id=mCP70797.1"
FT                   /protein_id="EDL38642.1"
FT                   /translation="MASYLKQQPLARMMHARALKTNKQCSLTPCTWLSYKDSISHFSFA
FT                   AVSKHPPSRGERAFEIWSLVMFLETDYAPVWCAQIEAWLGTIQATNCMG"
FT   gene            32309515..32367984
FT                   /gene="1110018J12Rik"
FT                   /locus_tag="mCG_19364"
FT                   /note="gene_id=mCG19364.1"
FT   mRNA            join(32309515..32309589,32322429..32322497,
FT                   32324906..32325052,32327149..32327250,32329068..32329232,
FT                   32329373..32329431,32330246..32330340,32334460..32334512,
FT                   32335191..32335340,32338193..32338294,32338381..32338469,
FT                   32341716..32341852,32345398..32345490,32348565..32348692,
FT                   32352088..32352240,32354811..32354903,32356757..32356999,
FT                   32358401..32358433,32360054..32360170,32362034..32362132,
FT                   32363472..32363600,32367303..32367984)
FT                   /gene="1110018J12Rik"
FT                   /locus_tag="mCG_19364"
FT                   /product="RIKEN cDNA 1110018J12, transcript variant
FT                   mCT18612"
FT                   /note="gene_id=mCG19364.1 transcript_id=mCT18612.2 created
FT                   on 08-NOV-2002"
FT   mRNA            join(32309529..32309589,32322429..32322497,
FT                   32324906..32325052,32327149..32327237,32363571..32363600,
FT                   32367303..32367984)
FT                   /gene="1110018J12Rik"
FT                   /locus_tag="mCG_19364"
FT                   /product="RIKEN cDNA 1110018J12, transcript variant
FT                   mCT172968"
FT                   /note="gene_id=mCG19364.1 transcript_id=mCT172968.0 created
FT                   on 08-NOV-2002"
FT   CDS             join(32309533..32309589,32322429..32322497,
FT                   32324906..32325052,32327149..32327237,32363571..32363600,
FT                   32367303..32367336)
FT                   /codon_start=1
FT                   /gene="1110018J12Rik"
FT                   /locus_tag="mCG_19364"
FT                   /product="RIKEN cDNA 1110018J12, isoform CRA_a"
FT                   /note="gene_id=mCG19364.1 transcript_id=mCT172968.0
FT                   protein_id=mCP95887.0 isoform=CRA_a"
FT                   /protein_id="EDL38643.1"
FT                   /translation="MASAELQGKYQKLAQEYSKLRAQNQVLKKGVVDEQASSAALKEQL
FT                   KMKDQSLRKLQQEMDSLTFRNLQLAKRVELLQDELALSEPRGKKNKKSGESSSQLSQEQ
FT                   KSVFDEDLQKKIEENERRLTRSRWPVRGILRRPGIGS"
FT   gene            32312327..>32312496
FT                   /locus_tag="mCG_124177"
FT                   /note="gene_id=mCG124177.0"
FT   mRNA            32312327..>32312496
FT                   /locus_tag="mCG_124177"
FT                   /product="mCG124177"
FT                   /note="gene_id=mCG124177.0 transcript_id=mCT125415.0
FT                   created on 30-JUL-2002"
FT   CDS             32312409..>32312496
FT                   /codon_start=1
FT                   /locus_tag="mCG_124177"
FT                   /product="mCG124177"
FT                   /note="gene_id=mCG124177.0 transcript_id=mCT125415.0
FT                   protein_id=mCP71330.1"
FT                   /protein_id="EDL38645.1"
FT                   /translation="MLRILDEKILMELNLLKMGLKISSLKYSV"
FT   CDS             join(32329188..32329232,32329373..32329431,
FT                   32330246..32330340,32334460..32334512,32335191..32335340,
FT                   32338193..32338294,32338381..32338469,32341716..32341852,
FT                   32345398..32345490,32348565..32348692,32352088..32352240,
FT                   32354811..32354903,32356757..32356999,32358401..32358433,
FT                   32360054..32360170,32362034..32362132,32363472..32363600,
FT                   32367303..32367332)
FT                   /codon_start=1
FT                   /gene="1110018J12Rik"
FT                   /locus_tag="mCG_19364"
FT                   /product="RIKEN cDNA 1110018J12, isoform CRA_b"
FT                   /note="gene_id=mCG19364.1 transcript_id=mCT18612.2
FT                   protein_id=mCP23715.2 isoform=CRA_b"
FT                   /protein_id="EDL38644.1"
FT                   /translation="METIEKLQSDKAKLEVKSQTLEKEAKECRLRTEECQLQLKNLHED
FT                   LSGRLEESLSIINEKVPFNDTKCHLYNALNVPLHNRRHQLKMRDIAGQALAFVQDLVPA
FT                   LLNFHTYTEQRIQIFPVDSAIDTISPLNQKFSQYLHENASYVRPLEEGMLHLFESITED
FT                   TVTVLETTVKLKMFSDHLTSYVRFLRKILPYQLKSLEEECDSSLCTPALRARNLELSQD
FT                   MRTMTAVFEKLRTYVTLLALPSTEPDGLLRTNYTSVLTNVGAALHGFHDVMKDISKHYS
FT                   QKASIEHEIPTATQKLVTTNDCILSSAVTLTNGAGKIASFFGNNVDYFIASLSYGPKTA
FT                   SGFISPLSAECMLQYKKKAAAYMKSLRTPLAESVPYGEAVANRRVLLSSTESREGLAQQ
FT                   VQQSLEKISKLEQEKEHWMLEAQLAKIKLEKENQRIADRLRGTTSAQLPGLAQENATVP
FT                   IASSQEEAAAKVLTEPVQSTSLVGMLTRTPDSEAPDVESREDLIKSHYMARIAELTSQL
FT                   QLADSKSVHFYAECRALSKRLALAEKSKETLTEEMRLASQNISRLQDELMTTKRSYEDQ
FT                   LSMMSDHLCSMNETLSKQREEIDTLKMASKGNSKKTRNR"
FT   gene            32373162..32435361
FT                   /locus_tag="mCG_19363"
FT                   /note="gene_id=mCG19363.3"
FT   mRNA            join(32373162..32373184,32407225..32409643)
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, transcript variant mCT171249"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT171249.2 created
FT                   on 24-MAR-2004"
FT   mRNA            join(32398616..32398903,32407225..32409187,
FT                   32416448..32416650,32417325..32417754,32434981..32435361)
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, transcript variant mCT171248"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT171248.2 created
FT                   on 24-MAR-2004"
FT   mRNA            join(32398616..32398903,32407225..32409187,
FT                   32416448..32416650,32417325..32417754,32421003..32421386)
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, transcript variant mCT185381"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT185381.0 created
FT                   on 24-MAR-2004"
FT   mRNA            join(32398616..32398903,32407225..32409643)
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, transcript variant mCT186521"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT186521.0 created
FT                   on 24-MAR-2004"
FT   CDS             32407272..32408672
FT                   /codon_start=1
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, isoform CRA_a"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT171248.2
FT                   protein_id=mCP94168.2 isoform=CRA_a"
FT                   /protein_id="EDL38646.1"
FT                   /translation="MYSTNPGSWVTFDDDPAFQSSQKRKDFSLETQGVCRPNGLKLTLP
FT                   TLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYP
FT                   IPECSSSSAPTTAGGVGPPLLLTKPDCSPHVSLPSSHSHTQPTPTLGFTEDAGPQRVQS
FT                   EARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKDKEVPIGHKSLTQCSLD
FT                   YICEKLEHLHSAETQDPLGDLSMQDPYAGDTVSFVPHSLFRSQPRAGWSFMLRIPEKKN
FT                   MMSSRQWGPIFLKVLPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKLENFSMAGKIHT
FT                   VKVEHVSYSEKRKYHAKTEVVHEPEVEQMLKLGSTEHRDFLEFLTTVEEELIKLPATAK
FT                   PKNKSYEEQEICLDIQDSLWGKVTKEGQLVESAVVTQICCLCFLNGPAECFLALNDREL
FT                   QKRGRMLF"
FT   CDS             32407272..32408672
FT                   /codon_start=1
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, isoform CRA_a"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT186521.0
FT                   protein_id=mCP107224.0 isoform=CRA_a"
FT                   /protein_id="EDL38647.1"
FT                   /translation="MYSTNPGSWVTFDDDPAFQSSQKRKDFSLETQGVCRPNGLKLTLP
FT                   TLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYP
FT                   IPECSSSSAPTTAGGVGPPLLLTKPDCSPHVSLPSSHSHTQPTPTLGFTEDAGPQRVQS
FT                   EARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKDKEVPIGHKSLTQCSLD
FT                   YICEKLEHLHSAETQDPLGDLSMQDPYAGDTVSFVPHSLFRSQPRAGWSFMLRIPEKKN
FT                   MMSSRQWGPIFLKVLPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKLENFSMAGKIHT
FT                   VKVEHVSYSEKRKYHAKTEVVHEPEVEQMLKLGSTEHRDFLEFLTTVEEELIKLPATAK
FT                   PKNKSYEEQEICLDIQDSLWGKVTKEGQLVESAVVTQICCLCFLNGPAECFLALNDREL
FT                   QKRGRMLF"
FT   CDS             32407272..32408672
FT                   /codon_start=1
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, isoform CRA_a"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT185381.0
FT                   protein_id=mCP106639.0 isoform=CRA_a"
FT                   /protein_id="EDL38648.1"
FT                   /translation="MYSTNPGSWVTFDDDPAFQSSQKRKDFSLETQGVCRPNGLKLTLP
FT                   TLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYP
FT                   IPECSSSSAPTTAGGVGPPLLLTKPDCSPHVSLPSSHSHTQPTPTLGFTEDAGPQRVQS
FT                   EARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKDKEVPIGHKSLTQCSLD
FT                   YICEKLEHLHSAETQDPLGDLSMQDPYAGDTVSFVPHSLFRSQPRAGWSFMLRIPEKKN
FT                   MMSSRQWGPIFLKVLPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKLENFSMAGKIHT
FT                   VKVEHVSYSEKRKYHAKTEVVHEPEVEQMLKLGSTEHRDFLEFLTTVEEELIKLPATAK
FT                   PKNKSYEEQEICLDIQDSLWGKVTKEGQLVESAVVTQICCLCFLNGPAECFLALNDREL
FT                   QKRGRMLF"
FT   CDS             32407272..32408672
FT                   /codon_start=1
FT                   /locus_tag="mCG_19363"
FT                   /product="mCG19363, isoform CRA_a"
FT                   /note="gene_id=mCG19363.3 transcript_id=mCT171249.2
FT                   protein_id=mCP94167.2 isoform=CRA_a"
FT                   /protein_id="EDL38649.1"
FT                   /translation="MYSTNPGSWVTFDDDPAFQSSQKRKDFSLETQGVCRPNGLKLTLP
FT                   TLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYP
FT                   IPECSSSSAPTTAGGVGPPLLLTKPDCSPHVSLPSSHSHTQPTPTLGFTEDAGPQRVQS
FT                   EARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKDKEVPIGHKSLTQCSLD
FT                   YICEKLEHLHSAETQDPLGDLSMQDPYAGDTVSFVPHSLFRSQPRAGWSFMLRIPEKKN
FT                   MMSSRQWGPIFLKVLPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKLENFSMAGKIHT
FT                   VKVEHVSYSEKRKYHAKTEVVHEPEVEQMLKLGSTEHRDFLEFLTTVEEELIKLPATAK
FT                   PKNKSYEEQEICLDIQDSLWGKVTKEGQLVESAVVTQICCLCFLNGPAECFLALNDREL
FT                   QKRGRMLF"
FT   gene            complement(32418781..32420547)
FT                   /locus_tag="mCG_148349"
FT                   /note="gene_id=mCG148349.0"
FT   mRNA            complement(join(32418781..32420400,32420429..32420547))
FT                   /locus_tag="mCG_148349"
FT                   /product="mCG148349"
FT                   /note="gene_id=mCG148349.0 transcript_id=mCT188612.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(32420085..32420267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148349"
FT                   /product="mCG148349"
FT                   /note="gene_id=mCG148349.0 transcript_id=mCT188612.0
FT                   protein_id=mCP108828.0"
FT                   /protein_id="EDL38650.1"
FT                   /translation="MESVTFFLFSFFRDMVSLCSPACPGTHPVGQAGLELRNPPASASQ
FT                   VLGLKACATFLIFCN"
FT   gene            32441541..32487442
FT                   /gene="Gtf2a1lf"
FT                   /locus_tag="mCG_145725"
FT                   /note="gene_id=mCG145725.0"
FT   mRNA            join(32441541..32441567,32444135..32444236,
FT                   32444440..32444560,32462836..32462891,32464567..32464651,
FT                   32466953..32467518,32484273..32484530,32485188..32485277,
FT                   32487174..32487442)
FT                   /gene="Gtf2a1lf"
FT                   /locus_tag="mCG_145725"
FT                   /product="general transcription factor II A, 1-like factor"
FT                   /note="gene_id=mCG145725.0 transcript_id=mCT18611.1 created
FT                   on 13-JUN-2003"
FT   CDS             join(32441547..32441567,32444135..32444236,
FT                   32444440..32444560,32462836..32462891,32464567..32464651,
FT                   32466953..32467518,32484273..32484530,32485188..32485277,
FT                   32487174..32487281)
FT                   /codon_start=1
FT                   /gene="Gtf2a1lf"
FT                   /locus_tag="mCG_145725"
FT                   /product="general transcription factor II A, 1-like factor"
FT                   /note="gene_id=mCG145725.0 transcript_id=mCT18611.1
FT                   protein_id=mCP23692.1"
FT                   /protein_id="EDL38651.1"
FT                   /translation="MAFINLVPKLYQSVIEDVIEGVRDLFAEEGIEEQVLKDLKKLWET
FT                   KVLQSKATEDFFRNSTQVPLLTLQLPHALPPALQPEASLLIPAGRTLPSFTPEDLNTAN
FT                   CGANFAFAGYPIHVPAGMAFQTASGHLYKVNVPVMVTQTSGRTEILQHPFQQVLQQLGQ
FT                   PLVIQTTVPTLHPCSLQAATEKSLRMEAVLQPPPILHPPPVDRTHVENAASDRRLLPGN
FT                   ELRPQESSPYLSLPGVGFPPQAALTESSLEPVLGVSASLTQNLHSDPFSQGPPGPLHHH
FT                   LLESQLQSLKDSIYGCDSTKQLRKAEEPSSLRVSEKNCTSERDLNIRVTDDDINEIIQI
FT                   DGTGDNSSTEEMGSIRDADENEFPGIIDAGDLNVLEEVDSVSNEDSTANSSDNEDHQIN
FT                   APEEDPLNSGDDVSEQDVPDLFDTENVIVCQYDKIHRSKNRWKFYLKDGVMCFGGRDYV
FT                   FAKAIGEAEW"
FT   gene            complement(32511153..>32561196)
FT                   /gene="Lhcgr"
FT                   /locus_tag="mCG_19362"
FT                   /note="gene_id=mCG19362.1"
FT   mRNA            complement(join(32511153..32512740,32519468..32519548,
FT                   32523107..32523292,32524914..32524988,32527620..32527688,
FT                   32534185..32534262,32534351..32534425,32536462..32536536,
FT                   32539046..32539120,32541215..32541286,32561019..>32561196))
FT                   /gene="Lhcgr"
FT                   /locus_tag="mCG_19362"
FT                   /product="luteinizing hormone/choriogonadotropin receptor"
FT                   /note="gene_id=mCG19362.1 transcript_id=mCT18609.1 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(32511597..32512740,32519468..32519548,
FT                   32523107..32523292,32524914..32524988,32527620..32527688,
FT                   32534185..32534262,32534351..32534425,32536462..32536536,
FT                   32539046..32539120,32541215..32541286,32561019..>32561194))
FT                   /codon_start=1
FT                   /gene="Lhcgr"
FT                   /locus_tag="mCG_19362"
FT                   /product="luteinizing hormone/choriogonadotropin receptor"
FT                   /note="gene_id=mCG19362.1 transcript_id=mCT18609.1
FT                   protein_id=mCP23644.0"
FT                   /protein_id="EDL38652.1"
FT                   /translation="AMGRRVPALRQLLVLAMLVLKQSQLHSPELSGSRCPEPCDCAPDG
FT                   ALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLN
FT                   LSEILIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVSKISSSEFNFILEICDN
FT                   LYITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGT
FT                   FQGATGPSILDVSSTKLQALPSHGLESIQTLIATSSYSLKTLPSREKFTSLLVATLTYP
FT                   SHCCAFRNLPKKEQNFSFSIFENFSKQCESTVREANNETLYSAIFEENELSGWDYDYDF
FT                   CSPKTLQCTPEPDAFNPCEDIMGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVP
FT                   RFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSAAGFFTVFASELS
FT                   VYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGWIFSTLMATLPLVGVSSYMKVS
FT                   ICLPMDVESTLSQVYILSILLLNAVAFVVICACYVRIYFAVQNPELTAPNKDTKIAKKM
FT                   AILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFLYAVFTKAF
FT                   QRDFFLLLSRFGCCKHRAELYRRKEFSACTFNSKNGFPRSSKPSQAALKLSIVHCQQPT
FT                   PPRVLIQ"
FT   gene            complement(32625320..32626042)
FT                   /pseudo
FT                   /locus_tag="mCG_50152"
FT                   /note="gene_id=mCG50152.1"
FT   mRNA            complement(32625320..32626042)
FT                   /pseudo
FT                   /locus_tag="mCG_50152"
FT                   /note="gene_id=mCG50152.1 transcript_id=mCT50335.1 created
FT                   on 07-NOV-2002"
FT   gene            complement(<32754694..>32970578)
FT                   /gene="Fshr"
FT                   /locus_tag="mCG_19361"
FT                   /note="gene_id=mCG19361.2"
FT   mRNA            complement(join(<32754694..32755918,32757948..32758133,
FT                   32771528..32771602,32771712..32771780,32779359..32779436,
FT                   32781112..32781183,32815167..32815241,32816726..32816800,
FT                   32867299..32867370,32970427..>32970578))
FT                   /gene="Fshr"
FT                   /locus_tag="mCG_19361"
FT                   /product="follicle stimulating hormone receptor"
FT                   /note="gene_id=mCG19361.2 transcript_id=mCT18608.1 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(32754694..32755918,32757948..32758133,
FT                   32771528..32771602,32771712..32771780,32779359..32779436,
FT                   32781112..32781183,32815167..32815241,32816726..32816800,
FT                   32867299..32867370,32970427..32970578))
FT                   /codon_start=1
FT                   /gene="Fshr"
FT                   /locus_tag="mCG_19361"
FT                   /product="follicle stimulating hormone receptor"
FT                   /note="gene_id=mCG19361.2 transcript_id=mCT18608.1
FT                   protein_id=mCP23638.1"
FT                   /db_xref="GOA:B2RQM3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002131"
FT                   /db_xref="InterPro:IPR002272"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR024635"
FT                   /db_xref="MGI:MGI:95583"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQM3"
FT                   /protein_id="EDL38653.1"
FT                   /translation="MALLLVSLLAFLGSGSGCHHWLCHCSNRVFLCQDSKVTEIPPDLP
FT                   RNAIELRFVLTKLRVIPKGSFSGFGDLEKIEISQNDVLEVIEADVFSNLPNLHEIRIEK
FT                   ANNLLYINPEAFQNLPSLRYLLISNTGIKHLPAFHKIQSLQKVLLDIQDNINIHIIARN
FT                   SFMGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPDDVFQGASGPVV
FT                   LDISRTKVYSLPNHGLENLKKLRARSTYRLKKLPSLDKFVMLIEASLTYPSHCCAFANW
FT                   RRQTSELHPICNKSISRQDIDDMTQPGDQRVSLVDDEPSYGKGSDMLYSEFDYDLCNEF
FT                   VDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNTTVLVVLTTSQYKLTVPRFL
FT                   MCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYT
FT                   LAAITLERWHTITHAMQLECKVQLCHAASIMVLGWAFAFAAALFPIFGISSYMKVSICL
FT                   PMDIDSPLSQLYVMALLVLNALAFVVICGCYTHIYLTVRNPNIVSSSRDTKIAKRMATL
FT                   IFTDFLCMAPILFFAISASLKVPLITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRD
FT                   FFVLMSKFGCYEVQAQIYKTETSSITHNFHSRKNPCSSAPRVTNSYVLVPLNHSVQN"
FT   gene            33083536..33090735
FT                   /locus_tag="mCG_1039626"
FT                   /note="gene_id=mCG1039626.1"
FT   mRNA            join(33083536..33083558,33084609..33084730,
FT                   33084842..33085183,33089525..33089635,33090335..33090735)
FT                   /locus_tag="mCG_1039626"
FT                   /product="mCG1039626"
FT                   /note="gene_id=mCG1039626.1 transcript_id=mCT157330.1
FT                   created on 31-OCT-2002"
FT   CDS             join(33085124..33085183,33089525..33089614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039626"
FT                   /product="mCG1039626"
FT                   /note="gene_id=mCG1039626.1 transcript_id=mCT157330.1
FT                   protein_id=mCP71218.1"
FT                   /protein_id="EDL38654.1"
FT                   /translation="MLRVPDGGEEISTICILAPRKISSIAMAEGTLSGVLGKTEVWALR
FT                   KHYT"
FT   gene            complement(33653476..33655290)
FT                   /locus_tag="mCG_9574"
FT                   /note="gene_id=mCG9574.2"
FT   mRNA            complement(join(33653476..33653857,33654784..33655290))
FT                   /locus_tag="mCG_9574"
FT                   /product="mCG9574"
FT                   /note="gene_id=mCG9574.2 transcript_id=mCT9194.2 created on
FT                   25-OCT-2002"
FT   CDS             complement(join(33653779..33653857,33654784..33655163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9574"
FT                   /product="mCG9574"
FT                   /note="gene_id=mCG9574.2 transcript_id=mCT9194.2
FT                   protein_id=mCP2113.2"
FT                   /protein_id="EDL38655.1"
FT                   /translation="MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDE
FT                   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLL
FT                   SREKQPPIDNIIRAGLIPKFVSFSLNLIEKYFSVEGRGRSKCGARNYL"
FT   gene            complement(33780773..34204188)
FT                   /locus_tag="mCG_15583"
FT                   /note="gene_id=mCG15583.2"
FT   mRNA            complement(join(33780773..33782349,33804448..33804535,
FT                   33908266..33908585,33909947..33910036,33954463..33954634,
FT                   34109095..34109276,34202455..34204188))
FT                   /locus_tag="mCG_15583"
FT                   /product="mCG15583, transcript variant mCT18460"
FT                   /note="gene_id=mCG15583.2 transcript_id=mCT18460.2 created
FT                   on 12-SEP-2002"
FT   mRNA            complement(join(33780773..33782349,33804457..33804535,
FT                   33831919..33831999,33832825..>33832992))
FT                   /locus_tag="mCG_15583"
FT                   /product="mCG15583, transcript variant mCT172965"
FT                   /note="gene_id=mCG15583.2 transcript_id=mCT172965.0 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(33782042..33782349,33804448..33804535,
FT                   33908266..33908585,33909947..33910036,33954463..33954634,
FT                   34109095..34109276,34202455..34202701))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15583"
FT                   /product="mCG15583, isoform CRA_b"
FT                   /note="gene_id=mCG15583.2 transcript_id=mCT18460.2
FT                   protein_id=mCP23656.1 isoform=CRA_b"
FT                   /db_xref="GOA:P0DI97"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DI97"
FT                   /protein_id="EDL38657.1"
FT                   /translation="MYQRMLRCGADLGSPGGGSGGGAGGRLALIWIVPLTLSGLLGVAW
FT                   GASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPND
FT                   RPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEE
FT                   SNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRV
FT                   VDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAI
FT                   VGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTD
FT                   DILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIV
FT                   AAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKN
FT                   KKNKDKEYYV"
FT   CDS             complement(join(33782042..33782349,33804457..33804535,
FT                   33831919..33831999,33832825..>33832827))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15583"
FT                   /product="mCG15583, isoform CRA_a"
FT                   /note="gene_id=mCG15583.2 transcript_id=mCT172965.0
FT                   protein_id=mCP95884.0 isoform=CRA_a"
FT                   /protein_id="EDL38656.1"
FT                   /translation="TLILILVRSKNALAFKHSLDPWESKPAETTDDILVASAECPSDDE
FT                   DIDPCEPSSANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKY
FT                   RNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV"
FT   gene            complement(34282868..>34452381)
FT                   /locus_tag="mCG_1296"
FT                   /note="gene_id=mCG1296.1"
FT   mRNA            complement(join(34282868..34283137,34308026..34308145,
FT                   34312598..34312771,34336474..34336664,34337665..34338046,
FT                   34344071..34344193,34367950..34367976,34370526..34370729,
FT                   34377026..34377409,34390148..34390586,34448757..34448918,
FT                   34452080..>34452381))
FT                   /locus_tag="mCG_1296"
FT                   /product="mCG1296"
FT                   /note="gene_id=mCG1296.1 transcript_id=mCT8582.2 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(34283097..34283137,34308026..34308145,
FT                   34312598..34312771,34336474..34336664,34337665..34338046,
FT                   34344071..34344193,34367950..34367976,34370526..34370729,
FT                   34377026..34377409,34390148..34390586,34448757..34448918,
FT                   34452080..>34452379))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1296"
FT                   /product="mCG1296"
FT                   /note="gene_id=mCG1296.1 transcript_id=mCT8582.2
FT                   protein_id=mCP23716.2"
FT                   /protein_id="EDL38658.1"
FT                   /translation="KEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLH
FT                   TGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTIS
FT                   VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVR
FT                   LELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDF
FT                   RTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQ
FT                   KKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLV
FT                   FPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKPCLSNPC
FT                   KNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSL
FT                   RFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYN
FT                   LNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP
FT                   SNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATL
FT                   QAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSN
FT                   KPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSL
FT                   PKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVC
FT                   LQQWDGFSCDCSMTSFSGPLCNDLGVHQDCFIYWLL"
FT   gene            complement(34540588..>34542159)
FT                   /locus_tag="mCG_1039307"
FT                   /note="gene_id=mCG1039307.1"
FT   mRNA            complement(34540588..>34542159)
FT                   /locus_tag="mCG_1039307"
FT                   /product="mCG1039307"
FT                   /note="gene_id=mCG1039307.1 transcript_id=mCT157011.1
FT                   created on 25-OCT-2002"
FT   CDS             complement(34541773..>34542024)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039307"
FT                   /product="mCG1039307"
FT                   /note="gene_id=mCG1039307.1 transcript_id=mCT157011.1
FT                   protein_id=mCP71003.1"
FT                   /protein_id="EDL38659.1"
FT                   /translation="NPHFMNKDVSKVVEHINNTIALALVSKKQNVVEQEKIDQLMIDMG
FT                   SAENESTFGANAILSQSVSGCLQIWSCAKWGAPSPSHC"
FT   gene            <34619796..34625738
FT                   /locus_tag="mCG_145009"
FT                   /note="gene_id=mCG145009.0"
FT   mRNA            join(<34619796..34620373,34621548..34622129,
FT                   34624693..34625738)
FT                   /locus_tag="mCG_145009"
FT                   /product="mCG145009"
FT                   /note="gene_id=mCG145009.0 transcript_id=mCT184433.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<34621901..34622129,34624693..34624748)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145009"
FT                   /product="mCG145009"
FT                   /note="gene_id=mCG145009.0 transcript_id=mCT184433.0
FT                   protein_id=mCP106301.0"
FT                   /protein_id="EDL38660.1"
FT                   /translation="QPSSVLLQDQSSLLTSEPACRLLSRHHQEEHLVTTCRDRIVSEGE
FT                   HVVVFSSDHHSNKSTASFHYQENHLEDFVSRFPGLEDEKYHSKRERKFH"
FT   gene            complement(34847249..>34851137)
FT                   /locus_tag="mCG_1295"
FT                   /note="gene_id=mCG1295.2"
FT   mRNA            complement(join(34847249..34847960,34850951..>34851137))
FT                   /locus_tag="mCG_1295"
FT                   /product="mCG1295"
FT                   /note="gene_id=mCG1295.2 transcript_id=mCT8581.2 created on
FT                   12-SEP-2002"
FT   CDS             complement(join(34847898..34847960,34850951..>34851136))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1295"
FT                   /product="mCG1295"
FT                   /note="gene_id=mCG1295.2 transcript_id=mCT8581.2
FT                   protein_id=mCP23714.2"
FT                   /protein_id="EDL38661.1"
FT                   /translation="SCSPCCSSLFHVLPFLTLGDRRSSLTPRKKAAAVALSLDLRKFAF
FT                   TDACFRFWLELRGITRQFLSSYKRQNKIKMHHQHTTN"
FT   gene            34864618..34867129
FT                   /pseudo
FT                   /locus_tag="mCG_1039308"
FT                   /note="gene_id=mCG1039308.1"
FT   mRNA            join(34864618..34864729,34864803..34866538,
FT                   34866717..34867129)
FT                   /pseudo
FT                   /locus_tag="mCG_1039308"
FT                   /note="gene_id=mCG1039308.1 transcript_id=mCT157012.1
FT                   created on 25-OCT-2002"
FT   gene            34883544..34884938
FT                   /pseudo
FT                   /locus_tag="mCG_1039309"
FT                   /note="gene_id=mCG1039309.1"
FT   mRNA            join(34883544..34884086,34884405..34884938)
FT                   /pseudo
FT                   /locus_tag="mCG_1039309"
FT                   /note="gene_id=mCG1039309.1 transcript_id=mCT157013.1
FT                   created on 25-OCT-2002"
FT   gene            34995594..34996945
FT                   /pseudo
FT                   /locus_tag="mCG_1294"
FT                   /note="gene_id=mCG1294.1"
FT   mRNA            34995594..34996945
FT                   /pseudo
FT                   /locus_tag="mCG_1294"
FT                   /note="gene_id=mCG1294.1 transcript_id=mCT8580.2 created on
FT                   23-OCT-2002"
FT   gene            complement(35955080..35955650)
FT                   /pseudo
FT                   /locus_tag="mCG_50450"
FT                   /note="gene_id=mCG50450.1"
FT   mRNA            complement(35955080..35955650)
FT                   /pseudo
FT                   /locus_tag="mCG_50450"
FT                   /note="gene_id=mCG50450.1 transcript_id=mCT50633.1 created
FT                   on 10-OCT-2002"
FT   gene            complement(36140520..36141668)
FT                   /pseudo
FT                   /locus_tag="mCG_14798"
FT                   /note="gene_id=mCG14798.1"
FT   mRNA            complement(36140520..36141668)
FT                   /pseudo
FT                   /locus_tag="mCG_14798"
FT                   /note="gene_id=mCG14798.1 transcript_id=mCT20421.1 created
FT                   on 10-OCT-2002"
FT   gene            36178061..36181524
FT                   /pseudo
FT                   /locus_tag="mCG_1039355"
FT                   /note="gene_id=mCG1039355.1"
FT   mRNA            join(36178061..36178449,36179442..36179646,
FT                   36181098..36181524)
FT                   /pseudo
FT                   /locus_tag="mCG_1039355"
FT                   /note="gene_id=mCG1039355.1 transcript_id=mCT157059.1
FT                   created on 08-NOV-2002"
FT   gene            complement(36295812..36296585)
FT                   /pseudo
FT                   /locus_tag="mCG_14799"
FT                   /note="gene_id=mCG14799.1"
FT   mRNA            complement(36295812..36296585)
FT                   /pseudo
FT                   /locus_tag="mCG_14799"
FT                   /note="gene_id=mCG14799.1 transcript_id=mCT20422.1 created
FT                   on 23-OCT-2002"
FT   gene            complement(36486500..36487460)
FT                   /pseudo
FT                   /locus_tag="mCG_49481"
FT                   /note="gene_id=mCG49481.2"
FT   mRNA            complement(36486500..36487460)
FT                   /pseudo
FT                   /locus_tag="mCG_49481"
FT                   /note="gene_id=mCG49481.2 transcript_id=mCT49664.2 created
FT                   on 08-NOV-2002"
FT   gene            <36746515..36746993
FT                   /locus_tag="mCG_50533"
FT                   /note="gene_id=mCG50533.2"
FT   mRNA            <36746515..36746993
FT                   /locus_tag="mCG_50533"
FT                   /product="mCG50533"
FT                   /note="gene_id=mCG50533.2 transcript_id=mCT50716.2 created
FT                   on 29-OCT-2002"
FT   CDS             <36746517..36746795
FT                   /codon_start=1
FT                   /locus_tag="mCG_50533"
FT                   /product="mCG50533"
FT                   /note="gene_id=mCG50533.2 transcript_id=mCT50716.2
FT                   protein_id=mCP26221.2"
FT                   /protein_id="EDL38662.1"
FT                   /translation="TGIRSIYGEKFEDENFILKHTGPGTLSMANAVPNTNDSQFFICTA
FT                   KTEWLDGKHVVFGKVKEGMNIVEAMEHFGSRNSKTSKMITISDCVQL"
FT   gene            36964491..36971535
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /note="gene_id=mCG16194.2"
FT   mRNA            join(36964491..36964669,36965494..36965601,
FT                   36967712..36967843,36968267..36968365,36969420..36969922)
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   transcript variant mCT16289"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT16289.1 created
FT                   on 30-JUL-2002"
FT   mRNA            join(36964880..36965093,36965494..36965601,
FT                   36967712..36967843,36968267..36968365,36969420..36969560,
FT                   36971417..36971535)
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   transcript variant mCT171247"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT171247.0 created
FT                   on 30-JUL-2002"
FT   mRNA            join(<36964893..36965093,36965494..36965601,
FT                   36967712..36967843,36968267..36968365,36969420..36970969)
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   transcript variant mCT193698"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT193698.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<36965089..36965093,36965494..36965601,
FT                   36967712..36967843,36968267..36968365,36969420..36969609)
FT                   /codon_start=1
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT193698.0
FT                   protein_id=mCP114650.0 isoform=CRA_b"
FT                   /protein_id="EDL38664.1"
FT                   /translation="TPMTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYD
FT                   QDGNPLQDFYDWDPPGVGSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARK
FT                   YLQSVVARGAGENLGGSAVDDPAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRY
FT                   KQRVKNKGRRIAYL"
FT   CDS             join(36965495..36965601,36967712..36967843,
FT                   36968267..36968365,36969420..36969560,36971417..36971477)
FT                   /codon_start=1
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT171247.0
FT                   protein_id=mCP94166.0 isoform=CRA_c"
FT                   /protein_id="EDL38665.1"
FT                   /translation="MTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYDQD
FT                   GNPLQDFYDWDPPGVGSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYL
FT                   QSVVARGAGENLGGSAVDDPAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRWVD
FT                   GCCRRSHCKQRKQADT"
FT   CDS             join(36965495..36965601,36967712..36967843,
FT                   36968267..36968365,36969420..36969609)
FT                   /codon_start=1
FT                   /gene="Adcyap1"
FT                   /locus_tag="mCG_16194"
FT                   /product="adenylate cyclase activating polypeptide 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16194.2 transcript_id=mCT16289.1
FT                   protein_id=mCP3071.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UYH8"
FT                   /db_xref="InterPro:IPR000532"
FT                   /db_xref="MGI:MGI:105094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYH8"
FT                   /protein_id="EDL38663.1"
FT                   /translation="MTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYDQD
FT                   GNPLQDFYDWDPPGVGSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYL
FT                   QSVVARGAGENLGGSAVDDPAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ
FT                   RVKNKGRRIAYL"
FT   gene            37090612..37092088
FT                   /pseudo
FT                   /locus_tag="mCG_16193"
FT                   /note="gene_id=mCG16193.1"
FT   mRNA            37090612..37092088
FT                   /pseudo
FT                   /locus_tag="mCG_16193"
FT                   /note="gene_id=mCG16193.1 transcript_id=mCT16288.1 created
FT                   on 23-OCT-2002"
FT   gene            38370562..38370955
FT                   /pseudo
FT                   /locus_tag="mCG_23395"
FT                   /note="gene_id=mCG23395.2"
FT   mRNA            38370562..38370955
FT                   /pseudo
FT                   /locus_tag="mCG_23395"
FT                   /note="gene_id=mCG23395.2 transcript_id=mCT23218.2 created
FT                   on 23-OCT-2002"
FT   gene            38454663..38455282
FT                   /pseudo
FT                   /locus_tag="mCG_49315"
FT                   /note="gene_id=mCG49315.2"
FT   mRNA            38454663..38455282
FT                   /pseudo
FT                   /locus_tag="mCG_49315"
FT                   /note="gene_id=mCG49315.2 transcript_id=mCT49498.2 created
FT                   on 28-OCT-2002"
FT   gene            complement(38486893..38509078)
FT                   /locus_tag="mCG_23397"
FT                   /note="gene_id=mCG23397.2"
FT   mRNA            complement(join(38486893..38488353,38494053..38494144,
FT                   38494511..38494617,38496300..38496474,38500418..38500487,
FT                   38501350..38501719,38504896..38504958,38508563..38509078))
FT                   /locus_tag="mCG_23397"
FT                   /product="mCG23397"
FT                   /note="gene_id=mCG23397.2 transcript_id=mCT23220.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(join(38488208..38488353,38494053..38494144,
FT                   38494511..38494617,38496300..38496474,38500418..38500487,
FT                   38501350..38501719,38504896..38504958,38508563..38508955))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23397"
FT                   /product="mCG23397"
FT                   /note="gene_id=mCG23397.2 transcript_id=mCT23220.2
FT                   protein_id=mCP3078.2"
FT                   /protein_id="EDL38666.1"
FT                   /translation="MSVVHHLPPGWLLDHLSFINKVNYQLCQHQESFCSKNNPTSSVYM
FT                   DSLQLDPGSPFGAPAMCFAPDFTTVSGNDDEGSCEVITEKYVFRSELFNVTKPYIVPAV
FT                   HKERQQSNKNENLVTDYKQEVSVSVGKKRKRCIAFNQGELDAMEYHTKIRELILDGSSK
FT                   LIQEGLRSGFLYPLVEKQDGSSGCITLPLDACNLSELCEMAKHLPSLNEMELQTLQLMG
FT                   DDVSVIELDLSSQIIENNSSFSKMITLMGQKYLLPPQSSFLLSDISCMQPLLNCGKTFD
FT                   AIVIDPPWENKSVKRSNRYSSLSPQQIKRMPIPKLAAADCLIVTWVTNRQKHLCFVKEE
FT                   LYPSWSVEVVAEWYWVKITNSGEFVFPLDSPHKKPYECLVLGRVKEKTPLALRNPDVRI
FT                   PPVPDQKLIVSVPCVLHSHKPPLTEVLRDYIKPGGQCLELFARNLQPGWMSWGNEVLKF
FT                   QHMDYFIALESGC"
FT   gene            38511103..38536278
FT                   /locus_tag="mCG_23398"
FT                   /note="gene_id=mCG23398.2"
FT   mRNA            join(38511103..38511197,38523606..38523764,
FT                   38524916..38525068,38528001..38528091,38532259..38532384,
FT                   38533003..38533106,38536033..38536270)
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, transcript variant mCT174658"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT174658.0 created
FT                   on 23-OCT-2002"
FT   mRNA            join(38511106..38511197,38516240..38516334,
FT                   38517463..38517552,38522642..38522748,38523606..38523764,
FT                   38524916..38525068,38528001..38528091,38532259..38532384,
FT                   38533003..38533106,38536033..38536278)
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, transcript variant mCT23221"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT23221.2 created
FT                   on 23-OCT-2002"
FT   mRNA            join(<38511115..38511332,38517463..38517552,
FT                   38523606..38523764,38524916..38525068,38528001..38528091,
FT                   38532280..38532384,38533003..38533080)
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, transcript variant mCT193653"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT193653.0 created
FT                   on 09-MAR-2004"
FT   gene            complement(38522044..38596591)
FT                   /locus_tag="mCG_23399"
FT                   /note="gene_id=mCG23399.2"
FT   mRNA            complement(join(38522044..38522721,38580665..38580714,
FT                   38582106..38582166,38596485..38596591))
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, transcript variant mCT174659"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT174659.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(38522701..38522721,38580665..38580714,
FT                   38582106..38582166,38596485..38596487))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, isoform CRA_a"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT174659.0
FT                   protein_id=mCP97578.0 isoform=CRA_a"
FT                   /protein_id="EDL38670.1"
FT                   /translation="MATIGKTIILKNIVKILEDMKGMKEVILERNPMNVINVSCNLFI"
FT   CDS             join(<38523627..38523764,38524916..38525068,
FT                   38528001..38528045)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, isoform CRA_a"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT193653.0
FT                   protein_id=mCP114657.0 isoform=CRA_a"
FT                   /protein_id="EDL38667.1"
FT                   /translation="LIRSLKNRLMSLRKLKASLQANVQNYKAEQQQMWNEELKYARGKE
FT                   AIEAQLAKYHKLARKLKLIPKGAENSKGYDFEIKFNPEVGANCPVKYRTQVYAPLKELL
FT                   NESEEKN"
FT   CDS             join(38523654..38523764,38524916..38525068,
FT                   38528001..38528045)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, isoform CRA_b"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT174658.0
FT                   protein_id=mCP97577.0 isoform=CRA_b"
FT                   /protein_id="EDL38668.1"
FT                   /translation="MSLRKLKASLQANVQNYKAEQQQMWNEELKYARGKEAIEAQLAKY
FT                   HKLARKLKLIPKGAENSKGYDFEIKFNPEVGANCPVKYRTQVYAPLKELLNESEEKN"
FT   CDS             join(38523654..38523764,38524916..38525068,
FT                   38528001..38528045)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23398"
FT                   /product="mCG23398, isoform CRA_b"
FT                   /note="gene_id=mCG23398.2 transcript_id=mCT23221.2
FT                   protein_id=mCP3070.2 isoform=CRA_b"
FT                   /protein_id="EDL38669.1"
FT                   /translation="MSLRKLKASLQANVQNYKAEQQQMWNEELKYARGKEAIEAQLAKY
FT                   HKLARKLKLIPKGAENSKGYDFEIKFNPEVGANCPVKYRTQVYAPLKELLNESEEKN"
FT   mRNA            complement(join(38529724..38529791,38536005..38536095,
FT                   38537234..38537593,38596485..38596584))
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, transcript variant mCT174660"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT174660.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(38537552..38537593,38596485..38596487))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, isoform CRA_b"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT174660.0
FT                   protein_id=mCP97579.0 isoform=CRA_b"
FT                   /protein_id="EDL38671.1"
FT                   /translation="MTYVLPRHNLWEDT"
FT   gene            38544110..38555673
FT                   /locus_tag="mCG_1051108"
FT                   /note="gene_id=mCG1051108.0"
FT   mRNA            join(38544110..38544306,38546615..38546652,
FT                   38555551..38555673)
FT                   /locus_tag="mCG_1051108"
FT                   /product="mCG1051108"
FT                   /note="gene_id=mCG1051108.0 transcript_id=mCT194897.0
FT                   created on 27-JAN-2005"
FT   CDS             38544152..38544286
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051108"
FT                   /product="mCG1051108"
FT                   /note="gene_id=mCG1051108.0 transcript_id=mCT194897.0
FT                   protein_id=mCP115926.0"
FT                   /protein_id="EDL38673.1"
FT                   /translation="MSYLKRRRCLKKRELKQNKARVRINQRLRLKIQKIPYQRRVTHS"
FT   gene            38564965..38568016
FT                   /locus_tag="mCG_23396"
FT                   /note="gene_id=mCG23396.1"
FT   mRNA            join(38564965..38566192,38566722..38567009,
FT                   38567078..38568016)
FT                   /locus_tag="mCG_23396"
FT                   /product="mCG23396"
FT                   /note="gene_id=mCG23396.1 transcript_id=mCT23219.1 created
FT                   on 19-JUN-2003"
FT   CDS             38565164..38565589
FT                   /codon_start=1
FT                   /locus_tag="mCG_23396"
FT                   /product="mCG23396"
FT                   /note="gene_id=mCG23396.1 transcript_id=mCT23219.1
FT                   protein_id=mCP3077.1"
FT                   /protein_id="EDL38674.1"
FT                   /translation="MKDGVTAKDVTRENGIHDLIPGSVIDVTLFNPCSYLTNGMKSDGT
FT                   YWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVKVFKPGKFVTTLFVNQSSKCRTVLS
FT                   SPQKIDGFKGLDCQSAMFNDYNFVFTSFAKKQQQQQS"
FT   mRNA            complement(join(38575743..38577629,38580665..38580714,
FT                   38582106..38582166,38582385..38582511,38596115..38596234))
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, transcript variant mCT23222"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT23222.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(38577622..38577629,38580665..38580714,
FT                   38582106..38582166,38582385..38582511,38596115..38596117))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23399"
FT                   /product="mCG23399, isoform CRA_c"
FT                   /note="gene_id=mCG23399.2 transcript_id=mCT23222.2
FT                   protein_id=mCP3074.1 isoform=CRA_c"
FT                   /protein_id="EDL38672.1"
FT                   /translation="MDAVTYDDVHVNFTGEEWDLLDSSQKSLYEEVMLETYQNITAIGY
FT                   NWEDHHIEEHCQNSRRHERHERSHIGEKPYERNQCGD"
FT   gene            complement(38619517..>38620256)
FT                   /locus_tag="mCG_1039359"
FT                   /note="gene_id=mCG1039359.1"
FT   mRNA            complement(38619517..>38620256)
FT                   /locus_tag="mCG_1039359"
FT                   /product="mCG1039359"
FT                   /note="gene_id=mCG1039359.1 transcript_id=mCT157063.1
FT                   created on 28-OCT-2002"
FT   CDS             complement(38620053..38620256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039359"
FT                   /product="mCG1039359"
FT                   /note="gene_id=mCG1039359.1 transcript_id=mCT157063.1
FT                   protein_id=mCP70874.1"
FT                   /protein_id="EDL38675.1"
FT                   /translation="MACSAARSLAYQDRFICIYPAYLNNKKTIAKGRRIPISKAVENPT
FT                   TTEVQDVCSAVGLNAFLEKNKL"
FT   gene            38626550..>38639036
FT                   /locus_tag="mCG_1039360"
FT                   /note="gene_id=mCG1039360.1"
FT   mRNA            join(38626550..38626650,38635525..38635651,
FT                   38635841..38635901,38637065..>38639036)
FT                   /locus_tag="mCG_1039360"
FT                   /product="mCG1039360"
FT                   /note="gene_id=mCG1039360.1 transcript_id=mCT157064.1
FT                   created on 28-OCT-2002"
FT   CDS             join(38626648..38626650,38635525..38635651,
FT                   38635841..38635901,38637065..38639036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039360"
FT                   /product="mCG1039360"
FT                   /note="gene_id=mCG1039360.1 transcript_id=mCT157064.1
FT                   protein_id=mCP70875.1"
FT                   /protein_id="EDL38676.1"
FT                   /translation="MDALTYDDVHVNFTQEEWALLNPTQRNLYKDVMLEIYRNLKAVGY
FT                   NWEDQNTEEYCQSSRKHGRHERSRTGEKPSENTKCGKAFACHSHPQKYERIHTGEKPND
FT                   GIQYGEAFVHHCSLQMHKIIHTGKKPYKCNQCGKAFAQPRTLQIHKRAHTGEKPYKCNE
FT                   CGKIFAQYNTLKRHKKTHTGEKPYECNQCSKAFADHDQLRKHERVHTGEKPYKCNECGK
FT                   VFAQYSTLKRHEKTHFGEKPYECKQCGKAFTQKAHLKIHIITHTGEKPYKCHQCDKAFA
FT                   SHGNLQVHKRTHTGEKPYECDQCGKAFAHHCHFRVHKRIHTGEKPYKCDQCVKAFADHG
FT                   QLRKHERVHTGEKPYKCNECGKAFVCNASLQAHKVTHSRVKPYECKQCSKSFASHGQLQ
FT                   AHERIHTGEKPYKCNQCGKAFIEHNTLKRHKITHTGEKPYECNQCSKSFASHGQLRKHE
FT                   RIHTGEKPYKCNQCGKAFAEHGQLLKHERIHTGEKPYKCNQCGKAFAYHYELQMHKRIH
FT                   TGEKPYECKQCGKFFASHGQLRKHERIHTGEKPYKCNQCGKVFGRHSHLRIHKRIHTGE
FT                   KPYKCDQCGKAFPYSNTLQVHKRTHTGEKPYACGQCGKAFANQSYLHVHKRIHTGEKPY
FT                   ECKQCSKSFVSNGQLQRHERIHTGEKPYKCDQCGKAFAYHYHLQMHKRMHTGEKPYECK
FT                   QCGKFFASHGQLRKHERIHTGEKPYK"
FT   assembly_gap    34954..53442
FT                   /estimated_length=18489
FT                   /gap_type="unknown"
FT   assembly_gap    136161..136180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222778..223219
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    228842..229087
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    230271..231305
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    238642..240191
FT                   /estimated_length=1550
FT                   /gap_type="unknown"
FT   assembly_gap    353282..354114
FT                   /estimated_length=833
FT                   /gap_type="unknown"
FT   assembly_gap    513342..513361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    658153..658776
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    661126..661145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    662408..662427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    752412..752517
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    837921..838385
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    874957..874991
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    876631..876650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980907..980956
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    987614..987633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    997897..998042
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    1030063..1030082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1057614..1057633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1079287..1081978
FT                   /estimated_length=2692
FT                   /gap_type="unknown"
FT   assembly_gap    1091051..1091093
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    1092280..1092299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1103362..1103381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108759..1108778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1136604..1143676
FT                   /estimated_length=7073
FT                   /gap_type="unknown"
FT   assembly_gap    1173371..1173390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1180516..1180535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1189326..1189345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1206267..1206389
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    1246145..1246164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1328089..1328108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1362828..1362918
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1392608..1394591
FT                   /estimated_length=1984
FT                   /gap_type="unknown"
FT   assembly_gap    1408748..1410899
FT                   /estimated_length=2152
FT                   /gap_type="unknown"
FT   assembly_gap    1423814..1423833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1429132..1432842
FT                   /estimated_length=3711
FT                   /gap_type="unknown"
FT   assembly_gap    1458683..1458702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1497842..1497998
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1500526..1500545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1504258..1504406
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1510150..1511195
FT                   /estimated_length=1046
FT                   /gap_type="unknown"
FT   assembly_gap    1520099..1520120
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1529827..1529869
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    1531089..1531194
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1552607..1552626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1576801..1576842
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1606115..1606483
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    1626413..1626432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1648746..1648765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1664240..1664285
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1668125..1668747
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    1713823..1713842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1735015..1735157
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    1738646..1738665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1764195..1764214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1777604..1777639
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    1792557..1792576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798990..1799289
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    1857996..1859821
FT                   /estimated_length=1826
FT                   /gap_type="unknown"
FT   assembly_gap    1860158..1860557
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    1868017..1869587
FT                   /estimated_length=1571
FT                   /gap_type="unknown"
FT   assembly_gap    1888902..1888921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1896603..1898412
FT                   /estimated_length=1810
FT                   /gap_type="unknown"
FT   assembly_gap    1910497..1910516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1916379..1916450
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1920567..1921405
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    1923847..1926171
FT                   /estimated_length=2325
FT                   /gap_type="unknown"
FT   assembly_gap    1928262..1928715
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    1930835..1930854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1933243..1933866
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    1938435..1938589
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1972769..1972788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975422..1975825
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    2012967..2012986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2013995..2014129
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    2108351..2108472
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    2119300..2119631
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    2120026..2120142
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    2173218..2173237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2179241..2179651
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    2199031..2199050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2214940..2214959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2217106..2217125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2218364..2218383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2229764..2231186
FT                   /estimated_length=1423
FT                   /gap_type="unknown"
FT   assembly_gap    2240525..2240772
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    2248527..2253440
FT                   /estimated_length=4914
FT                   /gap_type="unknown"
FT   assembly_gap    2274111..2274130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2296850..2296895
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    2309381..2309400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2312285..2312304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319743..2319762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2320903..2322004
FT                   /estimated_length=1102
FT                   /gap_type="unknown"
FT   assembly_gap    2324050..2324069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2339011..2339030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360581..2360600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2382825..2383452
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    2392116..2392135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2410672..2410720
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2411880..2411899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2418074..2418729
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    2421522..2421851
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    2427307..2428909
FT                   /estimated_length=1603
FT                   /gap_type="unknown"
FT   assembly_gap    2431010..2431960
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    2433214..2435460
FT                   /estimated_length=2247
FT                   /gap_type="unknown"
FT   assembly_gap    2443514..2443533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2458346..2459623
FT                   /estimated_length=1278
FT                   /gap_type="unknown"
FT   assembly_gap    2461109..2461429
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    2474155..2476474
FT                   /estimated_length=2320
FT                   /gap_type="unknown"
FT   assembly_gap    2493196..2493215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2508406..2508425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2509892..2509911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2513134..2513153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2532387..2532406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2536500..2536727
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    2544818..2545966
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    2546662..2548499
FT                   /estimated_length=1838
FT                   /gap_type="unknown"
FT   assembly_gap    2567911..2567930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2568985..2569004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2576891..2576910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2599659..2599678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2611145..2611740
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    2632478..2632576
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    2724351..2724463
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2747521..2750425
FT                   /estimated_length=2905
FT                   /gap_type="unknown"
FT   assembly_gap    2757604..2757623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2765508..2765538
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2772335..2772364
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2795554..2795573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2796882..2796934
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    2829746..2829765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2876274..2876293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2893071..2893090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2902004..2902023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2915720..2918549
FT                   /estimated_length=2830
FT                   /gap_type="unknown"
FT   assembly_gap    2919329..2919916
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    2929198..2929217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2993381..2993400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2995810..2995829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3016114..3016163
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    3017785..3018040
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    3019380..3019399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056127..3056497
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    3073644..3073757
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3095690..3096128
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    3134622..3134645
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3150120..3150272
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    3150851..3151251
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    3167358..3167522
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    3200694..3200713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3229414..3229433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3261821..3267352
FT                   /estimated_length=5532
FT                   /gap_type="unknown"
FT   assembly_gap    3276422..3280490
FT                   /estimated_length=4069
FT                   /gap_type="unknown"
FT   assembly_gap    3311481..3311934
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    3317188..3317207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3357401..3357444
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    3376723..3376861
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    3393527..3393604
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3413846..3413872
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    3420951..3421064
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3427194..3427213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3431676..3431695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3486395..3486414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3490488..3490507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3561065..3562918
FT                   /estimated_length=1854
FT                   /gap_type="unknown"
FT   assembly_gap    3571712..3571731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3574564..3574583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3614051..3614070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3616643..3616662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3638649..3638668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3655108..3655170
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3657176..3657195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3681187..3681206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3728727..3728760
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3755706..3755773
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3757671..3757690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3775874..3776456
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    3823805..3823824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3859322..3859341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3869257..3869276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3892132..3892151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3913408..3913427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3947501..3947520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3969511..3969530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3997550..3998112
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    4006627..4007421
FT                   /estimated_length=795
FT                   /gap_type="unknown"
FT   assembly_gap    4012213..4012232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4023419..4023811
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    4042824..4042843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4049334..4049353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4066395..4067697
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    4071984..4072003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4079609..4079628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4081918..4082259
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    4087229..4087248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4101808..4102338
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    4136518..4139324
FT                   /estimated_length=2807
FT                   /gap_type="unknown"
FT   assembly_gap    4177491..4177510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4223372..4223391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4262317..4264531
FT                   /estimated_length=2215
FT                   /gap_type="unknown"
FT   assembly_gap    4265321..4265538
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    4268253..4268272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4326475..4326494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4336835..4336854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4367080..4367120
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    4404220..4404239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4432617..4432636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4484355..4489906
FT                   /estimated_length=5552
FT                   /gap_type="unknown"
FT   assembly_gap    4531214..4531233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4534164..4538058
FT                   /estimated_length=3895
FT                   /gap_type="unknown"
FT   assembly_gap    4545505..4545524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4573264..4573283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4723053..4723072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4780213..4780311
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4814208..4814227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4820812..4820831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4838727..4838897
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    4869762..4869803
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    4887763..4887855
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4888759..4888778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4916735..4916838
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4923192..4923286
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4930894..4930913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4961655..4962088
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    4999348..4999444
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5000643..5000705
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    5027891..5030732
FT                   /estimated_length=2842
FT                   /gap_type="unknown"
FT   assembly_gap    5031921..5031940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5052942..5053453
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    5093136..5093155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5117901..5117920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5133970..5134354
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    5173603..5173657
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5184582..5184601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5237871..5238055
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    5240883..5241093
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    5246590..5246609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5310110..5310129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5319683..5319702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5322620..5323029
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    5353504..5353523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5382938..5383101
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    5414583..5414602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5423167..5423678
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    5441156..5441258
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    5464467..5464486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5484240..5484336
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5554048..5554067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5569778..5570241
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    5570477..5570540
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5641809..5641828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5642698..5642848
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    5648918..5653706
FT                   /estimated_length=4789
FT                   /gap_type="unknown"
FT   assembly_gap    5697692..5697886
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    5718173..5718192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5772509..5772528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5779106..5779229
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5793683..5793702
FT                   /es