Dbfetch

ID   CH466534; SV 1; linear; genomic DNA; CON; MUS; 41366983 BP.
XX
AC   CH466534;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009844919 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-41366983
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-41366983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; d277ea0791fd12c4934c2b3c0dc5a8b5.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000227.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000003555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004231; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011752; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016496; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024673; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024682; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024729; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024742; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024789; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024837; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024863; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024887; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024897; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024935; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024987; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025019; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025041; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025172; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025198; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025203; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025208; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025231; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033863; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034117; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041488; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042694; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044040; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045030; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045126; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045395; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046913; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047632; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048292; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050121; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050195; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050865; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054523; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056290; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056829; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067231; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074909; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079258; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079339; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079415; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090291; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094755; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095484; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096289; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000111123; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017886; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024836; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024839; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024844; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024862; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024863; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024865; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024869; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024870; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024873; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024878; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024880; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024883; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024886; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024888; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024903; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024904; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024911; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024914; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024916; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024917; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024920; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024921; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024922; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024923; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024924; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024934; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024935; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024939; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024943; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024945; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024947; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024948; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024949; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024956; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024959; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024961; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024974; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024983; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024987; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024990; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025002; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025004; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025018; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025019; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025021; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025022; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025023; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025028; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025030; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025033; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025034; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025058; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025059; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025060; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025064; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025066; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025068; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025075; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025078; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025084; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025087; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025098; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025099; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025102; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025112; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025130; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025135; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025162; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025168; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025170; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025176; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025179; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025185; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025187; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025191; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025205; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025209; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025212; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025214; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025218; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025225; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025230; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024804; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024807; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024812; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024830; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024831; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024833; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024837; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024838; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024841; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024846; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024853; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024854; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024857; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024860; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024864; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024879; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024880; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024887; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024890; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024892; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024893; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024897; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024898; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024899; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024900; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024911; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024920; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024922; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024923; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024924; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024925; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024926; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024929; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024933; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024936; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024938; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024951; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024964; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024967; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024979; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024981; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024995; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024996; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024998; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024999; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025000; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025005; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025007; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025011; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025036; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025037; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025040; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025042; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025054; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025060; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025063; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025078; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025089; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025096; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025100; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025107; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025112; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025120; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025139; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025145; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025147; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025153; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025156; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025161; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025162; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025164; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025168; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025181; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025185; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025188; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025194; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025201; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0025206; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017824; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024779; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024782; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024787; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024805; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024806; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024808; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024812; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024813; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024816; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024821; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024828; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024829; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024832; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024833; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024835; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024837; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024851; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024852; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024859; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024862; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024864; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024865; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024868; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024869; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024870; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024871; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024872; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024882; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024883; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024886; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024889; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024891; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024893; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024894; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024895; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024896; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024897; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024903; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024906; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024908; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024921; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024930; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024934; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024937; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024947; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024949; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024963; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024964; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024966; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024967; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024968; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024973; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024975; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024978; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024979; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024983; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025002; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025003; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025004; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025005; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025008; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025010; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025012; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025019; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025022; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025031; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025043; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025046; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025064; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025068; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025080; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025088; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025107; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025113; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025115; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025121; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025124; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025129; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025130; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025132; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025136; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025154; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025157; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025159; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025163; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025170; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025175; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017825; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024804; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024807; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024812; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024831; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024833; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024837; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024838; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024841; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024849; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024853; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024854; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024858; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024860; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024864; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024878; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024879; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024886; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024889; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024891; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024892; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024895; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024896; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024897; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024898; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024899; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024909; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024910; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024914; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024918; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024921; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024922; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024923; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024924; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024932; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024935; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024937; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024950; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024959; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024963; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024966; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024978; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024980; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024994; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024995; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024997; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024998; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024999; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025004; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025006; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025009; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025014; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025033; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025034; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025038; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025040; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025042; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025049; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025052; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025058; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025061; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025072; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025090; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025094; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025101; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025106; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025114; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025139; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025141; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025147; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025150; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025158; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025162; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025176; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025180; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025183; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025185; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025189; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025196; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017648; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024570; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024573; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024578; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024596; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024597; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024599; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024603; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024604; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024607; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024619; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024620; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024623; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024626; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024628; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024642; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024643; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024650; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024653; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024656; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024661; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024662; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024672; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024673; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024675; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024679; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024681; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024682; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024684; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024685; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024690; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024693; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024695; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024708; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024717; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024723; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024734; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024736; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024750; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024751; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024753; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024754; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024755; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024760; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024762; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024765; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024766; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024770; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024791; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024792; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024795; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024797; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024799; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024801; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024811; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024820; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024835; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024843; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024850; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024854; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024861; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024866; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024874; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024893; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024899; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024901; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024907; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024915; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024916; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024922; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024936; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024940; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024943; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024945; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024949; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024956; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024961; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018280; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021965; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025252; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025255; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025260; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025278; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025279; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025281; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025285; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025286; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025289; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025294; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025301; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025302; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025305; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025306; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025308; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025312; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025328; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025335; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025338; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025340; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025341; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025344; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025345; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025346; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025347; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025348; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025356; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025357; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025359; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025361; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025363; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025364; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025365; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025366; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025367; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025370; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025374; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025377; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025379; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025392; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025401; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025407; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025419; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025421; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025435; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025436; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025438; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025439; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025440; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025445; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025447; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025450; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025451; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025474; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025475; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025479; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025481; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025483; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025490; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025493; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025499; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025502; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025513; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025517; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025534; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025538; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025557; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025576; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025582; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025584; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025590; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025593; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025599; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025601; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025605; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025619; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025623; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025626; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025628; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025632; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025639; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025644; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020819; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024043; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024046; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024051; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024069; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024070; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024072; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024076; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024077; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024080; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024085; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024092; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024093; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024096; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024097; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024099; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024101; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024111; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024119; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024122; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024124; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024125; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024128; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024129; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024130; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024131; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024140; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024145; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024147; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024151; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024154; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024158; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024161; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024163; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024176; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024185; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024192; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024204; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024206; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024220; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024221; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024223; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024224; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024225; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024230; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024232; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024235; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024236; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024241; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024261; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024262; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024264; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024266; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024275; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024278; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024284; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024287; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024301; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024308; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024315; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024319; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024326; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024331; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024339; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024366; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024372; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024375; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024380; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024381; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024383; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024387; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024401; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024405; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024408; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024410; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024414; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024421; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024426; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017618; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024544; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024547; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024552; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024570; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024571; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024573; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024577; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024578; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024586; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024588; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024593; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024594; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024598; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024600; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024603; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024616; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024624; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024627; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024629; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024630; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024633; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024634; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024636; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024648; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024657; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024659; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024660; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024662; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024663; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024668; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024671; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024673; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024686; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024695; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024701; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024712; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024714; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024728; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024731; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024732; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024733; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024738; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024740; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024743; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024744; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024748; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024768; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024769; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024770; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024774; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024776; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024785; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024794; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024797; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024809; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024812; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024823; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024834; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024841; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024854; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024873; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024879; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024881; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024887; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024890; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024895; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024896; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024898; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024902; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024916; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024920; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024923; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024925; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024929; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024936; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017724; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024671; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024674; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024679; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024697; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024698; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024704; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024705; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024708; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024720; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024721; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024724; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024725; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024727; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024731; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024748; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024749; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024756; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024759; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024761; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024762; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024765; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024766; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024767; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024768; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024769; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024780; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024788; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024790; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024791; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024793; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024794; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024797; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024800; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024803; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024805; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024818; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024827; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024833; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024844; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024846; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024860; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024861; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024863; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024864; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024865; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024870; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024872; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024875; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024876; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024880; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024900; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024901; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024904; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024906; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024908; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024910; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024917; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024920; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024926; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024929; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024940; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024941; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024944; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024955; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024962; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024966; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024986; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025005; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025011; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025013; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025019; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025022; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025027; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025028; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025030; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025034; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025048; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025052; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025055; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025061; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025068; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025073; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017719; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024638; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024641; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024646; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024664; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024665; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024667; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024671; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024672; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024675; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024687; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024688; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024691; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024692; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024694; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024711; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024712; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024719; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024722; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024724; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024725; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024728; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024729; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024730; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024731; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024732; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024742; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024743; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024748; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024750; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024751; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024753; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024754; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024761; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024764; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024766; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024779; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024788; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024794; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024806; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024808; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024822; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024823; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024825; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024826; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024827; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024834; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024837; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024838; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024861; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024862; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024863; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024867; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024869; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024871; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024878; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024881; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024887; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024890; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024901; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024902; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024905; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024916; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024923; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024927; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024934; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024939; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024947; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024966; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024972; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024974; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024980; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024983; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024988; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024989; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024995; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025009; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025016; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025022; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025029; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0025034; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017798; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024758; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024761; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024766; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024784; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024785; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024787; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024791; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024792; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024795; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024800; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024807; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024808; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024811; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024812; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024814; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024818; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024831; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024832; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024842; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024844; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024848; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024849; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024850; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024851; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024852; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024862; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024863; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024870; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024872; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024873; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024874; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024875; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024876; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024879; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024884; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024887; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024889; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024902; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024911; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024917; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024929; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024931; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024945; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024946; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024948; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024949; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024950; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024957; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024960; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024965; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024984; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024986; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024987; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024988; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024992; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024994; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024996; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025003; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025006; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025012; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025015; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025026; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025030; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025041; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025048; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025052; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025064; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025072; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025091; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025097; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025105; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025113; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025114; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025116; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025120; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025134; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025138; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025141; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025143; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025154; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025159; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017747; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024665; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024668; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024673; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024691; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024692; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024694; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024698; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024699; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024707; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024714; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024715; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024718; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024719; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024738; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024739; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024746; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024752; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024755; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024756; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024757; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024758; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024759; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024769; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024770; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024774; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024776; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024778; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024780; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024788; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024791; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024793; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024806; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024815; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024821; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024833; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024835; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024849; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024850; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024853; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024854; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024859; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024861; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024864; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024865; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024869; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024882; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024892; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024898; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024900; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024902; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024909; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024912; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024921; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024932; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024936; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024947; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024954; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024958; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024965; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024970; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024997; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025003; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025005; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025011; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025014; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025019; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025020; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025022; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025026; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025040; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025044; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025047; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025049; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025053; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025065; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018320; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021988; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025300; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025303; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025326; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025327; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025329; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025333; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025334; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025337; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025342; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025349; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025350; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025353; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025354; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025356; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025360; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025375; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025376; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025383; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025386; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025388; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025389; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025392; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025393; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025394; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025395; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025396; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025406; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025407; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025411; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025413; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025414; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025416; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025418; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025419; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025420; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025421; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025425; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025429; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025432; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025456; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025462; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025474; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025476; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025490; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025491; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025493; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025494; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025495; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025500; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025502; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025505; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025506; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025510; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025532; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025537; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025539; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025541; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025548; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025551; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025557; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025560; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025571; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025572; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025575; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025584; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025595; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025602; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025607; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025615; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025634; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025640; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025642; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025648; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025651; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025656; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025657; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025659; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025663; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025677; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025684; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025686; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025690; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025697; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025702; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016994; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023788; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023791; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023796; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023814; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023817; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023822; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023824; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023836; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023837; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023840; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023841; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023843; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023860; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023861; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023868; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023871; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023873; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023877; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023878; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023879; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023889; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023890; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023898; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023902; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023907; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023912; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023925; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023934; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023940; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023952; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023954; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023968; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023971; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023972; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023973; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023978; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023980; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023983; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023984; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023989; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024000; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024016; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024018; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024020; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024030; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024036; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024039; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024050; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024058; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024069; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024080; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024088; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024107; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024113; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024121; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024124; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024129; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024132; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024136; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024150; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024154; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024157; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024159; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024163; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024170; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024175; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024105; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024108; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024113; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024131; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024132; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024134; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024138; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024139; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024142; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024154; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024155; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024159; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024163; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024179; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024180; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024187; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024190; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024192; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024193; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024196; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024197; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024198; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024199; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024209; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024210; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024215; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024217; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024218; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024219; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024220; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024221; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024226; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024229; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024231; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024244; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024253; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024259; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024271; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024273; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024287; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024288; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024290; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024291; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024292; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024299; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024302; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024303; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024307; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024323; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024325; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024326; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024327; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024331; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024333; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024335; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024342; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024345; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024351; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024354; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024365; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024366; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024378; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024385; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024389; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024396; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024401; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024409; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024434; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024442; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024445; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024450; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024451; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024453; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024457; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024471; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024475; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024478; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024480; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024484; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024491; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024496; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000004340; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018966; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025651; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025656; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025755; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025875; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056005; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061669; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065601; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067795; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071698; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072729; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082006; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087176; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000156291; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188267; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215930; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217281; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219412; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027548; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051070; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051073; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051094; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051142; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051146; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051155; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051157; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051164; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051179; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051187; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051195; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051199; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051203; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051218; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051219; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051233; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051242; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051246; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051247; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051251; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051252; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051253; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051254; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051264; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051265; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051273; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051275; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051276; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051277; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051278; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051279; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051287; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051298; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051301; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051337; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051363; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051368; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051371; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051393; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051397; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051462; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051464; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051467; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051475; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051476; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051497; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051503; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051575; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051581; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051583; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051586; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051616; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051630; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051642; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051649; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051683; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051684; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051690; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051715; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051747; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051767; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051791; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051868; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051892; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051895; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051912; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051917; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051928; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051929; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051932; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051946; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052013; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052021; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052030; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052037; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052044; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052055; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052062; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051061; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051064; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051085; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051133; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051137; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051146; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051148; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051155; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051171; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051197; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051202; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051210; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051212; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051214; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051220; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051235; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051236; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051250; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051259; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051264; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051267; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051268; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051269; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051270; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051271; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051281; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051282; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051291; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051293; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051294; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051295; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051296; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051300; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051305; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051319; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051355; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051382; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051387; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051390; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051411; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051415; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051478; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051491; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051492; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051513; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051530; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051531; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051590; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051594; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051598; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051600; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051603; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051633; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051659; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051666; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051695; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051696; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051702; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051724; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051756; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051761; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051800; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051876; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051899; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051902; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051919; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051937; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051939; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051957; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052022; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052030; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052038; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052045; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052052; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052063; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0052070; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027484; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051014; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051017; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051084; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051086; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051090; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051099; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051101; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051108; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051124; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051150; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051163; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051165; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051167; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051171; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051185; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051186; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051200; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051209; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051213; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051217; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051218; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051219; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051220; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051221; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051231; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051232; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051235; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051238; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051240; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051242; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051243; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051244; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051245; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051246; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051253; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051264; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051267; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051304; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051336; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051339; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051357; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051361; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051425; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051427; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051430; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051438; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051439; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051466; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051477; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051478; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051489; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051533; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051535; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051537; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051539; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051543; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051549; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051578; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051605; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051612; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051642; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051643; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051649; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051673; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051705; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051710; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051725; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051749; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051769; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051824; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051847; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051850; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051867; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051873; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051884; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051886; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051904; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051971; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051979; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051987; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051994; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052001; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052012; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0052019; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051007; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051010; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051031; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051077; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051079; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051083; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051092; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051094; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051117; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051129; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051143; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051148; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051156; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051158; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051160; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051166; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051180; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051181; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051195; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051204; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051208; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051209; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051212; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051213; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051214; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051215; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051216; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051226; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051227; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051231; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051235; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051237; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051238; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051239; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051240; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051250; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051261; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051264; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051300; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051327; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051332; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051356; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051360; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051424; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051426; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051429; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051437; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051438; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051459; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051476; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051488; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051534; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051536; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051542; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051544; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051547; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051591; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051603; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051643; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051644; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051650; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051669; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051701; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051706; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051745; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051765; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051820; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051842; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051846; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051863; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051872; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051883; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051885; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051888; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051903; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051970; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051978; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051986; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051993; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052000; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052011; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052018; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050748; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050751; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050772; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050818; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050820; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050824; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050833; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050835; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050885; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050893; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050901; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050915; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050916; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050930; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050939; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050943; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050944; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050947; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050948; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050949; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050950; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050951; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050960; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050963; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050967; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050969; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050970; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050979; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050990; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050993; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051030; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051057; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051064; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051083; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051087; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051150; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051155; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051163; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051164; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051185; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051191; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051202; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051203; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051214; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051265; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051269; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051273; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051275; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051279; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051308; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051322; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051335; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051371; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051372; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051378; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051400; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051437; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051452; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051477; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051497; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051551; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051576; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051579; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051596; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051616; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051618; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051621; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051636; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051703; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051711; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051719; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051726; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051744; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051751; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028004; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040557; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051499; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051502; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051523; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051568; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051570; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051574; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051583; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051585; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051592; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051607; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051632; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051637; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051645; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051649; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051656; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051672; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051673; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051687; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051696; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051700; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051701; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051705; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051706; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051708; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051716; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051717; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051723; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051724; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051725; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051726; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051727; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051730; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051735; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051746; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051785; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051812; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051819; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051843; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051913; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051915; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051918; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051927; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051965; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051976; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052019; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052021; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052023; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052029; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052031; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052035; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052065; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052079; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052093; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052100; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052135; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052136; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052143; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052165; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052197; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052202; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052240; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052260; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052337; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052341; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052365; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052376; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052378; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052381; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052396; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052467; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052475; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052482; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052489; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052500; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052507; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039827; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050884; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050887; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050908; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050954; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050960; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050969; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050971; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050978; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050993; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051015; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051020; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051028; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051030; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051032; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051036; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051046; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051047; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051060; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051069; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051073; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051074; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051077; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051078; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051079; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051080; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051089; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051090; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051094; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051096; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051097; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051099; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051100; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051103; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051119; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051122; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051158; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051185; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051192; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051215; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051219; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051285; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051287; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051290; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051298; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051299; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051322; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051340; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051341; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051400; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051406; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051438; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051452; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051467; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051474; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051507; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051565; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051588; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051612; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051633; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051691; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051715; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051719; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051738; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051743; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051754; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051756; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051759; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051842; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051852; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051867; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051875; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051887; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051895; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027235; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050685; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050688; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050709; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050755; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050757; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050761; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050770; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050772; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050779; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050795; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050801; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050820; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050825; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050833; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050835; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050837; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050842; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050856; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050870; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050879; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050883; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050884; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050887; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050888; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050889; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050890; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050891; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050901; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050902; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050911; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050913; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050914; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050916; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050923; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050934; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050937; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050974; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051008; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051027; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051031; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051094; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051096; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051099; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051107; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051108; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051129; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051146; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051147; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051158; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051205; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051207; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051209; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051215; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051217; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051250; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051264; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051283; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051316; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051317; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051323; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051348; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051379; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051384; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051399; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051443; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051498; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051522; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051525; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051542; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051551; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051563; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051565; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051568; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051583; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051650; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051658; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051666; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051673; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051680; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0051698; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050780; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050783; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050804; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050850; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050852; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050856; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050865; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050867; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050874; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050890; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050917; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050930; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050932; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050934; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050937; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050940; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050957; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050958; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050972; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050981; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050985; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050986; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050990; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050991; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050992; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050993; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051003; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051014; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051015; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051017; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051018; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051021; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051025; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051036; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051039; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051077; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051104; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051111; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051131; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051135; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051198; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051200; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051203; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051211; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051212; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051239; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051250; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051251; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051262; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051310; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051312; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051316; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051320; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051322; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051370; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051422; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051423; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051429; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051453; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051485; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051490; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051529; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051549; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051627; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051630; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051647; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051656; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051666; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051668; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051671; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051753; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051761; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051776; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051783; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051794; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0051801; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050746; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050749; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050770; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050820; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050829; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050831; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050838; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050878; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050883; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050891; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050893; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050895; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050900; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050915; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050916; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050930; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050939; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050947; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050948; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050949; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050950; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050951; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050961; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050962; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050967; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050969; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050970; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050972; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050973; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050981; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050992; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051058; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051065; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051087; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051157; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051159; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051162; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051170; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051171; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051192; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051198; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051209; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051221; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051262; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051267; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051269; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051275; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051280; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051309; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051323; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051335; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051341; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051375; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051376; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051382; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051407; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051439; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051444; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051459; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051484; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051504; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051559; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051584; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051601; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051609; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051620; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051622; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051625; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051640; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051707; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051715; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051723; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051737; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051749; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0051756; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0039960; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050902; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050905; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050926; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050972; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050974; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050978; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050987; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050989; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050996; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051011; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051038; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051043; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051053; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051055; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051058; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051061; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051074; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051075; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051089; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051098; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051102; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051103; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051106; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051107; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051108; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051109; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051110; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051120; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051121; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051128; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051130; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051131; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051132; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051133; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051134; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051137; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051143; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051154; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051157; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051193; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051220; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051227; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051248; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051252; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051318; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051320; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051323; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051331; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051332; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051353; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051359; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051370; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051371; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051381; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051431; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051433; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051439; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051441; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051445; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051472; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051498; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051540; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051546; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051574; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051606; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051611; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051626; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051670; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051725; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051748; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051751; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051767; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051772; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051783; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051788; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051803; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051870; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051878; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051886; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051900; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051911; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0051918; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050737; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050740; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050761; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050805; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050807; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050820; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050822; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050829; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050846; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050872; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050877; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050885; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050887; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050889; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050893; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050908; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050909; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050923; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050932; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050936; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050937; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050940; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050941; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050942; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050943; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050944; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050954; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050955; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050959; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050961; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050963; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050964; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050965; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050974; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050985; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050988; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051024; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051051; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051058; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051080; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051084; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051149; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051151; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051154; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051162; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051163; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051201; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051213; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051243; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051262; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051264; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051272; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051274; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051305; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051319; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051331; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051337; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051371; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051377; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051406; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051438; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051443; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051483; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051503; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051558; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051580; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051583; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051600; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051607; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051618; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051620; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051623; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051637; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051704; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051712; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051720; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051727; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051734; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051745; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051752; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040593; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051611; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051614; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051635; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051680; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051682; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051686; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051697; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051704; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051719; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051748; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051753; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051763; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051765; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051768; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051771; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051787; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051788; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051802; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051811; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051816; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051819; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051820; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051822; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051823; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051833; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051838; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051840; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051843; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051845; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051846; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051847; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051848; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051849; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051852; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051857; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051868; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051934; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051941; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051965; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052034; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052036; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052039; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052047; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052048; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052075; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052086; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052087; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052098; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052148; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052150; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052157; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052159; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052162; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052192; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052206; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052226; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052259; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052260; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052266; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052289; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052321; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052326; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052341; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052365; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052385; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052440; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052462; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052465; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052482; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052489; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052502; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052520; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052587; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052595; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052603; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052610; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052617; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052628; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052635; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026607; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050475; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050501; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050548; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050550; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050554; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050565; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050571; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050608; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050613; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050621; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050623; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050625; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050645; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050659; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050668; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050672; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050673; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050676; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050677; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050678; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050679; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050688; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050689; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050697; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050698; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050700; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050701; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050708; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050719; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050722; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050759; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050789; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050796; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050820; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050892; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050894; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050897; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050905; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050906; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050929; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050935; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050947; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050960; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050988; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051008; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051017; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051051; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051065; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051079; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051086; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051117; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051141; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051173; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051178; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051218; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051239; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051297; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051321; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051324; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051341; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051349; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051361; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051364; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051366; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051382; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051449; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051457; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051465; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051472; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051494; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051502; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026824; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050033; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050036; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050057; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050103; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050105; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050109; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050118; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050127; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050166; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050171; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050179; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050181; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050183; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050187; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050203; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050204; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050218; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050227; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050231; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050232; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050235; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050236; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050237; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050238; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050248; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050249; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050254; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050256; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050257; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050258; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050259; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050260; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050277; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050280; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050317; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050344; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050351; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050377; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050443; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050445; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050448; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050456; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050478; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050484; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050495; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050496; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050506; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050544; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050547; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050551; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050556; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050558; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050562; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050592; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050606; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050618; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050625; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050654; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050655; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050685; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050717; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050722; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050737; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050761; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050781; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050836; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050859; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050862; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050887; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050898; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050900; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050903; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050918; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050993; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051001; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051008; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051015; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051026; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051033; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..41366983
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1899..7607
FT                   /estimated_length=5709
FT                   /gap_type="unknown"
FT   assembly_gap    10937..12541
FT                   /estimated_length=1605
FT                   /gap_type="unknown"
FT   assembly_gap    13868..15121
FT                   /estimated_length=1254
FT                   /gap_type="unknown"
FT   assembly_gap    19504..20817
FT                   /estimated_length=1314
FT                   /gap_type="unknown"
FT   assembly_gap    25663..25682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26587..27822)
FT                   /locus_tag="mCG_118515"
FT                   /note="gene_id=mCG118515.0"
FT   mRNA            complement(26587..27822)
FT                   /locus_tag="mCG_118515"
FT                   /product="mCG118515"
FT                   /note="gene_id=mCG118515.0 transcript_id=mCT119681.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(26918..27703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118515"
FT                   /product="mCG118515"
FT                   /note="gene_id=mCG118515.0 transcript_id=mCT119681.0
FT                   protein_id=mCP64343.1"
FT                   /protein_id="EDL41327.1"
FT                   /translation="MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHV
FT                   SLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFE
FT                   APNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSSEFARICRDLSHIGDAVVISCA
FT                   KNGVKFSASGELGNGNIKLSQTSNVDKEEEAVAIEMNEPVHLTFALRYLNFFTKATPLS
FT                   PTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEAS"
FT   assembly_gap    27823..28305
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    29721..39011
FT                   /estimated_length=9291
FT                   /gap_type="unknown"
FT   assembly_gap    40215..40234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41388..45822
FT                   /estimated_length=4435
FT                   /gap_type="unknown"
FT   assembly_gap    48234..48253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    71922..71941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    73485..73504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    76017..77351
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   assembly_gap    79598..79617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    114349..115544
FT                   /estimated_length=1196
FT                   /gap_type="unknown"
FT   assembly_gap    119213..119948
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    130302..130321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    146277..150447
FT                   /estimated_length=4171
FT                   /gap_type="unknown"
FT   assembly_gap    159463..161474
FT                   /estimated_length=2012
FT                   /gap_type="unknown"
FT   assembly_gap    172071..172174
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    189628..195543
FT                   /estimated_length=5916
FT                   /gap_type="unknown"
FT   assembly_gap    219659..219713
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    230351..230370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(230766..257889)
FT                   /gene="Incenp"
FT                   /locus_tag="mCG_1916"
FT                   /note="gene_id=mCG1916.0"
FT   mRNA            complement(join(230766..231293,232640..232790,
FT                   233236..233343,233518..233596,235010..235236,
FT                   236097..236216,236548..236668,236739..236848,
FT                   242119..242253,242325..242439,242858..242909,
FT                   243893..244007,244127..244184,245095..245146,
FT                   251693..252429,253259..253372,253741..253891,
FT                   257759..257889))
FT                   /gene="Incenp"
FT                   /locus_tag="mCG_1916"
FT                   /product="inner centromere protein"
FT                   /note="gene_id=mCG1916.0 transcript_id=mCT1454.1 created on
FT                   04-APR-2003"
FT   CDS             complement(join(231097..231293,232640..232790,
FT                   233236..233343,233518..233596,235010..235236,
FT                   236097..236216,236548..236668,236739..236848,
FT                   242119..242253,242325..242439,242858..242909,
FT                   243893..244007,244127..244184,245095..245146,
FT                   251693..252429,253259..253372,253741..253880))
FT                   /codon_start=1
FT                   /gene="Incenp"
FT                   /locus_tag="mCG_1916"
FT                   /product="inner centromere protein"
FT                   /note="gene_id=mCG1916.0 transcript_id=mCT1454.1
FT                   protein_id=mCP9808.2"
FT                   /protein_id="EDL41328.1"
FT                   /translation="MGTTAPGPICLLDLCDQKLLDFVCNVDNKDFMWLKEIEEEAERMF
FT                   IREFSNEPELMPKTPSQKNRRKKRRVSNIQDENRDPVRKRLSRRKSRSSQVGTRHLRSK
FT                   PVTIVEENGFPVLQRITRATAAAAAAAAAASVASASSSSTAGSPTVLTKKAVVEISTSE
FT                   RLSAELQLTKLKGSLPPSPVSQGTLTSEEELTPKKSEAGKLDSVTVNSLKATPQSPKNR
FT                   GVGEGRSVSKLKIARASWGLQDSPGSTDSPWQERVLSPILLNNILPTTAKSPLGNIRSV
FT                   RRSLISQDSQVPLASKYNLVAKQENGSRRSSRRIAKKAGKEPEASARIICHSYLERLLN
FT                   VEVPQNVGLEQEPVEVAEPEEAEEEQEVSKNSGCPSKPRSATKIAISTPTSKPAAAGQT
FT                   TTVEEQEAELDQTDGHREPPQSVRRKRSYKQAISEPDEEQLEDEELQPCQNKTPSPPCP
FT                   ANKVVRPLRTFLHTVQKNQMLMTPTLASRSSVMKSFIKRNTPLRVDPKEKERQRLESLR
FT                   RKEEAEQRRRQKVEEDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIEQKFAQ
FT                   IDEKTEKAKEERLAEKAKKKATAKKMEEVEARRKQEEEARRLRWLQQEEEERRHQEMLQ
FT                   RKKEEEQERRKAAEARRLAEQREQERRREQERREQERREQERREQERKEQERREQEQER
FT                   LRAKREMQEREKALRLQKERLQKELEEKKRKEEQQRLAEQQLQEEQAKKAKEVAAARKV
FT                   LNMTVDVQSPVCTSYQMTPQGPKSIPKISVDDYGMDLNSDDSTDDESHPRKPIPSWAKG
FT                   TQLSQAIVHQYYHPPNILELFGSILPLDLEDIFKKRKTRYHKRTSSAVWNSPPLKATMV
FT                   PSSGD"
FT   assembly_gap    276531..276703
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    282582..282950
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    292942..293452
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    294262..294350
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    304307..304326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    328800..328819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <341448..343837
FT                   /gene="Fth1"
FT                   /locus_tag="mCG_1931"
FT                   /note="gene_id=mCG1931.0"
FT   mRNA            join(<341448..343072,343305..343430,343526..343837)
FT                   /gene="Fth1"
FT                   /locus_tag="mCG_1931"
FT                   /product="ferritin heavy chain 1, transcript variant
FT                   mCT194009"
FT                   /note="gene_id=mCG1931.0 transcript_id=mCT194009.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(341448..341728,342926..343072,343305..343430,
FT                   343526..343837)
FT                   /gene="Fth1"
FT                   /locus_tag="mCG_1931"
FT                   /product="ferritin heavy chain 1, transcript variant
FT                   mCT8313"
FT                   /note="gene_id=mCG1931.0 transcript_id=mCT8313.0 created on
FT                   30-SEP-2002"
FT   CDS             join(341615..341728,342926..343072,343305..343430,
FT                   343526..343687)
FT                   /codon_start=1
FT                   /gene="Fth1"
FT                   /locus_tag="mCG_1931"
FT                   /product="ferritin heavy chain 1, isoform CRA_b"
FT                   /note="gene_id=mCG1931.0 transcript_id=mCT8313.0
FT                   protein_id=mCP9865.1 isoform=CRA_b"
FT                   /protein_id="EDL41330.1"
FT                   /translation="MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRD
FT                   DVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECA
FT                   LHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPE
FT                   AGMAEYLFDKHTLGHGDES"
FT   CDS             join(<342827..343072,343305..343430,343526..343687)
FT                   /codon_start=1
FT                   /gene="Fth1"
FT                   /locus_tag="mCG_1931"
FT                   /product="ferritin heavy chain 1, isoform CRA_a"
FT                   /note="gene_id=mCG1931.0 transcript_id=mCT194009.0
FT                   protein_id=mCP115018.0 isoform=CRA_a"
FT                   /protein_id="EDL41329.1"
FT                   /translation="TFKRPSRMAHSLCIQPLRCLAVEISNMYPFHFQSCYFDRDDVALK
FT                   NFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEK
FT                   SVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAE
FT                   YLFDKHTLGHGDES"
FT   gene            complement(343916..>352066)
FT                   /gene="Vmd2"
FT                   /locus_tag="mCG_1951"
FT                   /note="gene_id=mCG1951.1"
FT   mRNA            complement(join(343916..344167,344942..345098,
FT                   345396..345739,347867..348018,348347..348427,
FT                   349219..349371,350382..350459,350802..350956,
FT                   351511..351744,351973..>352066))
FT                   /gene="Vmd2"
FT                   /locus_tag="mCG_1951"
FT                   /product="vitelliform macular dystrophy 2 homolog (human),
FT                   transcript variant mCT8333"
FT                   /note="gene_id=mCG1951.1 transcript_id=mCT8333.1 created on
FT                   30-SEP-2002"
FT   mRNA            complement(join(343919..344167,344942..345116,
FT                   345396..345739,347867..348018,348347..348427,
FT                   349219..349371,350382..350459,350802..350956,
FT                   351511..351744,351973..>352051))
FT                   /gene="Vmd2"
FT                   /locus_tag="mCG_1951"
FT                   /product="vitelliform macular dystrophy 2 homolog (human),
FT                   transcript variant mCT194092"
FT                   /note="gene_id=mCG1951.1 transcript_id=mCT194092.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(344131..344167,344942..345098,
FT                   345396..345739,347867..348018,348347..348427,
FT                   349219..349371,350382..350459,350802..350956,
FT                   351511..351744,351973..352066))
FT                   /codon_start=1
FT                   /gene="Vmd2"
FT                   /locus_tag="mCG_1951"
FT                   /product="vitelliform macular dystrophy 2 homolog (human),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1951.1 transcript_id=mCT8333.1
FT                   protein_id=mCP9858.1 isoform=CRA_b"
FT                   /protein_id="EDL41332.1"
FT                   /translation="MVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQ
FT                   YENLPWPDRLMIQVSSFVEGKDEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLH
FT                   HLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEV
FT                   CTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVV
FT                   PVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPM
FT                   ERDMYWNEAAPQPPYTAASARSRRHSFMGSTFNISLKKEDLELWSKEEADTDKKESGYS
FT                   STIGCFLGLQPKNYHLPLKDLKTKLLCSKNPLLEGQCKDANQKNQKDVWKFKGLDFLKC
FT                   VPRFKRRGSHCGPQAPSSHPTEQSAPSSSDTDYQEICHMKKKTVEFNLNIPESPTEHLQ
FT                   QRRLDQMSTNIQALMKEHAESYPYRDEAGTKPVLYE"
FT   CDS             complement(join(344131..344167,344942..345116,
FT                   345396..345739,347867..348018,348347..348427,
FT                   349219..349371,350382..350459,350802..350956,
FT                   351511..351744,351973..>352051))
FT                   /codon_start=1
FT                   /gene="Vmd2"
FT                   /locus_tag="mCG_1951"
FT                   /product="vitelliform macular dystrophy 2 homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1951.1 transcript_id=mCT194092.0
FT                   protein_id=mCP115076.0 isoform=CRA_a"
FT                   /protein_id="EDL41331.1"
FT                   /translation="DQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLP
FT                   WPDRLMIQVSSFVEGKDEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLA
FT                   GFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRT
FT                   QCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTI
FT                   LQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMY
FT                   WNEAAPQPPYTAASARSRRHSFMGSTFNISLKKEDLELWSKEEADTDKKESGYSSTIGC
FT                   FLGLQPKNYHLPLKDLKTKLLCSKNPLLEGQCKDANQKNQKDVWKFKGLDFLKCVPRFK
FT                   RRGSHCGPQAPSSHPTEQSAPSSSDTGDGPSTDYQEICHMKKKTVEFNLNIPESPTEHL
FT                   QQRRLDQMSTNIQALMKEHAESYPYRDEAGTKPVLYE"
FT   assembly_gap    353015..353034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    355019..355038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    356081..358443
FT                   /estimated_length=2363
FT                   /gap_type="unknown"
FT   assembly_gap    359996..360764
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   gene            373245..393408
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /note="gene_id=mCG1961.2"
FT   mRNA            join(373245..373391,381555..381814,382413..382508,
FT                   382589..382666,385179..385307,385398..385510,
FT                   387382..387481,388773..388839,389486..390111,
FT                   393087..393408)
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   transcript variant mCT174033"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT174033.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<373269..373395,381559..381814,382413..382508,
FT                   382589..382666,385179..385307,385398..385510,
FT                   387382..387481,388773..388839,389486..390484)
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   transcript variant mCT194129"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT194129.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<373271..373395,381559..381814,382413..382508,
FT                   382589..382666,385179..385307,385398..385510,
FT                   387382..387481,388773..388839,389486..389568)
FT                   /codon_start=1
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT194129.0
FT                   protein_id=mCP115095.0 isoform=CRA_b"
FT                   /protein_id="EDL41334.1"
FT                   /translation="GRPAGQTGGGAIDRRQGSSGAPGRVGGARGRGYGGDAGMWSGQPQ
FT                   QDEGLPVGLSAIPVPWKNLGPSKSNRESSGGLVEASTSWEEAQGEEHPAPAPLDVSRLR
FT                   SSSMEIREKGSEFLKEELYKAQKELKLKDEECERLCKVRAQLEQELEELTASLFEEAHK
FT                   MVREANMKQATSEKQLKEAWGKVDTTLFAEFQAWRASPTLDKSCPFLERVYREDVGPCL
FT                   DFTVQELSALVRTAVEDNTLTIEPVASQTLPAVKVPTVECNNTNTCALSGLARTCHHRI
FT                   RLGDSDSHYYISPSSRARITAVCNFFTYIRYIQQGLVRQDAEPMFWEIMRLRKGMSLAK
FT                   LGFFPQEA"
FT   mRNA            join(373283..373395,381559..381814,382413..382508,
FT                   382589..382666,383314..383532,385179..385307,
FT                   385398..385510,387382..387481,388773..388839,
FT                   389486..390111,393087..393408)
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   transcript variant mCT8343"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT8343.2 created on
FT                   30-SEP-2002"
FT   CDS             join(373385..373395,381559..381814,382413..382508,
FT                   382589..382666,383314..383532,385179..385307,
FT                   385398..385510,387382..387481,388773..388839,
FT                   389486..389568)
FT                   /codon_start=1
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT8343.2
FT                   protein_id=mCP9806.2 isoform=CRA_c"
FT                   /protein_id="EDL41335.1"
FT                   /translation="MWSGQPQQDEGLPVGLSAIPVPWKNLGPSKSNRESSGGLVEASTS
FT                   WEEAQGEEHPAPAPLDVSRLRSSSMEIREKGSEFLKEELYKAQKELKLKDEECERLCKV
FT                   RAQLEQELEELTASLFEEAHKMVREANMKQATSEKQLKEAWGKIDMLQAEVTALKTLVI
FT                   TSTPASPNRELHPQLLSPTKAGPRKGHSRQKSTSSSLCPVVCPTAGHIPTPDKEGKEVD
FT                   TTLFAEFQAWRASPTLDKSCPFLERVYREDVGPCLDFTVQELSALVRTAVEDNTLTIEP
FT                   VASQTLPAVKVPTVECNNTNTCALSGLARTCHHRIRLGDSDSHYYISPSSRARITAVCN
FT                   FFTYIRYIQQGLVRQDAEPMFWEIMRLRKGMSLAKLGFFPQEA"
FT   CDS             join(373385..373391,381555..381814,382413..382508,
FT                   382589..382666,385179..385307,385398..385510,
FT                   387382..387481,388773..388839,389486..389568)
FT                   /codon_start=1
FT                   /gene="Rab3il1"
FT                   /locus_tag="mCG_1961"
FT                   /product="RAB3A interacting protein (rabin3)-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1961.2 transcript_id=mCT174033.0
FT                   protein_id=mCP96952.0 isoform=CRA_a"
FT                   /protein_id="EDL41333.1"
FT                   /translation="MWSSQPQQDEGLPVGLSAIPVPWKNLGPSKSNRESSGGLVEASTS
FT                   WEEAQGEEHPAPAPLDVSRLRSSSMEIREKGSEFLKEELYKAQKELKLKDEECERLCKV
FT                   RAQLEQELEELTASLFEEAHKMVREANMKQATSEKQLKEAWGKVDTTLFAEFQAWRASP
FT                   TLDKSCPFLERVYREDVGPCLDFTVQELSALVRTAVEDNTLTIEPVASQTLPAVKVPTV
FT                   ECNNTNTCALSGLARTCHHRIRLGDSDSHYYISPSSRARITAVCNFFTYIRYIQQGLVR
FT                   QDAEPMFWEIMRLRKGMSLAKLGFFPQEA"
FT   assembly_gap    394314..394484
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    396456..396598
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            396715..415223
FT                   /gene="Fads3"
FT                   /locus_tag="mCG_1954"
FT                   /note="gene_id=mCG1954.2"
FT   mRNA            join(396715..397065,407313..407423,407947..408144,
FT                   409131..409232,409338..409460,409717..409777,
FT                   410218..410294,410708..410805,411102..411198,
FT                   411328..411407,411536..411661,412996..413898)
FT                   /gene="Fads3"
FT                   /locus_tag="mCG_1954"
FT                   /product="fatty acid desaturase 3, transcript variant
FT                   mCT8336"
FT                   /note="gene_id=mCG1954.2 transcript_id=mCT8336.2 created on
FT                   30-SEP-2002"
FT   mRNA            join(396719..397065,407313..407423,407947..408144,
FT                   409131..409232,409338..409460,409717..409777,
FT                   410218..410294,410708..410805,411102..411198,
FT                   411328..411407,411536..411661,412996..413075,
FT                   414624..415223)
FT                   /gene="Fads3"
FT                   /locus_tag="mCG_1954"
FT                   /product="fatty acid desaturase 3, transcript variant
FT                   mCT174030"
FT                   /note="gene_id=mCG1954.2 transcript_id=mCT174030.0 created
FT                   on 30-SEP-2002"
FT   CDS             join(396841..397065,407313..407423,407947..408144,
FT                   409131..409232,409338..409460,409717..409777,
FT                   410218..410294,410708..410805,411102..411198,
FT                   411328..411407,411536..411661,412996..413047)
FT                   /codon_start=1
FT                   /gene="Fads3"
FT                   /locus_tag="mCG_1954"
FT                   /product="fatty acid desaturase 3, isoform CRA_a"
FT                   /note="gene_id=mCG1954.2 transcript_id=mCT174030.0
FT                   protein_id=mCP96949.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3T9H9"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="MGI:MGI:1928740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9H9"
FT                   /protein_id="EDL41336.1"
FT                   /translation="MGGVGEPGGGPGPREGPAPLGAPLPIFRWEQIRQHDLPGDKWLVI
FT                   ERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFHAFHQDLHFVRKFLKPLLIGELAPEE
FT                   PSQDGAQNAQLIEDFRALRQAAEDMKLFEADTTFFALLLGHILAMELLAWLIIYLLGPG
FT                   WVSSILAALILAISQAQCWCLQHDLGHASIFTKSRWNHVAQQFVMGQLKGFSAHWWNFR
FT                   HFQHHAKPNIFHKDPDVTVAPVFLLGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTL
FT                   VNFEVENLAYMLVCMQWTDLLWAASFYSRFFLSYSPFYGATGTLLLFVAVRVLESHWFV
FT                   WITQMNHIPKEIGHEKHRDWASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRH
FT                   NYRRVAPLVKAFCAKHGLHYEVKPFLTALVDIIGSLKKSGDIWLDAYLHQ"
FT   CDS             join(396841..397065,407313..407423,407947..408144,
FT                   409131..409232,409338..409460,409717..409777,
FT                   410218..410294,410708..410805,411102..411198,
FT                   411328..411407,411536..411661,412996..413047)
FT                   /codon_start=1
FT                   /gene="Fads3"
FT                   /locus_tag="mCG_1954"
FT                   /product="fatty acid desaturase 3, isoform CRA_a"
FT                   /note="gene_id=mCG1954.2 transcript_id=mCT8336.2
FT                   protein_id=mCP9854.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3T9H9"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="MGI:MGI:1928740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9H9"
FT                   /protein_id="EDL41337.1"
FT                   /translation="MGGVGEPGGGPGPREGPAPLGAPLPIFRWEQIRQHDLPGDKWLVI
FT                   ERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFHAFHQDLHFVRKFLKPLLIGELAPEE
FT                   PSQDGAQNAQLIEDFRALRQAAEDMKLFEADTTFFALLLGHILAMELLAWLIIYLLGPG
FT                   WVSSILAALILAISQAQCWCLQHDLGHASIFTKSRWNHVAQQFVMGQLKGFSAHWWNFR
FT                   HFQHHAKPNIFHKDPDVTVAPVFLLGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTL
FT                   VNFEVENLAYMLVCMQWTDLLWAASFYSRFFLSYSPFYGATGTLLLFVAVRVLESHWFV
FT                   WITQMNHIPKEIGHEKHRDWASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRH
FT                   NYRRVAPLVKAFCAKHGLHYEVKPFLTALVDIIGSLKKSGDIWLDAYLHQ"
FT   assembly_gap    416184..416203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(419101..458841)
FT                   /gene="Fads2"
FT                   /locus_tag="mCG_1947"
FT                   /note="gene_id=mCG1947.2"
FT   mRNA            complement(join(419101..419899,420271..420396,
FT                   421186..421265,421836..421932,422099..422196,
FT                   425858..425934,426150..426210,439875..440000,
FT                   446043..446144,446249..446446,449082..449192,
FT                   458561..458841))
FT                   /gene="Fads2"
FT                   /locus_tag="mCG_1947"
FT                   /product="fatty acid desaturase 2"
FT                   /note="gene_id=mCG1947.2 transcript_id=mCT8330.2 created on
FT                   30-SEP-2002"
FT   CDS             complement(join(419848..419899,420271..420396,
FT                   421186..421265,421836..421932,422099..422196,
FT                   425858..425934,426150..426210,439875..440000,
FT                   446043..446144,446249..446446,449082..449192,
FT                   458561..458767))
FT                   /codon_start=1
FT                   /gene="Fads2"
FT                   /locus_tag="mCG_1947"
FT                   /product="fatty acid desaturase 2"
FT                   /note="gene_id=mCG1947.2 transcript_id=mCT8330.2
FT                   protein_id=mCP9816.2"
FT                   /protein_id="EDL41338.1"
FT                   /translation="MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYN
FT                   VTKWSQRHPGGHRVIGHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRG
FT                   KSSQITEDFRALKKTAEDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLV
FT                   TAFVLATSQAQAGWLQHDYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHA
FT                   KPNIFHKDPDIKSLHVFVLGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQY
FT                   QIIMTMISRRDWVDLAWAISYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQM
FT                   NHLVMEIDLDHYRDWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKI
FT                   APLVKSLCAKHGIEYQEKPLLRALIDIVSSLKKSGELWLDAYLHK"
FT   assembly_gap    433451..433470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    474805..474905
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    503085..503104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    505756..505775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    518607..518671
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    535409..535467
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            540269..554209
FT                   /gene="Fads1"
FT                   /locus_tag="mCG_1956"
FT                   /note="gene_id=mCG1956.2"
FT   mRNA            join(540269..540597,542260..542370,543018..543215,
FT                   543711..543812,544088..544216,548775..548835,
FT                   550247..550323,551036..551133,551331..551427,
FT                   551653..551732,551824..551949,552206..554209)
FT                   /gene="Fads1"
FT                   /locus_tag="mCG_1956"
FT                   /product="fatty acid desaturase 1"
FT                   /note="gene_id=mCG1956.2 transcript_id=mCT8338.2 created on
FT                   24-DEC-2002"
FT   CDS             join(540385..540597,542260..542370,543018..543215,
FT                   543711..543812,544088..544216,548775..548835,
FT                   550247..550323,551036..551133,551331..551427,
FT                   551653..551732,551824..551949,552206..552257)
FT                   /codon_start=1
FT                   /gene="Fads1"
FT                   /locus_tag="mCG_1956"
FT                   /product="fatty acid desaturase 1"
FT                   /note="gene_id=mCG1956.2 transcript_id=mCT8338.2
FT                   protein_id=mCP9847.1"
FT                   /protein_id="EDL41339.1"
FT                   /translation="MAPDPVPTPGPASAQLRQTRYFTWEEVAQRSGREKERWLVIDRKV
FT                   YNISDFSRRHPGGSRVISHYAGQDATDPFVAFHINKGLVRKYMNSLLIGELAPEQPSFE
FT                   PTKNKALTDEFRELRATVERMGLMKANHLFFLVYLLHILLLDVAAWLTLWIFGTSLVPF
FT                   ILCAVLLSTVQAQAGWLQHDFGHLSVFGTSTWNHLLHHFVIGHLKGAPASWWNHMHFQH
FT                   HAKPNCFRKDPDINMHPLFFALGKVLPVELGREKKKHMPYNHQHKYFFLIGPPALLPLY
FT                   FQWYIFYFVVQRKKWVDLAWMLSFYARIFFTYMPLLGLKGFLGLFFIVRFLESNWFVWV
FT                   TQMNHIPMHIDHDRNVDWVSTQLQATCNVHQSAFNNWFSGHLNFQIEHHLFPTMPRHNY
FT                   HKVAPLVQSLCAKYGIKYESKPLLTAFADIVYSLKESGQLWLDAYLHQ"
FT   gene            complement(556474..>561266)
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /note="gene_id=mCG1942.3"
FT   mRNA            complement(join(556474..558432,561023..>561266))
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1,
FT                   transcript variant mCT194058"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT194058.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(556476..558432,561139..>561227))
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1,
FT                   transcript variant mCT194057"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT194057.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(556503..558432,561034..561209))
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1,
FT                   transcript variant mCT8324"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT8324.2 created on
FT                   30-SEP-2002"
FT   CDS             complement(join(557271..558432,561139..>561167))
FT                   /codon_start=1
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT194057.0
FT                   protein_id=mCP115021.0 isoform=CRA_a"
FT                   /protein_id="EDL41340.1"
FT                   /translation="LLKARALETGHCSCATMGIHGLAKLIADVAPSAIRENDIKSYFGR
FT                   KVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGK
FT                   PPQLKSGELAKRSERRAEAEKQLQQAQEAGMEEEVEKFTKRLVKVTKQHNDECKHLLSL
FT                   MGIPYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQE
FT                   FHLSRVLQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDP
FT                   SKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSG
FT                   VKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGPAKKKAKTGGAGKFRRGK"
FT   CDS             complement(join(557271..558432,561023..>561159))
FT                   /codon_start=1
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT194058.0
FT                   protein_id=mCP115022.0 isoform=CRA_b"
FT                   /protein_id="EDL41341.1"
FT                   /translation="GSCTRDGVRSRGSVSESGRAAGTAPGSPGLGHSLCSEHSSSPVGR
FT                   SHCSCATMGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDV
FT                   LQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQL
FT                   QQAQEAGMEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAG
FT                   KVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQEQFVDLCIL
FT                   LGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEAQQLFLEPEV
FT                   LDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVT
FT                   GSLSSAKRKEPEPKGPAKKKAKTGGAGKFRRGK"
FT   CDS             complement(557271..558413)
FT                   /codon_start=1
FT                   /gene="Fen1"
FT                   /locus_tag="mCG_1942"
FT                   /product="flap structure specific endonuclease 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1942.3 transcript_id=mCT8324.2
FT                   protein_id=mCP9829.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q91Z50"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="MGI:MGI:102779"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Z50"
FT                   /protein_id="EDL41342.1"
FT                   /translation="MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIA
FT                   VRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERR
FT                   AEAEKQLQQAQEAGMEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASC
FT                   AALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQEQ
FT                   FVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEAQQ
FT                   LFLEPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRL
FT                   DDFFKVTGSLSSAKRKEPEPKGPAKKKAKTGGAGKFRRGK"
FT   gene            561348..565151
FT                   /locus_tag="mCG_1963"
FT                   /note="gene_id=mCG1963.2"
FT   mRNA            join(561348..561600,563760..563869,564500..564636,
FT                   565053..565151)
FT                   /locus_tag="mCG_1963"
FT                   /product="mCG1963, transcript variant mCT8344"
FT                   /note="gene_id=mCG1963.2 transcript_id=mCT8344.2 created on
FT                   25-OCT-2002"
FT   mRNA            join(561349..561600,563760..564166)
FT                   /locus_tag="mCG_1963"
FT                   /product="mCG1963, transcript variant mCT174034"
FT                   /note="gene_id=mCG1963.2 transcript_id=mCT174034.0 created
FT                   on 25-OCT-2002"
FT   CDS             join(561598..561600,563760..563869,564500..564626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1963"
FT                   /product="mCG1963, isoform CRA_b"
FT                   /note="gene_id=mCG1963.2 transcript_id=mCT8344.2
FT                   protein_id=mCP9890.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q60FD1"
FT                   /db_xref="InterPro:IPR007915"
FT                   /db_xref="MGI:MGI:1916288"
FT                   /db_xref="UniProtKB/TrEMBL:Q60FD1"
FT                   /protein_id="EDL41344.1"
FT                   /translation="MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTK
FT                   YTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV"
FT   CDS             join(561598..561600,563760..563903)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1963"
FT                   /product="mCG1963, isoform CRA_a"
FT                   /note="gene_id=mCG1963.2 transcript_id=mCT174034.0
FT                   protein_id=mCP96953.0 isoform=CRA_a"
FT                   /protein_id="EDL41343.1"
FT                   /translation="MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYPLFAAR
FT                   RQN"
FT   gene            complement(565606..598161)
FT                   /locus_tag="mCG_118536"
FT                   /note="gene_id=mCG118536.0"
FT   mRNA            complement(join(565606..567801,567935..568009,
FT                   569778..569865,572353..572438,573035..573146,
FT                   573397..573485,573756..573828,573999..574159,
FT                   574801..574910,575529..575640,575845..576045,
FT                   576419..576509,576903..577013,577176..577248,
FT                   578567..578754,580498..580621,580698..580948,
FT                   586068..586331,586435..586522,597969..598161))
FT                   /locus_tag="mCG_118536"
FT                   /product="mCG118536"
FT                   /note="gene_id=mCG118536.0 transcript_id=mCT119693.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(567721..567801,567935..568009,
FT                   569778..569865,572353..572438,573035..573146,
FT                   573397..573485,573756..573828,573999..574159,
FT                   574801..574910,575529..575640,575845..576045,
FT                   576419..576509,576903..577013,577176..577248,
FT                   578567..578754,580498..580621,580698..580948,
FT                   586068..586331,586435..586522,597969..598014))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118536"
FT                   /product="mCG118536"
FT                   /note="gene_id=mCG118536.0 transcript_id=mCT119693.0
FT                   protein_id=mCP64510.1"
FT                   /protein_id="EDL41345.1"
FT                   /translation="MEVVDETEALQRFFEGHDISGALEPSNIDTSILEEYIGKEDASDL
FT                   CFPEISAPASTASFPHGPPAIPGSSGLHHLSPPGSGPSPGRHGPLPPPTYGTPLNCNNN
FT                   NGMGTAPKPFLGGSGPPIKAEPKAPYAPGLPPHPSKKRKHSESPPNTLNAQMLNGMIKQ
FT                   EPGTVTALPPHPARAPSPPWPPQGPLSPGTGSLPLSIARAQTPPWHPPGAPSPGLLQDS
FT                   DSLSGSYLDPNYQSIKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFV
FT                   CQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHEALNQSINIEQSQSDRSKRP
FT                   FNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNY
FT                   TLAAQISERIIVRASNPGQFESDSDVLWQRAQLPDTVFHHGRVGINTDRPDEALVVHGN
FT                   VKVMGSLMHPSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETG
FT                   VIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKELCKLTDNLET
FT                   RIDELERWSHKLAKLRRLDSLKSTGSSGAFSHAGSQFSRAGSVPHKKRPPKLANKSSPA
FT                   VPDQACISQRFLQGTIIALVVVMAFSVVSMSTLYVLSLRSEEDLVDADGYVHGDGVIVK
FT                   PSGPVQPELRDHTAPTVLHDHRTTRHTALFAAGPSAIPDLHPAAGEFHAYHFSVLCARR
FT                   CLQGTSHQWPVTILSFREFTYHFRVTLLGQANCSSEAIVQPATDYYFHFYRLCD"
FT   assembly_gap    573857..573876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    582809..582969
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(604695..613649)
FT                   /locus_tag="mCG_1944"
FT                   /note="gene_id=mCG1944.1"
FT   mRNA            complement(join(604695..606036,607781..607968,
FT                   608479..608608,609451..609650,610742..610814,
FT                   611129..611197,612223..612365,613077..613157,
FT                   613540..613649))
FT                   /locus_tag="mCG_1944"
FT                   /product="mCG1944"
FT                   /note="gene_id=mCG1944.1 transcript_id=mCT8326.1 created on
FT                   30-SEP-2002"
FT   CDS             complement(join(605076..606036,607781..607968,
FT                   608479..608608,609451..609650,610742..610814,
FT                   611129..611197,612223..612365,613077..613154))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1944"
FT                   /product="mCG1944"
FT                   /note="gene_id=mCG1944.1 transcript_id=mCT8326.1
FT                   protein_id=mCP9807.1"
FT                   /protein_id="EDL41346.1"
FT                   /translation="MVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAG
FT                   TAAILSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLE
FT                   GFRRQLLDVLQRSTKPKWRIIVGATKCIPKSELPEDQVEVTTLASTRLWTHPSDLTIAL
FT                   SASTPLYPPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLP
FT                   YVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPLPTGLAL
FT                   ELPATEHRNSSVRSKSQSEMSLEGFSEGRLLSPVAAASAARQDPVELLLLSTQERLAAE
FT                   LQSRRAPLATMESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIP
FT                   EENPSLSSRTELLAADSLSKHSQDTQPLEAALGSGGVTPERPPSATIEEEEAAGGSEGG
FT                   GVAPRGELALHNGRLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMMVPESPTSDY
FT                   TEGPKSPSQQEILLRAQFEPNLVPKPPRLFAGSAEPSSGISLSPSFPLSSSGELMDLTP
FT                   TGLSSQECLATDKIRTSTPTGHGASPTKQDDLVISAR"
FT   gene            complement(<619910..>662049)
FT                   /locus_tag="mCG_118525"
FT                   /note="gene_id=mCG118525.0"
FT   mRNA            complement(join(<619910..619987,620510..620644,
FT                   622424..622511,626607..626745,627137..627238,
FT                   628408..628619,628914..629019,661995..>662049))
FT                   /locus_tag="mCG_118525"
FT                   /product="mCG118525"
FT                   /note="gene_id=mCG118525.0 transcript_id=mCT119687.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(<619910..619987,620510..620644,
FT                   622424..622511,626607..626745,627137..627238,
FT                   628408..628619,628914..629019,661995..662049))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118525"
FT                   /product="mCG118525"
FT                   /note="gene_id=mCG118525.0 transcript_id=mCT119687.0
FT                   protein_id=mCP64465.0"
FT                   /protein_id="EDL41347.1"
FT                   /translation="MEVAVAVAAAGRALRRAGELPAMPGIVVFRRRWSVGSDDLVLPAI
FT                   FLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGRGYLGILLSCMIAEMAIIWLSMR
FT                   GGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVC
FT                   NWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKV
FT                   FLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQRQRAKRNAVLDEAN
FT                   NDILAFLSGMPVTRNTKYLDLKNS"
FT   gene            648103..650606
FT                   /locus_tag="mCG_148456"
FT                   /note="gene_id=mCG148456.0"
FT   mRNA            join(648103..648757,648882..650606)
FT                   /locus_tag="mCG_148456"
FT                   /product="mCG148456"
FT                   /note="gene_id=mCG148456.0 transcript_id=mCT188719.0
FT                   created on 13-JAN-2004"
FT   CDS             649549..650196
FT                   /codon_start=1
FT                   /locus_tag="mCG_148456"
FT                   /product="mCG148456"
FT                   /note="gene_id=mCG148456.0 transcript_id=mCT188719.0
FT                   protein_id=mCP109155.0"
FT                   /protein_id="EDL41348.1"
FT                   /translation="MVSRHGGLDSRQPATIKPFSRGPATTQRCTASSWNGEERSSQATE
FT                   TAQKTRPYSWNSPRDQSRARGARVTFRLLLPRSLETETWSLSRHTAMAEITQLWVLPCQ
FT                   KCHSSLIYSTITSLAQPMSPDSGVYLGHLMENELTVPLKPCKLGVRGLLDVSSPLSLCS
FT                   RQLSLPSLEETEKQEGDKLSLDQNDRQGAPGPGEDEGTWTRLLQPECHSPGR"
FT   assembly_gap    712211..712656
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    719094..719156
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    729611..729869
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    734200..734219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    736115..736134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    746528..747290
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   assembly_gap    753094..753176
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <770950..>806049
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /note="gene_id=mCG1938.1"
FT   mRNA            join(<770950..771062,775552..775631,779347..779478,
FT                   793141..793276,796742..797012,800435..800604,
FT                   800984..801098,801592..801791,805945..>806049)
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, transcript variant mCT194019"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT194019.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<770950..771062,775552..775631,783890..784053,
FT                   784202..784258,787929..788051,793141..793276,
FT                   796742..797012,800435..800604,800984..801098,
FT                   801592..801791,805945..>806049)
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, transcript variant mCT194018"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT194018.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(770950..771062,775552..775631,793141..793276,
FT                   796742..797012,800435..800604,800984..801098,
FT                   801592..801791,805945..>806049)
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, transcript variant mCT8320"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT8320.0 created on
FT                   01-OCT-2002"
FT   CDS             join(<770952..771062,775552..775631,779347..779478,
FT                   793141..793276,796742..797012,800435..800604,
FT                   800984..801098,801592..801791,805945..806049)
FT                   /codon_start=1
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, isoform CRA_b"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT194019.0
FT                   protein_id=mCP115020.0 isoform=CRA_b"
FT                   /protein_id="EDL41350.1"
FT                   /translation="SSGAPTRDVLLVSAIITVSLSVTIVLCGLCHWCQRKLGKRYKNSL
FT                   ETVGTPDSGRGRGEKKAINDLDRDFWNNNESTVQQKWSSYPPKEFILNISPYAPYGDPR
FT                   LSLKLPAGGKAVNTAPVPGQTPHDESDRRTETRSSVSDLVNSLTSEMLMLSPGSEEDEA
FT                   HEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHK
FT                   LETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV
FT                   DLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDP
FT                   YVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSR
FT                   NDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA"
FT   CDS             join(<783929..784053,784202..784258,787929..788051,
FT                   793141..793276,796742..797012,800435..800604,
FT                   800984..801098,801592..801791,805945..806049)
FT                   /codon_start=1
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, isoform CRA_a"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT194018.0
FT                   protein_id=mCP115019.0 isoform=CRA_a"
FT                   /protein_id="EDL41349.1"
FT                   /translation="VYPQLRGRAEMPATPHTDAAAEPAAAAEPEPAGPAAQSAHHHWDH
FT                   VVGQIRNRGLDMKSFLEGRMVVLSLVLGLSEQDDFANIPDLQNPGTQQNQNAQGDKRLP
FT                   AGGKAVNTAPVPGQTPHDESDRRTETRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSR
FT                   ENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVK
FT                   RKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQ
FT                   TFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWL
FT                   MYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGK
FT                   IYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA"
FT   CDS             join(793268..793276,796742..797012,800435..800604,
FT                   800984..801098,801592..801791,805945..806049)
FT                   /codon_start=1
FT                   /gene="Syt7"
FT                   /locus_tag="mCG_1938"
FT                   /product="synaptotagmin VII, isoform CRA_c"
FT                   /note="gene_id=mCG1938.1 transcript_id=mCT8320.0
FT                   protein_id=mCP9818.1 isoform=CRA_c"
FT                   /protein_id="EDL41351.1"
FT                   /translation="MLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKA
FT                   QELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRV
FT                   LYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYN
FT                   PSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNES
FT                   FAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPV
FT                   AQWHQLKA"
FT   assembly_gap    806983..807375
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            809753..810928
FT                   /locus_tag="mCG_1045154"
FT                   /note="gene_id=mCG1045154.1"
FT   mRNA            809753..810928
FT                   /locus_tag="mCG_1045154"
FT                   /product="mCG1045154"
FT                   /note="gene_id=mCG1045154.1 transcript_id=mCT162858.1
FT                   created on 19-DEC-2002"
FT   CDS             809912..810067
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045154"
FT                   /product="mCG1045154"
FT                   /note="gene_id=mCG1045154.1 transcript_id=mCT162858.1
FT                   protein_id=mCP64248.1"
FT                   /protein_id="EDL41352.1"
FT                   /translation="MWLWQAMPFAVLSMSSIHKEAIIFQPLPALSRAAGLPVLRVLQKA
FT                   NHICFR"
FT   gene            complement(813844..>815070)
FT                   /locus_tag="mCG_51226"
FT                   /note="gene_id=mCG51226.1"
FT   mRNA            complement(813844..>815070)
FT                   /locus_tag="mCG_51226"
FT                   /product="mCG51226"
FT                   /note="gene_id=mCG51226.1 transcript_id=mCT51409.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(814192..815070)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51226"
FT                   /product="mCG51226"
FT                   /note="gene_id=mCG51226.1 transcript_id=mCT51409.2
FT                   protein_id=mCP32012.0"
FT                   /db_xref="GOA:G3XA50"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2685551"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA50"
FT                   /protein_id="EDL41353.1"
FT                   /translation="MGIAESTPDELPSDAEEQLRSGEQQLELSGRRLRRLPSAVCALSR
FT                   LQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLA
FT                   LPPDFAQLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRG
FT                   LWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPPRV
FT                   ADTVFLVGEGAVERMAERDEPIPRQPARRPTRAFDDEEEEDLLIGGAGPRALGPTRDSL
FT                   RALEAPPGLGT"
FT   assembly_gap    815203..815223
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    819286..819372
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    829235..829979
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   gene            complement(831616..>840315)
FT                   /gene="4930579J09Rik"
FT                   /locus_tag="mCG_118527"
FT                   /note="gene_id=mCG118527.1"
FT   mRNA            complement(join(831616..831709,831871..831949,
FT                   832312..832482,834409..834503,834586..834699,
FT                   834906..834992,835096..835155,835578..835690,
FT                   836006..836069,836854..836982,838669..838822,
FT                   839088..839205,839618..839753,840214..840315))
FT                   /gene="4930579J09Rik"
FT                   /locus_tag="mCG_118527"
FT                   /product="RIKEN cDNA 4930579J09, transcript variant
FT                   mCT119688"
FT                   /note="gene_id=mCG118527.1 transcript_id=mCT119688.1
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(831620..831705,831871..831949,
FT                   832312..832482,834409..834503,834586..834699,
FT                   834906..834992,835096..835155,835578..835690,
FT                   836006..836069,836854..836982,838669..838822,
FT                   839088..839205,839618..839753,840214..>840315))
FT                   /gene="4930579J09Rik"
FT                   /locus_tag="mCG_118527"
FT                   /product="RIKEN cDNA 4930579J09, transcript variant
FT                   mCT194082"
FT                   /note="gene_id=mCG118527.1 transcript_id=mCT194082.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(831880..831949,832312..832482,
FT                   834409..834503,834586..834699,834906..834992,
FT                   835096..835155,835578..835690,836006..836069,
FT                   836854..836982,838669..838822,839088..839205,
FT                   839618..839753,840214..>840264))
FT                   /codon_start=1
FT                   /gene="4930579J09Rik"
FT                   /locus_tag="mCG_118527"
FT                   /product="RIKEN cDNA 4930579J09, isoform CRA_b"
FT                   /note="gene_id=mCG118527.1 transcript_id=mCT194082.0
FT                   protein_id=mCP115042.0 isoform=CRA_b"
FT                   /protein_id="EDL41355.1"
FT                   /translation="AAPASCGLCRPQSLLQRARGAPASHIMMGKLPLGVVSPYVKMSSG
FT                   GCSDPLKFYATSYCTAYGREEFKPRLGSHVGTGYKSNYRPLVSYQPHLDTLDNPAIGQQ
FT                   IRDTSKSVTSQSYSPLEVPDGKQPLPWNLHQTTSSYGREKLNPGPHSKEVRKVHFDTQD
FT                   HGPQTITGLEPKEVPLIHQQQGKGSTEWENSHYGPRFMTSEYNSKYIKESPNHPDLLLK
FT                   KTIGSKEETGFTEESTKNPIVFQPPSQAFPGDPVLHPGRSITKSDYLPVTHPQGSDFLP
FT                   VLSRGSDRDTGFSRVNERTLNPRVPTPAPQPASMSHRSYQPPQRMQQTNVALLGRESVG
FT                   NKEPTGFTLNNPSYVRSSYEQDRDQRYLTTYNQGYFENIPKGLDREGWTRGGIQPQKAG
FT                   AYALSELNNHTLMDSTPNPTETLRHLHPHVGRTLASVDPFYRDMPHSSRYPASS"
FT   CDS             complement(join(831880..831949,832312..832482,
FT                   834409..834503,834586..834699,834906..834992,
FT                   835096..835155,835578..835690,836006..836069,
FT                   836854..836982,838669..838822,839088..839205,
FT                   839618..839726))
FT                   /codon_start=1
FT                   /gene="4930579J09Rik"
FT                   /locus_tag="mCG_118527"
FT                   /product="RIKEN cDNA 4930579J09, isoform CRA_a"
FT                   /note="gene_id=mCG118527.1 transcript_id=mCT119688.1
FT                   protein_id=mCP64042.1 isoform=CRA_a"
FT                   /protein_id="EDL41354.1"
FT                   /translation="MMGKLPLGVVSPYVKMSSGGCSDPLKFYATSYCTAYGREEFKPRL
FT                   GSHVGTGYKSNYRPLVSYQPHLDTLDNPAIGQQIRDTSKSVTSQSYSPLEVPDGKQPLP
FT                   WNLHQTTSSYGREKLNPGPHSKEVRKVHFDTQDHGPQTITGLEPKEVPLIHQQQGKGST
FT                   EWENSHYGPRFMTSEYNSKYIKESPNHPDLLLKKTIGSKEETGFTEESTKNPIVFQPPS
FT                   QAFPGDPVLHPGRSITKSDYLPVTHPQGSDFLPVLSRGSDRDTGFSRVNERTLNPRVPT
FT                   PAPQPASMSHRSYQPPQRMQQTNVALLGRESVGNKEPTGFTLNNPSYVRSSYEQDRDQR
FT                   YLTTYNQGYFENIPKGLDREGWTRGGIQPQKAGAYALSELNNHTLMDSTPNPTETLRHL
FT                   HPHVGRTLASVDPFYRDMPHSSRYPASS"
FT   gene            complement(858905..>882304)
FT                   /gene="0610038F07Rik"
FT                   /locus_tag="mCG_146177"
FT                   /note="gene_id=mCG146177.0"
FT   mRNA            complement(join(858905..860396,874177..874286,
FT                   874366..874583,882249..>882304))
FT                   /gene="0610038F07Rik"
FT                   /locus_tag="mCG_146177"
FT                   /product="RIKEN cDNA 0610038F07, transcript variant
FT                   mCT186280"
FT                   /note="gene_id=mCG146177.0 transcript_id=mCT186280.0
FT                   created on 14-JUL-2003"
FT   mRNA            complement(join(859615..860396,874177..874583,
FT                   882249..>882287))
FT                   /gene="0610038F07Rik"
FT                   /locus_tag="mCG_146177"
FT                   /product="RIKEN cDNA 0610038F07, transcript variant
FT                   mCT194060"
FT                   /note="gene_id=mCG146177.0 transcript_id=mCT194060.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(860266..860396,874177..874286,
FT                   874366..874583,882249..>882302))
FT                   /codon_start=1
FT                   /gene="0610038F07Rik"
FT                   /locus_tag="mCG_146177"
FT                   /product="RIKEN cDNA 0610038F07, isoform CRA_a"
FT                   /note="gene_id=mCG146177.0 transcript_id=mCT186280.0
FT                   protein_id=mCP107443.0 isoform=CRA_a"
FT                   /protein_id="EDL41356.1"
FT                   /translation="LCYKREMAVVTLIPTLARALSKHSLLSPLPSVTSFRRFYRGDSPT
FT                   DSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEK
FT                   QLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDLE
FT                   YLFEKPH"
FT   CDS             complement(join(860266..860396,874177..>874435))
FT                   /codon_start=1
FT                   /gene="0610038F07Rik"
FT                   /locus_tag="mCG_146177"
FT                   /product="RIKEN cDNA 0610038F07, isoform CRA_b"
FT                   /note="gene_id=mCG146177.0 transcript_id=mCT194060.0
FT                   protein_id=mCP115016.0 isoform=CRA_b"
FT                   /protein_id="EDL41357.1"
FT                   /translation="KPKEPAYSMRAERGGCWRTAFSLGSGAEGSGCHFSLTRQSCQPHF
FT                   PSHFSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMELLR
FT                   EFAKNKNKEQRLRAPDLEYLFEKPH"
FT   assembly_gap    882439..882521
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <882566..896146
FT                   /locus_tag="mCG_145657"
FT                   /note="gene_id=mCG145657.0"
FT   mRNA            join(<882566..882629,883254..883362,889081..889299,
FT                   890120..890223,890593..890765,892404..892818,
FT                   894105..896146)
FT                   /locus_tag="mCG_145657"
FT                   /product="mCG145657"
FT                   /note="gene_id=mCG145657.0 transcript_id=mCT185081.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<882568..882629,883254..883362,889081..889299,
FT                   890120..890223,890593..890765,892404..892818,
FT                   894105..894246)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145657"
FT                   /product="mCG145657"
FT                   /note="gene_id=mCG145657.0 transcript_id=mCT185081.0
FT                   protein_id=mCP105530.0"
FT                   /protein_id="EDL41358.1"
FT                   /translation="GERFARFGPSRDSPRPPPYSRGIFLTLSVLRARERISGAMSEGVD
FT                   LIDIYADEEFNQDSEFNNTDQIDLYDDVLTAASQPSDDRSSSTEPPPPVRQEPAPKPNN
FT                   KTPAILYTYSGLRSRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQS
FT                   KGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRG
FT                   GIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPPPI
FT                   PPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPNA
FT                   TVGPPPDTYMKASTPYNHHGSRDSGPPPSTVSEAEFEEIMKRNRAISSSAISKAVSGAS
FT                   AGNKLLLY"
FT   gene            complement(888622..900232)
FT                   /locus_tag="mCG_148492"
FT                   /note="gene_id=mCG148492.0"
FT   mRNA            complement(join(888622..888662,899029..900232))
FT                   /locus_tag="mCG_148492"
FT                   /product="mCG148492"
FT                   /note="gene_id=mCG148492.0 transcript_id=mCT188755.0
FT                   created on 13-JAN-2004"
FT   gene            complement(891165..913547)
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /note="gene_id=mCG1958.2"
FT   mRNA            complement(join(891165..891255,896960..897124,
FT                   908265..908347,909080..909281,911836..911928,
FT                   912370..912471,913006..913044))
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, transcript variant
FT                   mCT175265"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT175265.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(896709..897124,908265..908347,
FT                   909080..909281,911836..911928,912370..912471,
FT                   913020..913056))
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, transcript variant
FT                   mCT174032"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT174032.0 created
FT                   on 25-OCT-2002"
FT   gene            897979..905037
FT                   /locus_tag="mCG_148454"
FT                   /note="gene_id=mCG148454.0"
FT   mRNA            join(897979..898154,902999..905037)
FT                   /locus_tag="mCG_148454"
FT                   /product="mCG148454"
FT                   /note="gene_id=mCG148454.0 transcript_id=mCT188717.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(899276..899416)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148492"
FT                   /product="mCG148492"
FT                   /note="gene_id=mCG148492.0 transcript_id=mCT188755.0
FT                   protein_id=mCP109191.0"
FT                   /protein_id="EDL41359.1"
FT                   /translation="MLSCLLGGCLYVEFYRLCKRFEFTKTYENAQEVKVSSLPHPVSIH
FT                   S"
FT   CDS             903376..903771
FT                   /codon_start=1
FT                   /locus_tag="mCG_148454"
FT                   /product="mCG148454"
FT                   /note="gene_id=mCG148454.0 transcript_id=mCT188717.0
FT                   protein_id=mCP109153.0"
FT                   /protein_id="EDL41364.1"
FT                   /translation="MWDCRKVTGCAKNAQGSALNTIFDGAKRVQTLLTYHFIQLLYFPS
FT                   RLRRDHENRNYLVTRQVFSVFSSHIDGLFPWPPRRLNPFDSLLSDSSVDLFLQSRTREV
FT                   AICQKPRPARYHHLLLQACLPVVITSS"
FT   mRNA            complement(join(907773..908347,909080..909281,
FT                   911836..911928,912370..912471,913422..913547))
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, transcript variant
FT                   mCT8340"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT8340.2 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(907773..908347,909080..909281,
FT                   911836..911928,912370..912471,913006..913060))
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, transcript variant
FT                   mCT175264"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT175264.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(908332..908347,909080..909281,
FT                   911836..911881))
FT                   /codon_start=1
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, isoform CRA_a"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT174032.0
FT                   protein_id=mCP96951.0 isoform=CRA_a"
FT                   /protein_id="EDL41360.1"
FT                   /translation="MLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYY
FT                   LLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMDRI"
FT   CDS             complement(join(908332..908347,909080..909281,
FT                   911836..911881))
FT                   /codon_start=1
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, isoform CRA_a"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT175265.0
FT                   protein_id=mCP98184.0 isoform=CRA_a"
FT                   /protein_id="EDL41361.1"
FT                   /translation="MLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYY
FT                   LLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMDRI"
FT   CDS             complement(join(908332..908347,909080..909281,
FT                   911836..911881))
FT                   /codon_start=1
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, isoform CRA_a"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT175264.0
FT                   protein_id=mCP98183.0 isoform=CRA_a"
FT                   /protein_id="EDL41362.1"
FT                   /translation="MLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYY
FT                   LLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMDRI"
FT   CDS             complement(join(908332..908347,909080..909281,
FT                   911836..911881))
FT                   /codon_start=1
FT                   /gene="2810441K11Rik"
FT                   /locus_tag="mCG_1958"
FT                   /product="RIKEN cDNA 2810441K11, isoform CRA_a"
FT                   /note="gene_id=mCG1958.2 transcript_id=mCT8340.2
FT                   protein_id=mCP9885.2 isoform=CRA_a"
FT                   /protein_id="EDL41363.1"
FT                   /translation="MLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYY
FT                   LLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMDRI"
FT   assembly_gap    915682..915870
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            complement(927785..934682)
FT                   /gene="Tmem138"
FT                   /locus_tag="mCG_1955"
FT                   /note="gene_id=mCG1955.2"
FT   mRNA            complement(join(927785..928572,928833..928908,
FT                   932139..932310,932542..932813,934383..934682))
FT                   /gene="Tmem138"
FT                   /locus_tag="mCG_1955"
FT                   /product="transmembrane protein 138, transcript variant
FT                   mCT8337"
FT                   /note="gene_id=mCG1955.2 transcript_id=mCT8337.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(927804..928572,928833..928908,
FT                   932139..932310,932542..932813,934268..934389))
FT                   /gene="Tmem138"
FT                   /locus_tag="mCG_1955"
FT                   /product="transmembrane protein 138, transcript variant
FT                   mCT174031"
FT                   /note="gene_id=mCG1955.2 transcript_id=mCT174031.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(928460..928572,928833..928908,
FT                   932139..932310,932542..932669))
FT                   /codon_start=1
FT                   /gene="Tmem138"
FT                   /locus_tag="mCG_1955"
FT                   /product="transmembrane protein 138, isoform CRA_a"
FT                   /note="gene_id=mCG1955.2 transcript_id=mCT174031.0
FT                   protein_id=mCP96950.0 isoform=CRA_a"
FT                   /protein_id="EDL41365.1"
FT                   /translation="MLQTGNYSLVLSLQFLLLSYDLFVNSFSELLRMAPVIQLVLFIIQ
FT                   DIAILFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTSVYLALSISLHVWVMNVRW
FT                   KNSSSFSWTNGLQTLFVFQRLAAVLYCYFYKRTAVRLGDPRFYQDSLWLRKEFMQVRR"
FT   CDS             complement(join(928460..928572,928833..928908,
FT                   932139..932310,932542..932669))
FT                   /codon_start=1
FT                   /gene="Tmem138"
FT                   /locus_tag="mCG_1955"
FT                   /product="transmembrane protein 138, isoform CRA_a"
FT                   /note="gene_id=mCG1955.2 transcript_id=mCT8337.2
FT                   protein_id=mCP9880.2 isoform=CRA_a"
FT                   /protein_id="EDL41366.1"
FT                   /translation="MLQTGNYSLVLSLQFLLLSYDLFVNSFSELLRMAPVIQLVLFIIQ
FT                   DIAILFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTSVYLALSISLHVWVMNVRW
FT                   KNSSSFSWTNGLQTLFVFQRLAAVLYCYFYKRTAVRLGDPRFYQDSLWLRKEFMQVRR"
FT   gene            934601..947420
FT                   /gene="Cybasc3"
FT                   /locus_tag="mCG_1957"
FT                   /note="gene_id=mCG1957.1"
FT   mRNA            join(934601..934982,939612..939795,942584..942792,
FT                   944093..944247,945219..945375,946526..947420)
FT                   /gene="Cybasc3"
FT                   /locus_tag="mCG_1957"
FT                   /product="cytochrome b, ascorbate dependent 3, transcript
FT                   variant mCT8339"
FT                   /note="gene_id=mCG1957.1 transcript_id=mCT8339.1 created on
FT                   01-OCT-2002"
FT   CDS             join(934755..934982,939612..939795,942584..942792,
FT                   944093..944247,945219..945375,946526..946594)
FT                   /codon_start=1
FT                   /gene="Cybasc3"
FT                   /locus_tag="mCG_1957"
FT                   /product="cytochrome b, ascorbate dependent 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1957.1 transcript_id=mCT8339.1
FT                   protein_id=mCP9824.2 isoform=CRA_b"
FT                   /protein_id="EDL41368.1"
FT                   /translation="MPWSADLLESQFSEVQEEPREWQLSLTGGSQRPAPKVSHCVAKGG
FT                   IEPGLGEPGYGFQWWFRRFLASLCLTSAFSLMASGWFYLSCMVLGSLGSMCILFTAYWM
FT                   QYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALH
FT                   LLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQ
FT                   WLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYSSLPGEAVFANSTGL
FT                   LVVAFGLLVLYVLLASSWKRPDPGALTDRQLLLQLLPGSRPFPVTYMPVPLR"
FT   mRNA            join(<935022..935382,936281..936373,937762..937861,
FT                   939597..939795,942584..942792,944093..944247,
FT                   945219..945375,945922..947226)
FT                   /gene="Cybasc3"
FT                   /locus_tag="mCG_1957"
FT                   /product="cytochrome b, ascorbate dependent 3, transcript
FT                   variant mCT194098"
FT                   /note="gene_id=mCG1957.1 transcript_id=mCT194098.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<937784..937861,939597..939795,942584..942792,
FT                   944093..944247,945219..945375,945922..945945)
FT                   /codon_start=1
FT                   /gene="Cybasc3"
FT                   /locus_tag="mCG_1957"
FT                   /product="cytochrome b, ascorbate dependent 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1957.1 transcript_id=mCT194098.0
FT                   protein_id=mCP115077.0 isoform=CRA_a"
FT                   /protein_id="EDL41367.1"
FT                   /translation="VFSSGCSDGENQRSGHLSVSLQLSLKVLLIRMASGWFYLSCMVLG
FT                   SLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWV
FT                   GPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQW
FT                   FLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYS
FT                   SLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHDRE"
FT   assembly_gap    941270..941800
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   gene            complement(949591..962451)
FT                   /gene="Dak"
FT                   /locus_tag="mCG_1941"
FT                   /note="gene_id=mCG1941.2"
FT   mRNA            complement(join(949591..950184,950542..950631,
FT                   950721..950754,950859..950962,951065..951171,
FT                   951826..951963,952098..952217,952689..952805,
FT                   953407..953496,953593..953677,953753..953787,
FT                   954327..954416,954705..954783,956427..956608,
FT                   956703..956813,957966..958155,961562..961667,
FT                   962335..962451))
FT                   /gene="Dak"
FT                   /locus_tag="mCG_1941"
FT                   /product="dihydroxyacetone kinase 2 homolog (yeast)"
FT                   /note="gene_id=mCG1941.2 transcript_id=mCT8323.2 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(950023..950184,950542..950631,
FT                   950721..950754,950859..950962,951065..951171,
FT                   951826..951963,952098..952217,952689..952805,
FT                   953407..953496,953593..953677,953753..953787,
FT                   954327..954416,954705..954783,956427..956608,
FT                   956703..956813,957966..958155,961562..961564))
FT                   /codon_start=1
FT                   /gene="Dak"
FT                   /locus_tag="mCG_1941"
FT                   /product="dihydroxyacetone kinase 2 homolog (yeast)"
FT                   /note="gene_id=mCG1941.2 transcript_id=mCT8323.2
FT                   protein_id=mCP9809.2"
FT                   /protein_id="EDL41369.1"
FT                   /translation="MSSKKMVNSVEGCADDALAGLVASNPDLQLLQGHRVALRSDLDTL
FT                   KGRVALLSGGGSGHEPAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGT
FT                   LLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDDSAFTVLKKAGRRGLCGTVLIHKV
FT                   AGALAEEGMGLEEITKRVSVIAKTMGTLGVSLSSCSVPGATHTFELAADEIELGLGIHG
FT                   EAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIA
FT                   DAAIRLLEGRGVKVARALVGTFMSALEMPGVSLTLMLVDEPVLKLIDAETTAKAWPHMA
FT                   KVSVTGRKRIRAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAA
FT                   GDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLSRLSVLLLERMGGSSGALYGLFLTAA
FT                   AQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWKSPGASLL
FT                   PVLTKAVKSAEAAAEATKNMEAGAGRASYISSAQLDQPDPGAVAAAAIFRAILEVLQTQ
FT                   GA"
FT   gene            963019..987223
FT                   /gene="Ddb1"
FT                   /locus_tag="mCG_1935"
FT                   /note="gene_id=mCG1935.1"
FT   mRNA            join(963019..963160,964239..964387,965187..965303,
FT                   965645..965866,968094..968208,969036..969133,
FT                   970265..970423,971500..971583,972244..972360,
FT                   972880..972982,976452..976527,976623..976731,
FT                   978944..979122,979224..979387,979465..979572,
FT                   979693..979900,980742..980837,980930..981041,
FT                   982127..982250,982570..982734,983299..983393,
FT                   983995..984165,984529..984639,984893..985062,
FT                   985166..985268,985829..985952,986483..987223)
FT                   /gene="Ddb1"
FT                   /locus_tag="mCG_1935"
FT                   /product="damage specific DNA binding protein 1"
FT                   /note="gene_id=mCG1935.1 transcript_id=mCT8317.1 created on
FT                   01-OCT-2002"
FT   CDS             join(963100..963160,964239..964387,965187..965303,
FT                   965645..965866,968094..968208,969036..969133,
FT                   970265..970423,971500..971583,972244..972360,
FT                   972880..972982,976452..976527,976623..976731,
FT                   978944..979122,979224..979387,979465..979572,
FT                   979693..979900,980742..980837,980930..981041,
FT                   982127..982250,982570..982734,983299..983393,
FT                   983995..984165,984529..984603)
FT                   /codon_start=1
FT                   /gene="Ddb1"
FT                   /locus_tag="mCG_1935"
FT                   /product="damage specific DNA binding protein 1"
FT                   /note="gene_id=mCG1935.1 transcript_id=mCT8317.1
FT                   protein_id=mCP9891.2"
FT                   /protein_id="EDL41370.1"
FT                   /translation="MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVT
FT                   AEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRA
FT                   HGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELH
FT                   VIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAV
FT                   PEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLF
FT                   MLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDS
FT                   NEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEH
FT                   ASIDLPGIKGLWPLRSDPGRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTF
FT                   FCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQGKNISVASCNSSQVVVAVGRALY
FT                   YLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFEL
FT                   LHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQP
FT                   TVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALA
FT                   NNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDSSGGTTALR
FT                   PSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEY
FT                   ALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVY
FT                   SMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSV
FT                   LLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFTGS"
FT   gene            991625..1024556
FT                   /locus_tag="mCG_1948"
FT                   /note="gene_id=mCG1948.2"
FT   mRNA            join(991625..991976,994534..994628,994727..994816,
FT                   995471..995599,999057..999173,1001578..1001694,
FT                   1002425..1002553,1003974..1004392,1004472..1004565,
FT                   1005937..1006019,1009949..1010036,1012439..1012524,
FT                   1013623..1013740,1014741..1014826,1015999..1016095,
FT                   1017388..1017470,1018903..1018993,1019070..1019152,
FT                   1019462..1019525,1023506..1024556)
FT                   /locus_tag="mCG_1948"
FT                   /product="mCG1948, transcript variant mCT8327"
FT                   /note="gene_id=mCG1948.2 transcript_id=mCT8327.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(991625..991976,994534..994628,994727..994816,
FT                   995471..995599,999057..999173,1001578..1001694,
FT                   1002425..1002553,1003974..1004392,1004472..1004565,
FT                   1005937..1006019,1009949..1010036,1012439..1012524,
FT                   1013623..1013740,1014741..1014806,1015999..1016095,
FT                   1017388..1017470,1018903..1018993,1019070..1019152,
FT                   1019462..1019525,1023506..1024556)
FT                   /locus_tag="mCG_1948"
FT                   /product="mCG1948, transcript variant mCT185200"
FT                   /note="gene_id=mCG1948.2 transcript_id=mCT185200.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(991867..991976,994534..994628,994727..994816,
FT                   995471..995599,999057..999173,1001578..1001694,
FT                   1002425..1002553,1003974..1004392,1004472..1004565,
FT                   1005937..1006019,1009949..1010036,1012439..1012524,
FT                   1013623..1013740,1014741..1014826,1015999..1016095,
FT                   1017388..1017470,1018903..1018993,1019070..1019152,
FT                   1019462..1019525,1023506..1024116)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1948"
FT                   /product="mCG1948, isoform CRA_b"
FT                   /note="gene_id=mCG1948.2 transcript_id=mCT8327.2
FT                   protein_id=mCP9820.3 isoform=CRA_b"
FT                   /protein_id="EDL41372.1"
FT                   /translation="MWARLLLHVAYILIPLLGSSARGYTGRKAPGHYSAERRRLGPHVC
FT                   LSGFGSGCCPGWAPSMGSGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPEAHGSC
FT                   GEYGCDLTCNHGGCQEVARVCPVGFLMTETAVGIRCADIDECLSSSCEGHCVNTEGGFV
FT                   CECGPGMQLSADRHSCQDTDECLGTPCQQRCKNSIGSYKCSCRAGFHLHGNRHSCIDVN
FT                   ECRRPQERRVCHHTCHNTVGSFLCTCRPGFRLRSDRVSCEAFPKAVLAPSAILQPRQHP
FT                   AKMSLLLPEAGRPALSPGHSPPPGAPGYPTGVRTISQPSTTQVLPTFFPTQLISTPVPS
FT                   SSPPGTLGPPSLLQGAVGTPSSPRGPESPKLGAGPSSCWHLGATYESGSRWNQPGCSQC
FT                   LCQDGEVTCGGVRCDATCSHPVPPRDGGCCPSCTGCFHSGAIRAEGDVFSPPEENCTVC
FT                   VCLAGNVSCISPECPPGPCKASPQSDCCTCVPGRCYFHGRWYTDGAVFSGGGDDCTTCV
FT                   CQNGEVECSFTPCPELECPREEWLLGPGQCCFTCREPTPTTGCSLDDNGVEFPIGQIWS
FT                   PGDPCELCVCQADGSVSCKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNETFP
FT                   SVLDPCLSCICLLGSVACSPVDCPITCTYPFHPDGECCPVCHDCNFEGRKVVNGQVFTL
FT                   DDEPCTRCICQLGEVSCETVPCRPICTDPSCPDSVFPLEEKQQPSPHGELAKAARNARG
FT                   DTEVPVNCSSCPGPPSASPTRPMIHLLQRLLRTNLSNIQSASPSPPIAQTSSSPLLEPE
FT                   GISLGKPRASQPPEPSAGSPVSPRLSTLPPAIPGTPLSPVTPESSSSTFGTQTAFQWLL
FT                   SATPLTEAETPSMTNADLSETLTTSSSSQRLSAALPDTPNPVPQQSTIDTPKKENSTI"
FT   CDS             join(991867..991976,994534..994628,994727..994816,
FT                   995471..995599,999057..999173,1001578..1001694,
FT                   1002425..1002553,1003974..1004392,1004472..1004565,
FT                   1005937..1006019,1009949..1010036,1012439..1012524,
FT                   1013623..1013740,1014741..1014806,1015999..1016084)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1948"
FT                   /product="mCG1948, isoform CRA_a"
FT                   /note="gene_id=mCG1948.2 transcript_id=mCT185200.0
FT                   protein_id=mCP106458.0 isoform=CRA_a"
FT                   /protein_id="EDL41371.1"
FT                   /translation="MWARLLLHVAYILIPLLGSSARGYTGRKAPGHYSAERRRLGPHVC
FT                   LSGFGSGCCPGWAPSMGSGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPEAHGSC
FT                   GEYGCDLTCNHGGCQEVARVCPVGFLMTETAVGIRCADIDECLSSSCEGHCVNTEGGFV
FT                   CECGPGMQLSADRHSCQDTDECLGTPCQQRCKNSIGSYKCSCRAGFHLHGNRHSCIDVN
FT                   ECRRPQERRVCHHTCHNTVGSFLCTCRPGFRLRSDRVSCEAFPKAVLAPSAILQPRQHP
FT                   AKMSLLLPEAGRPALSPGHSPPPGAPGYPTGVRTISQPSTTQVLPTFFPTQLISTPVPS
FT                   SSPPGTLGPPSLLQGAVGTPSSPRGPESPKLGAGPSSCWHLGATYESGSRWNQPGCSQC
FT                   LCQDGEVTCGGVRCDATCSHPVPPRDGGCCPSCTGCFHSGAIRAEGDVFSPPEENCTVC
FT                   VCLAGNVSCISPECPPGPCKASPQSDCCTCVPGRCYFHGRWYTDGAVFSGGGDDCTTCV
FT                   CQNGEVECSFTPCPELECPREEWLLGPGQCCFTCREPTPTTGCSLDDNGVEFPIGQIWS
FT                   PGDPCRRLCELQEDRLRGLLPAPHPDSWTVLS"
FT   gene            complement(1003133..>1005566)
FT                   /locus_tag="mCG_146176"
FT                   /note="gene_id=mCG146176.0"
FT   mRNA            complement(join(1003133..1003395,1004274..1004485,
FT                   1005447..>1005566))
FT                   /locus_tag="mCG_146176"
FT                   /product="mCG146176"
FT                   /note="gene_id=mCG146176.0 transcript_id=mCT186279.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(1003163..>1003375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146176"
FT                   /product="mCG146176"
FT                   /note="gene_id=mCG146176.0 transcript_id=mCT186279.0
FT                   protein_id=mCP107442.0"
FT                   /protein_id="EDL41373.1"
FT                   /translation="KGKGLHKEVEEWGWRAISEVKGTGFSCRGAGSVPSSHMVTHTIHS
FT                   PSPRRSLLGPSGACGTHTNQQAKPL"
FT   assembly_gap    1007182..1007201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1018139..1018282
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    1020748..1020767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1028509..1037756)
FT                   /gene="Pga5"
FT                   /locus_tag="mCG_1932"
FT                   /note="gene_id=mCG1932.1"
FT   mRNA            complement(join(1028509..1028698,1028792..1028890,
FT                   1028965..1029109,1031056..1031172,1033427..1033626,
FT                   1034606..1034724,1034823..1034940,1036404..1036563,
FT                   1037695..1037756))
FT                   /gene="Pga5"
FT                   /locus_tag="mCG_1932"
FT                   /product="pepsinogen 5, group I"
FT                   /note="gene_id=mCG1932.1 transcript_id=mCT8314.0 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(1028546..1028698,1028792..1028890,
FT                   1028965..1029109,1031056..1031172,1033427..1033626,
FT                   1034606..1034724,1034823..1034940,1036404..1036563,
FT                   1037695..1037747))
FT                   /codon_start=1
FT                   /gene="Pga5"
FT                   /locus_tag="mCG_1932"
FT                   /product="pepsinogen 5, group I"
FT                   /note="gene_id=mCG1932.1 transcript_id=mCT8314.0
FT                   protein_id=mCP9869.1"
FT                   /protein_id="EDL41374.1"
FT                   /translation="MKWLWVLGLVALSECLVKIPLMKIKSMRENLRESQVLKDYLEKYP
FT                   RSRAHVLLEQRRNPALTYEPMRNYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIY
FT                   CSSPACAHHKAFNPLRSSTFLVSGRPVNVAYGSGEMSGFLAYDTVRIGDLTVVAQAFGL
FT                   SLEEPGIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWLQGLIPQNLFAFYLSSKDEKG
FT                   SMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEVIACDGGCQGIMDTGTSLL
FT                   TGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIGSVTYPVPASAYIRKDRS
FT                   HNCRSNFEEGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIGLAPAA"
FT   assembly_gap    1032568..1032587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1039314..1039358
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            1044554..>1045239
FT                   /locus_tag="mCG_148461"
FT                   /note="gene_id=mCG148461.0"
FT   mRNA            join(1044554..1044721,1044903..>1045239)
FT                   /locus_tag="mCG_148461"
FT                   /product="mCG148461"
FT                   /note="gene_id=mCG148461.0 transcript_id=mCT188724.0
FT                   created on 13-JAN-2004"
FT   CDS             1045012..>1045239
FT                   /codon_start=1
FT                   /locus_tag="mCG_148461"
FT                   /product="mCG148461"
FT                   /note="gene_id=mCG148461.0 transcript_id=mCT188724.0
FT                   protein_id=mCP109159.0"
FT                   /protein_id="EDL41375.1"
FT                   /translation="MPSLAAHSIPSSSGQAWQRRIKPRAPSTWTLSTGTRCPVSHVYHV
FT                   VCTHPGIANNARSPTQKFELTQNIMRLVLYV"
FT   gene            <1048577..1076135
FT                   /gene="Vps37c"
FT                   /locus_tag="mCG_128840"
FT                   /note="gene_id=mCG128840.2"
FT   mRNA            join(<1048577..1048741,1067647..1067745,1071705..1071876,
FT                   1072706..1072788,1074036..1075930)
FT                   /gene="Vps37c"
FT                   /locus_tag="mCG_128840"
FT                   /product="vacuolar protein sorting 37C (yeast), transcript
FT                   variant mCT194133"
FT                   /note="gene_id=mCG128840.2 transcript_id=mCT194133.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1048718..1048741,1067647..1067745,1071705..1071876,
FT                   1072706..1072788,1074036..1074746)
FT                   /codon_start=1
FT                   /gene="Vps37c"
FT                   /locus_tag="mCG_128840"
FT                   /product="vacuolar protein sorting 37C (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG128840.2 transcript_id=mCT194133.0
FT                   protein_id=mCP115109.0 isoform=CRA_b"
FT                   /protein_id="EDL41377.1"
FT                   /translation="LPAVAAAPEKMEGLKDKTLQELEEMQNDPEAIARLALESPEVQDL
FT                   QLEREMALATNRSLAEQNLEFQGPLEISRSNLSDKYQELRKLVERCQEQKAKLEKFSSA
FT                   LQPGTLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLESFSSMRTLLHLRRVRVEKL
FT                   QDVVRRPRALPELAGDVPPKRPPPPRPVPQATPPETEEQPPQPSVVTPYPLPYSPSPGL
FT                   PVGPTAQGALQPAPFPVVAQPSSYGGPLGPYPSPHPGPRAMVGYSWSPQRSGPPQPGYP
FT                   TAPTSTSGPGYPLVGGRTPGPGYPQQSPYLPSGNKPPYPTQPQLPGFPGQPQPPVPPQP
FT                   PYPPGTTPSYGFHPPGPAWPRY"
FT   assembly_gap    1048890..1048983
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   mRNA            join(1049031..1049193,1067613..1067745,1071705..1071876,
FT                   1072706..1072788,1074036..1076135)
FT                   /gene="Vps37c"
FT                   /locus_tag="mCG_128840"
FT                   /product="vacuolar protein sorting 37C (yeast), transcript
FT                   variant mCT130145"
FT                   /note="gene_id=mCG128840.2 transcript_id=mCT130145.1
FT                   created on 01-OCT-2002"
FT   assembly_gap    1054552..1054571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1059375..1059394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1067653..1067745,1071705..1071876,1072706..1072788,
FT                   1074036..1074746)
FT                   /codon_start=1
FT                   /gene="Vps37c"
FT                   /locus_tag="mCG_128840"
FT                   /product="vacuolar protein sorting 37C (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG128840.2 transcript_id=mCT130145.1
FT                   protein_id=mCP64310.1 isoform=CRA_a"
FT                   /protein_id="EDL41376.1"
FT                   /translation="MEGLKDKTLQELEEMQNDPEAIARLALESPEVQDLQLEREMALAT
FT                   NRSLAEQNLEFQGPLEISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLL
FT                   QIEGMKIEEESEAMAEKFLEGEVPLETFLESFSSMRTLLHLRRVRVEKLQDVVRRPRAL
FT                   PELAGDVPPKRPPPPRPVPQATPPETEEQPPQPSVVTPYPLPYSPSPGLPVGPTAQGAL
FT                   QPAPFPVVAQPSSYGGPLGPYPSPHPGPRAMVGYSWSPQRSGPPQPGYPTAPTSTSGPG
FT                   YPLVGGRTPGPGYPQQSPYLPSGNKPPYPTQPQLPGFPGQPQPPVPPQPPYPPGTTPSY
FT                   GFHPPGPAWPRY"
FT   assembly_gap    1073574..1073713
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(1079363..1100221)
FT                   /gene="Cd5"
FT                   /locus_tag="mCG_1950"
FT                   /note="gene_id=mCG1950.1"
FT   mRNA            complement(join(1079363..1079815,1080713..1080804,
FT                   1081396..1081515,1082444..1082497,1083127..1083252,
FT                   1084217..1084507,1086187..1086528,1087004..1087066,
FT                   1087471..1087779,1091390..1091428,1100164..1100221))
FT                   /gene="Cd5"
FT                   /locus_tag="mCG_1950"
FT                   /product="CD5 antigen"
FT                   /note="gene_id=mCG1950.1 transcript_id=mCT8331.1 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(1080716..1080804,1081396..1081515,
FT                   1082444..1082497,1083127..1083252,1084217..1084507,
FT                   1086187..1086528,1087004..1087066,1087471..1087779,
FT                   1091390..1091428,1100164..1100215))
FT                   /codon_start=1
FT                   /gene="Cd5"
FT                   /locus_tag="mCG_1950"
FT                   /product="CD5 antigen"
FT                   /note="gene_id=mCG1950.1 transcript_id=mCT8331.1
FT                   protein_id=mCP9828.2"
FT                   /protein_id="EDL41378.1"
FT                   /translation="MDSHEVLLAATYLLGTLAAFCLGQSGRGGLDVQVMLSGSNSKCQG
FT                   QVEIQMENKWKTVCSSSWRLSQDHSKNAQLASAVCKQLRCGDPLALGPFPSLNRPQNQV
FT                   FCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVP
FT                   GHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTP
FT                   APAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGG
FT                   SSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFL
FT                   CAQEKLSQCYHLQKKKHCNKRVFVTCQDPNPAGLAPGTVASIILTLVLLVVLLAMCGPL
FT                   VYKKLVKKFRQKKQRQWIGPTGVNQNMSFHRSHTATVRSQVENPTASHVDNEYSQPPRN
FT                   SHLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL"
FT   assembly_gap    1092590..1092879
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    1101012..1101191
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            <1102358..1140433
FT                   /gene="A430093F15Rik"
FT                   /locus_tag="mCG_145658"
FT                   /note="gene_id=mCG145658.0"
FT   mRNA            join(<1102358..1102414,1136156..1137475,1139623..1139735,
FT                   1139808..1140433)
FT                   /gene="A430093F15Rik"
FT                   /locus_tag="mCG_145658"
FT                   /product="RIKEN cDNA A430093F15, transcript variant
FT                   mCT185082"
FT                   /note="gene_id=mCG145658.0 transcript_id=mCT185082.0
FT                   created on 05-JUN-2003"
FT   mRNA            join(<1102363..1102414,1136156..1136358,1139623..1139735,
FT                   1139808..1140424)
FT                   /gene="A430093F15Rik"
FT                   /locus_tag="mCG_145658"
FT                   /product="RIKEN cDNA A430093F15, transcript variant
FT                   mCT194026"
FT                   /note="gene_id=mCG145658.0 transcript_id=mCT194026.0
FT                   created on 09-MAR-2004"
FT   assembly_gap    1105100..1110790
FT                   /estimated_length=5691
FT                   /gap_type="unknown"
FT   assembly_gap    1118016..1119728
FT                   /estimated_length=1713
FT                   /gap_type="unknown"
FT   assembly_gap    1129838..1129857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1136209..1136358,1139623..1139735,1139808..1139976)
FT                   /codon_start=1
FT                   /gene="A430093F15Rik"
FT                   /locus_tag="mCG_145658"
FT                   /product="RIKEN cDNA A430093F15, isoform CRA_a"
FT                   /note="gene_id=mCG145658.0 transcript_id=mCT194026.0
FT                   protein_id=mCP115015.0 isoform=CRA_a"
FT                   /protein_id="EDL41379.1"
FT                   /translation="AFDKMLQKTALQCGGLCATYCQSVLETRGMGPPEAPSTFHTAREE
FT                   DTLMMGNMARGRWRESCAGGQKGSEPAGATSQGRLSKLSFLGCSPSSPEADTLNFWDPR
FT                   NVGFREASSAGDSSTPRMLFPRTQSLSSRCLDSTRAECS"
FT   CDS             join(<1137398..1137475,1139623..1139735,1139808..1139976)
FT                   /codon_start=1
FT                   /gene="A430093F15Rik"
FT                   /locus_tag="mCG_145658"
FT                   /product="RIKEN cDNA A430093F15, isoform CRA_b"
FT                   /note="gene_id=mCG145658.0 transcript_id=mCT185082.0
FT                   protein_id=mCP105531.0 isoform=CRA_b"
FT                   /protein_id="EDL41380.1"
FT                   /translation="CVAKPLLRTLHLCWLSLLVMVSADAEGNMARGRWRESCAGGQKGS
FT                   EPAGATSQGRLSKLSFLGCSPSSPEADTLNFWDPRNVGFREASSAGDSSTPRMLFPRTQ
FT                   SLSSRCLDSTRAECS"
FT   gene            complement(1143730..>1184599)
FT                   /gene="Cd6"
FT                   /locus_tag="mCG_1943"
FT                   /note="gene_id=mCG1943.2"
FT   mRNA            complement(join(1143730..1144627,1144953..1145054,
FT                   1145300..1145554,1145766..1145837,1147212..1147328,
FT                   1148516..1148611,1148938..1149078,1150700..1150762,
FT                   1152050..1152352,1152689..1153000,1153567..1153914,
FT                   1154717..1154785,1184348..>1184599))
FT                   /gene="Cd6"
FT                   /locus_tag="mCG_1943"
FT                   /product="CD6 antigen, transcript variant mCT194059"
FT                   /note="gene_id=mCG1943.2 transcript_id=mCT194059.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1143731..1144419,1145453..1145554,
FT                   1145766..1145837,1147212..1147328,1148516..1148611,
FT                   1148938..1149078,1150700..1150762,1152050..1152352,
FT                   1152689..1153000,1153567..1153914,1154717..1154785,
FT                   1184348..1184548))
FT                   /gene="Cd6"
FT                   /locus_tag="mCG_1943"
FT                   /product="CD6 antigen, transcript variant mCT8325"
FT                   /note="gene_id=mCG1943.2 transcript_id=mCT8325.1 created on
FT                   02-OCT-2002"
FT   CDS             complement(join(1144331..1144419,1145453..1145554,
FT                   1145766..1145837,1147212..1147328,1148516..1148611,
FT                   1148938..1149078,1150700..1150762,1152050..1152352,
FT                   1152689..1153000,1153567..1153914,1154717..1154785,
FT                   1184348..1184396))
FT                   /codon_start=1
FT                   /gene="Cd6"
FT                   /locus_tag="mCG_1943"
FT                   /product="CD6 antigen, isoform CRA_b"
FT                   /note="gene_id=mCG1943.2 transcript_id=mCT8325.1
FT                   protein_id=mCP9804.1 isoform=CRA_b"
FT                   /protein_id="EDL41382.1"
FT                   /translation="MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLEERLGI
FT                   RLVNGSSRCSGSVKVLLESWEPVCAAHWNRAATEAVCKALNCGDSGKVTYLMPPTSELP
FT                   PGATSGNTSSAGNTTWARAPTERCRGANWQFCKVQDQECSSDRRLVWVTCAENQAVRLV
FT                   DGSSRCAGRVEMLEHGEWGTVCDDTWDLQDAHVVCKQLKCGWAVKALAGLHFTPGQGPI
FT                   HRDQVNCSGTEAYLWDCPGRPGDQYCGHKEDAGVVCSEHQSWRLTGGIDSCEGQVEVYF
FT                   RGVWSTVCDSEWYPSEAKVLCRSLGCGSAVARPRGLPHSLDGRMYYSCKGQEPALSTCS
FT                   WRFNNSNLCSQSRAARVVCSGSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTL
FT                   LILCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIA
FT                   KEAPMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYNSQRHRVTEEEAQQNRFQ
FT                   MPPLEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNNKASGVRAESWVEQTGSGH
FT                   FLGVVKGHAG"
FT   CDS             complement(join(1144557..1144627,1144953..1145054,
FT                   1145300..1145554,1145766..1145837,1147212..1147328,
FT                   1148516..1148611,1148938..1149078,1150700..1150762,
FT                   1152050..1152352,1152689..1153000,1153567..1153914,
FT                   1154717..1154785,1184348..>1184420))
FT                   /codon_start=1
FT                   /gene="Cd6"
FT                   /locus_tag="mCG_1943"
FT                   /product="CD6 antigen, isoform CRA_a"
FT                   /note="gene_id=mCG1943.2 transcript_id=mCT194059.0
FT                   protein_id=mCP115023.0 isoform=CRA_a"
FT                   /protein_id="EDL41381.1"
FT                   /translation="VAVETAPDMWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTL
FT                   DLEERLGIRLVNGSSRCSGSVKVLLESWEPVCAAHWNRAATEAVCKALNCGDSGKVTYL
FT                   MPPTSELPPGATSGNTSSAGNTTWARAPTERCRGANWQFCKVQDQECSSDRRLVWVTCA
FT                   ENQAVRLVDGSSRCAGRVEMLEHGEWGTVCDDTWDLQDAHVVCKQLKCGWAVKALAGLH
FT                   FTPGQGPIHRDQVNCSGTEAYLWDCPGRPGDQYCGHKEDAGVVCSEHQSWRLTGGIDSC
FT                   EGQVEVYFRGVWSTVCDSEWYPSEAKVLCRSLGCGSAVARPRGLPHSLDGRMYYSCKGQ
FT                   EPALSTCSWRFNNSNLCSQSRAARVVCSGSQRHLNLSTSEVPSRVPVTIESSVPVSVKD
FT                   KDSQGLTLLILCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNY
FT                   HPVPITIAKEAPMLFIQPRVPADSDSSSDSDYEHYDFSSQPPVALTTFYNSQRHRVTEE
FT                   EAQQNRFQMPPLEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNSDSSTSSEEGY
FT                   CNDPSSKPPPWNSQAFYSEKSPLTEQPPNLELAGSPAVFSGPSADDSSSTSSGEWYQNF
FT                   QPPPQHPPAEQFECPGPPGPQTDSIDDDEEDYDDIGAA"
FT   assembly_gap    1157190..1157209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1160423..1160442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1191669..1191688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1197015..1212389
FT                   /gene="Slc15a3"
FT                   /locus_tag="mCG_1939"
FT                   /note="gene_id=mCG1939.1"
FT   mRNA            join(1197015..1198056,1202981..1203264,1207605..1207752,
FT                   1208738..1208845,1209393..1209561,1210372..1210530,
FT                   1211669..1211824,1212116..1212389)
FT                   /gene="Slc15a3"
FT                   /locus_tag="mCG_1939"
FT                   /product="solute carrier family 15, member 3"
FT                   /note="gene_id=mCG1939.1 transcript_id=mCT8321.1 created on
FT                   02-OCT-2002"
FT   CDS             join(1197499..1198056,1202981..1203264,1207605..1207752,
FT                   1208738..1208845,1209393..1209561,1210372..1210530,
FT                   1211669..1211824,1212116..1212270)
FT                   /codon_start=1
FT                   /gene="Slc15a3"
FT                   /locus_tag="mCG_1939"
FT                   /product="solute carrier family 15, member 3"
FT                   /note="gene_id=mCG1939.1 transcript_id=mCT8321.1
FT                   protein_id=mCP9905.1"
FT                   /protein_id="EDL41383.1"
FT                   /translation="MSAPRAEEQPSRSGERQPLVARGPRGPRRWRRTAAAAVLLVQMLE
FT                   RAAFFGVTSNLVLYLNSLNFNWDGQQASRATLLFLGASYLLAPVGGWLADVYLGRFLTI
FT                   SLSLLLYLAASGLLLTTITNDGRRSFCGEMPELPLEPACPSSSCQGSWSSPYCATTLYL
FT                   VLLLLALAASSVRSTLTSFGADQVMDLGRDATRRFFNWFYWSINLGAILSLLVVAFIEQ
FT                   NISFLWGYSIIVGLVGLAFFIFLFATPVFITKPPTGSQVSSMLKLAFQNCCPCRRSSSR
FT                   DSESAHLLPDQRSNQPGPSPQEDMANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGL
FT                   HLHIPNIFRTNPNISLLLRSDSSNYRIPEAWLLLANVAVILILIPVKDHLIDPLLLRCK
FT                   LLPSSLQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQ
FT                   IPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSFP
FT                   GGWMYCPKDFGNINNCQMDRYFFLLAGIEAVTAVLFLWIAGRYERTRQDPASQRSSSRV
FT                   RG"
FT   assembly_gap    1204207..1204567
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   gene            complement(1212319..>1224266)
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /note="gene_id=mCG1949.2"
FT   mRNA            complement(join(1212319..1213637,1214050..1214241,
FT                   1214610..1214883,1216020..1216222,1217713..1217856,
FT                   1217955..1218150,1218445..1218594,1219746..1220077,
FT                   1220959..1221177,1221420..1221634,1224026..>1224218))
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, transcript variant
FT                   mCT194065"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT194065.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1212320..1214241,1214610..1214883,
FT                   1216020..1216222,1217713..1217856,1217955..1218153,
FT                   1218445..1218594,1219746..1220077,1220959..1221177,
FT                   1221420..1221634,1224026..>1224266))
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, transcript variant
FT                   mCT194066"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT194066.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1212320..1213145,1213485..1213637,
FT                   1214050..1214241,1214610..1214883,1216020..1216222,
FT                   1217713..1217856,1217955..1218150,1218445..1218594,
FT                   1219746..1220077,1220959..1221201,1221420..1221634,
FT                   1224026..1224250))
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, transcript variant
FT                   mCT8332"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT8332.1 created on
FT                   02-OCT-2002"
FT   CDS             complement(join(1212594..1213637,1214050..1214241,
FT                   1214610..1214883,1216020..1216222,1217713..1217856,
FT                   1217955..1218150,1218445..1218594,1219746..1220077,
FT                   1220959..1221177,1221420..1221634,1224026..>1224158))
FT                   /codon_start=1
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, isoform CRA_a"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT194065.0
FT                   protein_id=mCP115074.0 isoform=CRA_a"
FT                   /protein_id="EDL41384.1"
FT                   /translation="AARRLPSFGGKECASMTERKAAAPRGPYGAWFCLLVALALEVVRV
FT                   SSNHDTLDPIYLPVALELLDAPEHFRVQQVGHYPPANSSLASRSETFLLMQPWPRAQPL
FT                   LRASYPPFATQQVVPPRVTEPHRRPVPWDVRAVSVEAAVTPAEPYARVLFHLKGQDWPP
FT                   GPGSLPCARLHATHPAGTAHRACRFQPSLGACVVELQFPSHWFSQSATTRAELAYTLEP
FT                   AGEGPGGCGLGTEEEPREQALPVGGVELHPEDPPQYQEVPLDEAVTLRAPDVPMRPGQL
FT                   FTATLLLRHNFTASLLTLRIKVKKGLQVIAARPAQPTLWTAKLDRFKGSKHHTSLITCH
FT                   RAGPAGPDSSPLELSEFLWVDFAVENSTGGGVAVTRPVTWQLEYPGQAPEAEKDKMVWE
FT                   ILVSERDIRALIPLAKAEELVNTAPLTGVPQRIPVRLVTVDSGGALEEVTEHIGCESAN
FT                   TQVLQVSEACDAVFVAGQESRGAKGVRVDFWWRRLRASLKLTVWAPLLPLRIELTDTTL
FT                   EQIRGWRVPGSAEGQLEPETAAEEVERRSRGCRLQYQRAGVRFLVPFAAHPLDGGRRLT
FT                   HLLGPDWLLDVSHLVAAHAHVQDPRIASLEGGRILVGREPGVTSIEVRSPLSDAILGEQ
FT                   ALAVTDDKVSVLDLRVQPVMGISLSLSRGMSHPGEVTATCWAQSALPAPKQEVALSLWL
FT                   SFSDHTLAPAELYDRNDLGLSVSAEEPSAVLPAEEQGAQLGVVVSGVGAEGLPLHVALH
FT                   PPEPCRRGRHRVPLASGTAWLGLPPLPTPVPALPSSPVRTSPFTEATVEGKRQIAGDMG
FT                   GHVGIRGKFERAEEEAGKEENEAKEEEEDEEEMVPAPQRVTDLELGMYALLGIFCLAIL
FT                   IFLVNGVVFVLRYQRKEPPDSATDPASPQPHNWVWLGTNQEELSRQLDRCSSSGPPKGE
FT                   GGCPCESGAGGDASTVAPSASESPAGSSSTLARKEAGGRRKRVEFVTFAPAPPTQPPEE
FT                   PVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIRGSS"
FT   CDS             complement(join(1212594..1213145,1213485..1213637,
FT                   1214050..1214241,1214610..1214883,1216020..1216222,
FT                   1217713..1217856,1217955..1218150,1218445..1218594,
FT                   1219746..1220077,1220959..1221201,1221420..1221634,
FT                   1224026..1224113))
FT                   /codon_start=1
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, isoform CRA_c"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT8332.1
FT                   protein_id=mCP9910.1 isoform=CRA_c"
FT                   /protein_id="EDL41386.1"
FT                   /translation="MTERKAAAPRGPYGAWFCLLVALALEVVRVSSNHDTLDPIYLPVA
FT                   LELLDAPEHFRVQQVGHYPPANSSLASRSETFLLMQPWPRAQPLLRASYPPFATQQMSM
FT                   FALFQVVPPRVTEPHRRPVPWDVRAVSVEAAVTPAEPYARVLFHLKGQDWPPGPGSLPC
FT                   ARLHATHPAGTAHRACRFQPSLGACVVELQFPSHWFSQSATTRAELAYTLEPAGEGPGG
FT                   CGLGTEEEPREQALPVGGVELHPEDPPQYQEVPLDEAVTLRAPDVPMRPGQLFTATLLL
FT                   RHNFTASLLTLRIKVKKGLQVIAARPAQPTLWTAKLDRFKGSKHHTSLITCHRAGPAGP
FT                   DSSPLELSEFLWVDFAVENSTGGGVAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERD
FT                   IRALIPLAKAEELVNTAPLTGVPQRIPVRLVTVDSGGALEEVTEHIGCESANTQVLQVS
FT                   EACDAVFVAGQESRGAKGVRVDFWWRRLRASLKLTVWAPLLPLRIELTDTTLEQIRGWR
FT                   VPGSAEGQLEPETAAEEVERRSRGCRLQYQRAGVRFLVPFAAHPLDGGRRLTHLLGPDW
FT                   LLDVSHLVAAHAHVQDPRIASLEGGRILVGREPGVTSIEVRSPLSDAILGEQALAVTDD
FT                   KVSVLDLRVQPVMGISLSLSRGMSHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTL
FT                   APAELYDRNDLGLSVSAEEPSAVLPAEEQGAQLGVVRVTDLELGMYALLGIFCLAILIF
FT                   LVNGVVFVLRYQRKEPPDSATDPASPQPHNWVWLGTNQEELSRQLDRCSSSGPPKGEGG
FT                   CPCESGAGGDASTVAPSASESPAGSSSTLARKEAGGRRKRVEFVTFAPAPPTQPPEEPV
FT                   GAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIRGSS"
FT   CDS             complement(join(1213999..1214241,1214610..1214883,
FT                   1216020..1216222,1217713..1217856,1217955..1218153,
FT                   1218445..1218594,1219746..1220077,1220959..1221177,
FT                   1221420..1221634,1224026..>1224158))
FT                   /codon_start=1
FT                   /gene="Tmem132a"
FT                   /locus_tag="mCG_1949"
FT                   /product="transmembrane protein 132A, isoform CRA_b"
FT                   /note="gene_id=mCG1949.2 transcript_id=mCT194066.0
FT                   protein_id=mCP115075.0 isoform=CRA_b"
FT                   /protein_id="EDL41385.1"
FT                   /translation="AARRLPSFGGKECASMTERKAAAPRGPYGAWFCLLVALALEVVRV
FT                   SSNHDTLDPIYLPVALELLDAPEHFRVQQVGHYPPANSSLASRSETFLLMQPWPRAQPL
FT                   LRASYPPFATQQVVPPRVTEPHRRPVPWDVRAVSVEAAVTPAEPYARVLFHLKGQDWPP
FT                   GPGSLPCARLHATHPAGTAHRACRFQPSLGACVVELQFPSHWFSQSATTRAELAYTLEP
FT                   AGEGPGGCGLGTEEEPREQALPVGGVELHPEDPPQYQEVPLDEAVTLRAPDVPMRPGQL
FT                   FTATLLLRHNFTASLLTLRIKVKKGLQVIAARPAQPTLWTAKLDRFKGSKHHTSLITCH
FT                   RAGPAGPDSSSPLELSEFLWVDFAVENSTGGGVAVTRPVTWQLEYPGQAPEAEKDKMVW
FT                   EILVSERDIRALIPLAKAEELVNTAPLTGVPQRIPVRLVTVDSGGALEEVTEHIGCESA
FT                   NTQVLQVSEACDAVFVAGQESRGAKGVRVDFWWRRLRASLKLTVWAPLLPLRIELTDTT
FT                   LEQIRGWRVPGSAEGQLEPETAAEEVERRSRGCRLQYQRAGVRFLVPFAAHPLDGGRRL
FT                   THLLGPDWLLDVSHLVAAHAHVQDPRIASLEGGRILVGREPGVTSIEVRSPLSDAILGE
FT                   QALAVTDDKVSVLDLRVQPVMGISLSLSRGMSHPGEVTATCWAQSALPAPKQVMAGGER
FT                   AWSDTIGGG"
FT   gene            complement(1225151..1236349)
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /note="gene_id=mCG1953.3"
FT   mRNA            complement(join(1225151..1225885,1226005..1226726,
FT                   1227165..1227267,1228820..1229064,1232657..1232727,
FT                   1236269..1236349))
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, transcript variant
FT                   mCT185383"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT185383.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1225151..1225885,1226006..1226726,
FT                   1227165..1227267,1228820..1229064,1236269..1236344))
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, transcript variant
FT                   mCT8335"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT8335.3 created on
FT                   13-JUN-2003"
FT   mRNA            complement(join(1225151..1225885,1226005..1226726,
FT                   1227165..1227267,1228820..1229064,1234758..1234948))
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, transcript variant
FT                   mCT181302"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT181302.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    1225886..1226004
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   CDS             complement(join(1226335..1226726,1227165..1227267,
FT                   1228820..1229064,1232657..1232690))
FT                   /codon_start=1
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, isoform CRA_c"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT185383.0
FT                   protein_id=mCP106640.0 isoform=CRA_c"
FT                   /protein_id="EDL41389.1"
FT                   /translation="MLWMRSEHRAQDTNMAGAHSTPLWSRHLLKAVLMVLVALFLVHSA
FT                   SAQSHREFASPGQQKKETSADILTQIGRSLKEMLDTWLGPETMHVISETLLQVMWAISS
FT                   AISVACFALSGIAAQLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLL
FT                   GLVLALLGRILGGLKLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSS
FT                   GSHLEAKVRGLERQIEELRGRQRRAAKMPRSMEEE"
FT   CDS             complement(join(1226335..1226726,1227165..1227267,
FT                   1228820..1229056))
FT                   /codon_start=1
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, isoform CRA_b"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT8335.3
FT                   protein_id=mCP9821.2 isoform=CRA_b"
FT                   /protein_id="EDL41388.1"
FT                   /translation="MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQ
FT                   KKETSADILTQIGRSLKEMLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAA
FT                   QLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGL
FT                   KLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQ
FT                   IEELRGRQRRAAKMPRSMEEE"
FT   CDS             complement(join(1226335..1226726,1227165..1227267,
FT                   1228820..1229056))
FT                   /codon_start=1
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, isoform CRA_b"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT181302.1
FT                   protein_id=mCP104224.0 isoform=CRA_b"
FT                   /protein_id="EDL41390.1"
FT                   /translation="MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQ
FT                   KKETSADILTQIGRSLKEMLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAA
FT                   QLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGL
FT                   KLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQ
FT                   IEELRGRQRRAAKMPRSMEEE"
FT   mRNA            complement(join(1228516..1229064,1236269..1236331))
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, transcript variant
FT                   mCT185382"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT185382.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(1228661..1229056)
FT                   /codon_start=1
FT                   /gene="Tmem109"
FT                   /locus_tag="mCG_1953"
FT                   /product="transmembrane protein 109, isoform CRA_a"
FT                   /note="gene_id=mCG1953.3 transcript_id=mCT185382.0
FT                   protein_id=mCP106641.0 isoform=CRA_a"
FT                   /protein_id="EDL41387.1"
FT                   /translation="MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQ
FT                   KKETSADILTQIGRSLKEMLDTWLGPETMHVISEVRKVVPVVAVCRKKRRDIVNATSPH
FT                   HHIFCPSCYCLERAPPSTNTSWHFCLL"
FT   assembly_gap    1235510..1235583
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    1244533..1244594
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   gene            1249650..1259943
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /note="gene_id=mCG1945.1"
FT   mRNA            join(1249650..1249877,1251912..1252061,1252226..1252302,
FT                   1253392..1253514,1253779..1253841,1254584..1254625,
FT                   1254733..1254807,1255099..1255174,1255336..1255445,
FT                   1256753..1256908,1257111..1257180,1257377..1257462,
FT                   1257700..1257870,1258047..1258152,1259444..1259943)
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), transcript variant mCT8328"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT8328.1 created on
FT                   02-OCT-2002"
FT   mRNA            join(<1249673..1249877,1251912..1252061,1252226..1252302,
FT                   1253392..1253533,1253614..1253687,1253779..1253841,
FT                   1254584..1254625,1254733..1254807,1255099..1255174,
FT                   1255336..1255445,1256753..1256908,1257111..1257180,
FT                   1257377..1257462,1257700..1257870,1258047..1258152,
FT                   1259444..1259726)
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), transcript variant mCT194061"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT194061.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1249822..1249877,1251912..1252061,1252226..1252302,
FT                   1253335..1253533,1253614..1253687,1253779..1253841,
FT                   1254584..1254625,1254733..1254807,1255099..1255174,
FT                   1255336..1255445,1256753..1256908,1257111..1257180,
FT                   1257377..1257462,1257700..1257870,1258047..1258152,
FT                   1259444..1259919)
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), transcript variant mCT194062"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT194062.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1249829..1249877,1251912..1252061,1252226..1252302,
FT                   1253335..1253533,1253614..1253687,1253779..1253841,
FT                   1254584..1254625,1254733..1254807,1255099..1255174,
FT                   1255336..1255445,1256753..1256908,1257111..1257180,
FT                   1257377..1257462,1257700..1257870,1258047..1258152,
FT                   1259444..1259541)
FT                   /codon_start=1
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT194062.0
FT                   protein_id=mCP115073.0 isoform=CRA_b"
FT                   /protein_id="EDL41392.1"
FT                   /translation="GDWQQRYDGAMSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIA
FT                   ENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWGWPNSPALPQSS
FT                   QWPTLSQDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATL
FT                   KPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKT
FT                   VPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKS
FT                   TEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTG
FT                   LSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTM
FT                   DSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKT
FT                   LQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAK
FT                   FIASTGMDRSLKFYSL"
FT   CDS             join(<1249829..1249877,1251912..1252061,1252226..1252302,
FT                   1253392..1253533,1253614..1253687,1253779..1253841,
FT                   1254584..1254625,1254733..1254807,1255099..1255174,
FT                   1255336..1255445,1256753..1256908,1257111..1257180,
FT                   1257377..1257462,1257700..1257870,1258047..1258152,
FT                   1259444..1259541)
FT                   /codon_start=1
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT194061.0
FT                   protein_id=mCP115072.0 isoform=CRA_a"
FT                   /protein_id="EDL41391.1"
FT                   /translation="GDWQQRYDGAMSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIA
FT                   ENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQ
FT                   QLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSV
FT                   VGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVAS
FT                   HVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSTEQILATLKGHTKKVTSVV
FT                   FHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYW
FT                   AFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP
FT                   GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGT
FT                   YLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL"
FT   CDS             join(1249859..1249877,1251912..1252061,1252226..1252302,
FT                   1253392..1253514,1253779..1253841,1254584..1254625,
FT                   1254733..1254807,1255099..1255174,1255336..1255445,
FT                   1256753..1256908,1257111..1257180,1257377..1257462,
FT                   1257700..1257870,1258047..1258152,1259444..1259541)
FT                   /codon_start=1
FT                   /gene="Prpf19"
FT                   /locus_tag="mCG_1945"
FT                   /product="PRP19/PSO4 pre-mRNA processing factor 19 homolog
FT                   (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG1945.1 transcript_id=mCT8328.1
FT                   protein_id=mCP9825.1 isoform=CRA_c"
FT                   /protein_id="EDL41393.1"
FT                   /translation="MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQ
FT                   PLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELS
FT                   HALYQHDAACRVIARLTKEGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTV
FT                   PEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKST
FT                   EQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGL
FT                   SLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMD
FT                   SQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTL
FT                   QLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKF
FT                   IASTGMDRSLKFYSL"
FT   gene            complement(1268698..1274987)
FT                   /locus_tag="mCG_1936"
FT                   /note="gene_id=mCG1936.1"
FT   mRNA            complement(join(1268698..1268862,1269033..1269140,
FT                   1269238..1269319,1270600..1270744,1270843..1271032,
FT                   1271127..1271254,1272046..1272143,1272306..1272493,
FT                   1272878..1273021,1273111..1273474,1273789..1273910,
FT                   1274759..1274987))
FT                   /locus_tag="mCG_1936"
FT                   /product="mCG1936"
FT                   /note="gene_id=mCG1936.1 transcript_id=mCT8318.1 created on
FT                   02-OCT-2002"
FT   CDS             complement(join(1268732..1268862,1269033..1269140,
FT                   1269238..1269319,1270600..1270744,1270843..1271032,
FT                   1271127..1271254,1272046..1272143,1272306..1272493,
FT                   1272878..1273021,1273111..1273474,1273789..1273910,
FT                   1274759..1274930))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1936"
FT                   /product="mCG1936"
FT                   /note="gene_id=mCG1936.1 transcript_id=mCT8318.1
FT                   protein_id=mCP9845.2"
FT                   /db_xref="GOA:Q059L1"
FT                   /db_xref="InterPro:IPR000519"
FT                   /db_xref="InterPro:IPR001507"
FT                   /db_xref="InterPro:IPR017957"
FT                   /db_xref="InterPro:IPR017977"
FT                   /db_xref="MGI:MGI:103073"
FT                   /db_xref="UniProtKB/TrEMBL:Q059L1"
FT                   /protein_id="EDL41394.1"
FT                   /translation="MAWGCFVVLLLLAAAPLRLGQRLHLEPGFEYSYDCGVRGMQLLVF
FT                   PRPNQTVQFKVLDEFGNRFEVNNCSICYHWVTSEAQEHTVFSADYKGCHVLEKDGRFHL
FT                   RVFIQAVLPNGRVDIAQDVTLICPKPDHTVTPDPYLAPPTTPEPFTPHAFALHPIPDHT
FT                   LAGSGHTGLTTLYPEQSFIHPTPAPPSLGPGPAGSTVPHSQWGTLEPWELTELDSVGTH
FT                   LPQERCQVASGHIPCMVNGSSKETCQQAGCCYDSTKEEPCYYGNTVTLQCFKSGYFTLV
FT                   MSQETALTHGVLLDNVHLAYAPNGCPPTQKTSAFVVFHVPLTLCGTAIQVVGEQLIYEN
FT                   QLVSDIDVQKGPQGSITRDSAFRLHVRCIFNASDFLPIQASIFSPQPPAPVTQSGPLRL
FT                   ELRIATDKTFSSYYQGSDYPLVRLLREPVYVEVRLLQRTDPSLVLVLHQCWATPTTSPF
FT                   EQPQWPILSDGCPFKGDNYRTQVVAADREALPFWSHYQRFTITTFMLLDSSSQNALRGQ
FT                   VYFFCSASACHPLGSDTCSTTCDSGIARRRRSSGHHNITLRALDIVSSPGAVGFEDAAK
FT                   LEPSGSSRNSSSRMLLLLLAITLALAAGIFVGLIWAWAQKLWEGIRY"
FT   assembly_gap    1274400..1274419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1277123..1277150
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1279099..1279118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1291479..1296692
FT                   /gene="Gpr44"
FT                   /locus_tag="mCG_1933"
FT                   /note="gene_id=mCG1933.1"
FT   mRNA            join(1291479..1291578,1293293..1293383,1294388..1296692)
FT                   /gene="Gpr44"
FT                   /locus_tag="mCG_1933"
FT                   /product="G protein-coupled receptor 44"
FT                   /note="gene_id=mCG1933.1 transcript_id=mCT8315.1 created on
FT                   13-JUN-2003"
FT   CDS             1294448..1295596
FT                   /codon_start=1
FT                   /gene="Gpr44"
FT                   /locus_tag="mCG_1933"
FT                   /product="G protein-coupled receptor 44"
FT                   /note="gene_id=mCG1933.1 transcript_id=mCT8315.1
FT                   protein_id=mCP9835.0"
FT                   /db_xref="GOA:Q9Z2J6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1330275"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2J6"
FT                   /protein_id="EDL41395.1"
FT                   /translation="MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLG
FT                   LVENGLILFVVGCRMRQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCK
FT                   LHSSVFFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTI
FT                   PYFVFRDTIPRLDGRIMCYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIA
FT                   SSHVAVSLRLHHRGRQRTGRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLA
FT                   SRGLPFVTSLAFFNSVVNPLLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRR
FT                   RRASSTATPASTLLLADRIPQLRPTRLIGWMRRGSAEVPQRV"
FT   gene            complement(1295808..>1303585)
FT                   /gene="Ccdc86"
FT                   /locus_tag="mCG_145097"
FT                   /note="gene_id=mCG145097.0"
FT   mRNA            complement(join(1295808..1297616,1297805..1297879,
FT                   1299611..1299740,1302606..>1303585))
FT                   /gene="Ccdc86"
FT                   /locus_tag="mCG_145097"
FT                   /product="coiled-coil domain containing 86"
FT                   /note="gene_id=mCG145097.0 transcript_id=mCT184521.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1297497..1297616,1297805..1297879,
FT                   1299611..1299740,1302606..>1303564))
FT                   /codon_start=1
FT                   /gene="Ccdc86"
FT                   /locus_tag="mCG_145097"
FT                   /product="coiled-coil domain containing 86"
FT                   /note="gene_id=mCG145097.0 transcript_id=mCT184521.0
FT                   protein_id=mCP105511.0"
FT                   /protein_id="EDL41396.1"
FT                   /translation="AMDTPLRRSRRLEGLKPLSPENLPVPEVSRAKRALVDFKSNSEET
FT                   GELKSTRVPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQ
FT                   PETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPEASPGSPGPRQDADDGSP
FT                   QRQPEPHPGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEV
FT                   IPGSPEPCPGQQAPGPEPSQPAQELTVQAPSSPERQLEPGKLPPAGETVTESLNLKKRV
FT                   IASPQAPASKKLKEKEELPVIPKGKPKSGRVWKDRSKKRFSQMVQDKPLRTSWQRKMKE
FT                   RQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERKAEIVQVIRNPAKLKKAK
FT                   KKQLRSIEKRDTLALLQKQPPQRPVAKV"
FT   gene            complement(1314713..1327086)
FT                   /gene="Ms4a10"
FT                   /locus_tag="mCG_12910"
FT                   /note="gene_id=mCG12910.1"
FT   mRNA            complement(join(1314713..1314818,1315351..1315489,
FT                   1316452..1316545,1317078..1317188,1318174..1318305,
FT                   1319484..1319540,1320538..1320657,1321008..1321203,
FT                   1327029..1327086))
FT                   /gene="Ms4a10"
FT                   /locus_tag="mCG_12910"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   10"
FT                   /note="gene_id=mCG12910.1 transcript_id=mCT13625.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1315374..1315489,1316452..1316545,
FT                   1317078..1317188,1318174..1318305,1319484..1319540,
FT                   1320538..1320657,1321008..1321181))
FT                   /codon_start=1
FT                   /gene="Ms4a10"
FT                   /locus_tag="mCG_12910"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   10"
FT                   /note="gene_id=mCG12910.1 transcript_id=mCT13625.1
FT                   protein_id=mCP9849.2"
FT                   /db_xref="GOA:B2RWS0"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:1917076"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWS0"
FT                   /protein_id="EDL41397.1"
FT                   /translation="MAGQAPTAVPGSVTGEVSRWQNLGPAQPAQKVAQPQNLVPDGHLE
FT                   KALEGSDLLQKLGGFHIAIAFAHLAFGGYLISTVKNLHLVVLKCWYPLWGTVSFLVAGM
FT                   AAMTTVTFPKTSLKVLCVIANVISLFCALAGFFVIAKDLFLEGPFPWPIWRPYPEPTTY
FT                   IQRLELTLFCFTFLEIFLSGSTAITAYRMKRLQAEDKDDTPFVPDTPMELKGLSLGPPP
FT                   SYKDVAQGHSSSDTGRALATSSGLLLASDSFHQALLHTGPRTLRK"
FT   assembly_gap    1328413..1328533
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1329581..1329774
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            complement(<1331631..1336190)
FT                   /locus_tag="mCG_128845"
FT                   /note="gene_id=mCG128845.0"
FT   mRNA            complement(join(<1331631..1331747,1332516..1332629,
FT                   1332987..1333079,1333710..1333766,1336068..1336190))
FT                   /locus_tag="mCG_128845"
FT                   /product="mCG128845"
FT                   /note="gene_id=mCG128845.0 transcript_id=mCT130150.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(1331631..1331747,1332516..1332629,
FT                   1332987..1333079,1333710..1333766,1336068..1336136))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128845"
FT                   /product="mCG128845"
FT                   /note="gene_id=mCG128845.0 transcript_id=mCT130150.0
FT                   protein_id=mCP63888.1"
FT                   /protein_id="EDL41398.1"
FT                   /translation="MVRRGHLGMLFIEGGVPFWGGACFIISGSLSVAAERNHTSCLLKS
FT                   SLGTNILSAMAAFAGTAILLMDFGVTNWDVGRGYLAVLTIFTILEFFIAVIATHFGCQA
FT                   TRAQTNASVIFLPNAFGTDFNIPSPAVSPPPAYDNVAYMPKESSE"
FT   assembly_gap    1334368..1334387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1349933..1370907)
FT                   /locus_tag="mCG_12904"
FT                   /note="gene_id=mCG12904.1"
FT   mRNA            complement(join(1349933..1350364,1353244..1353357,
FT                   1354804..1354914,1364275..1364400,1366139..1366612,
FT                   1370769..1370907))
FT                   /locus_tag="mCG_12904"
FT                   /product="mCG12904, transcript variant mCT13619"
FT                   /note="gene_id=mCG12904.1 transcript_id=mCT13619.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1349934..1350364,1353244..1353357,
FT                   1354804..1354914,1361571..1361627,1364275..1364400,
FT                   1366139..1366612,1370769..>1370842))
FT                   /locus_tag="mCG_12904"
FT                   /product="mCG12904, transcript variant mCT194029"
FT                   /note="gene_id=mCG12904.1 transcript_id=mCT194029.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1350200..1350364,1353244..1353357,
FT                   1354804..1354914,1361571..1361627,1364275..1364400,
FT                   1366139..1366612,1370769..>1370825))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12904"
FT                   /product="mCG12904, isoform CRA_b"
FT                   /note="gene_id=mCG12904.1 transcript_id=mCT194029.0
FT                   protein_id=mCP114991.0 isoform=CRA_b"
FT                   /protein_id="EDL41400.1"
FT                   /translation="SSCRNCQGLKKETDLPGLKQLCIMSNQENVSAVTVPSNVQVMQPT
FT                   YAVVSGSHEQPLGKTTTYPASATMLQYNPGSANFQNPQVMIQNPAGTTGLQAGPTGLQY
FT                   SAGMAGVQAPPGVIQYSPEVTSVQIPPGDPQNPLNTVPGPTQTSSLPQWNMSFMTFPEF
FT                   NPKKFINEEVRTLGAIQILIGLFHIFSAVNPQLYNTQFFVVPLLGVSGYLIWGGLSFII
FT                   SGSLSVLAEKNSNSCVVNSSIGMNVVSSIFSLTGIIIIIVQLSIYPSEISPLMSSMKAA
FT                   AGSILPFALLEFILTCIASHFGCQAVCCAHFQNMTMFPTIFGGNTVNTTTGPGNTTIPN
FT                   STTSIPVQTTLPSNVPLEQVYQDVAQK"
FT   CDS             complement(join(1350200..1350364,1353244..1353357,
FT                   1354804..1354914,1364275..1364400,1366139..1366600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12904"
FT                   /product="mCG12904, isoform CRA_a"
FT                   /note="gene_id=mCG12904.1 transcript_id=mCT13619.1
FT                   protein_id=mCP9833.1 isoform=CRA_a"
FT                   /protein_id="EDL41399.1"
FT                   /translation="MSNQENVSAVTVPSNVQVMQPTYAVVSGSHEQPLGKTTTYPASAT
FT                   MLQYNPGSANFQNPQVMIQNPAGTTGLQAGPTGLQYSAGMAGVQAPPGVIQYSPEVTSV
FT                   QIPPGDPQNPLNTVPGPTQTSSLPQWNMSFMTFPEFNPKKFINEEVRTLGAIQILIGLF
FT                   HIFSAVNPQLYNTQFFVVPLLGVSGYLIWGGLSVNSSIGMNVVSSIFSLTGIIIIIVQL
FT                   SIYPSEISPLMSSMKAAAGSILPFALLEFILTCIASHFGCQAVCCAHFQNMTMFPTIFG
FT                   GNTVNTTTGPGNTTIPNSTTSIPVQTTLPSNVPLEQVYQDVAQK"
FT   assembly_gap    1372754..1373084
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    1377597..1378213
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    1379253..1379335
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1383155..1383475
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   gene            complement(1388229..1390483)
FT                   /locus_tag="mCG_12889"
FT                   /note="gene_id=mCG12889.1"
FT   mRNA            complement(join(1388229..1388416,1388553..1388647,
FT                   1390349..1390483))
FT                   /locus_tag="mCG_12889"
FT                   /product="mCG12889"
FT                   /note="gene_id=mCG12889.1 transcript_id=mCT13604.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1388337..1388416,1388553..1388562))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12889"
FT                   /product="mCG12889"
FT                   /note="gene_id=mCG12889.1 transcript_id=mCT13604.1
FT                   protein_id=mCP9861.2"
FT                   /protein_id="EDL41401.1"
FT                   /translation="MTIGIWEPRKHPNSIQQNPNEIYHVIKQI"
FT   gene            complement(1400436..1403403)
FT                   /locus_tag="mCG_12906"
FT                   /note="gene_id=mCG12906.1"
FT   mRNA            complement(join(1400436..1400920,1401106..1401219,
FT                   1403225..1403403))
FT                   /locus_tag="mCG_12906"
FT                   /product="mCG12906"
FT                   /note="gene_id=mCG12906.1 transcript_id=mCT13621.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1400807..1400920,1401106..1401219,
FT                   1403225..1403233))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12906"
FT                   /product="mCG12906"
FT                   /note="gene_id=mCG12906.1 transcript_id=mCT13621.1
FT                   protein_id=mCP9911.1"
FT                   /db_xref="GOA:Q3U6J0"
FT                   /db_xref="MGI:MGI:2147706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U6J0"
FT                   /protein_id="EDL41402.1"
FT                   /translation="MSPIPLIFIFGGVLIICLMQQYLAYKSSKNVVKVFCHQANDVHIY
FT                   QTQVVMTNTLETSSGKSHPLGRSGEIQSLKKQN"
FT   assembly_gap    1404931..1404950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1415475..1415666
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            complement(1420378..>1434342)
FT                   /gene="Ms4a8a"
FT                   /locus_tag="mCG_12903"
FT                   /note="gene_id=mCG12903.2"
FT   mRNA            complement(join(1420378..1420683,1421281..1421394,
FT                   1423617..1423754,1424508..1424567,1429531..1429653,
FT                   1432627..1432846,1434227..1434277))
FT                   /gene="Ms4a8a"
FT                   /locus_tag="mCG_12903"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   8A, transcript variant mCT13618"
FT                   /note="gene_id=mCG12903.2 transcript_id=mCT13618.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1420527..1420683,1421281..1421394,
FT                   1423617..1423754,1424508..1424554,1429531..1429653,
FT                   1432627..1432846,1434227..>1434342))
FT                   /gene="Ms4a8a"
FT                   /locus_tag="mCG_12903"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   8A, transcript variant mCT194027"
FT                   /note="gene_id=mCG12903.2 transcript_id=mCT194027.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1420579..1420683,1421281..1421394,
FT                   1423617..1423754,1424508..1424554,1429531..1429653,
FT                   1432627..1432846,1434227..>1434292))
FT                   /codon_start=1
FT                   /gene="Ms4a8a"
FT                   /locus_tag="mCG_12903"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   8A, isoform CRA_b"
FT                   /note="gene_id=mCG12903.2 transcript_id=mCT194027.0
FT                   protein_id=mCP114990.0 isoform=CRA_b"
FT                   /protein_id="EDL41404.1"
FT                   /translation="VFYSKELGTGARETYLATGHSKHEYSNFTGPHGQFCICGGTAQQL
FT                   SCGPRNRASDAYLSQQSASSPCDFWSSAWFGASYDRTACPESLEKGTSPRGHPDPDRPG
FT                   AHRPGLHHDHQPLQPLYTCLPLWRFPLLGRHLGSLSVAAETQPNSPCLLNGSVGLNIFS
FT                   AICSAVGIMLFITDISISSGYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVS
FT                   SHFGCQVACCHYNNPGVVIPNVYAANPVVIPEPPNPIPSYSEVVQDSR"
FT   CDS             complement(join(1420579..1420683,1421281..1421394,
FT                   1423617..1423754,1424508..1424567,1429531..1429653,
FT                   1432627..1432845))
FT                   /codon_start=1
FT                   /gene="Ms4a8a"
FT                   /locus_tag="mCG_12903"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   8A, isoform CRA_a"
FT                   /note="gene_id=mCG12903.2 transcript_id=mCT13618.1
FT                   protein_id=mCP9822.1 isoform=CRA_a"
FT                   /protein_id="EDL41403.1"
FT                   /translation="MNTVTSPGPMANSVYVVAPPNSYPVVPGTVPQMPIYPSNQPQVHV
FT                   ISGHLPGLVPAMTEPPAQRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSHYTPVSLY
FT                   GGFPFWGGIWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIMLFITDISIS
FT                   SGYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVSSHFGCQVACCHYNNPGVV
FT                   IPNVYAANPVVIPEPPNPIPSYSEVVQDSR"
FT   assembly_gap    1426520..1426539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1441305..1441960
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   gene            complement(<1443417..1445599)
FT                   /locus_tag="mCG_52285"
FT                   /note="gene_id=mCG52285.1"
FT   mRNA            complement(join(<1443417..1444465,1445091..1445599))
FT                   /locus_tag="mCG_52285"
FT                   /product="mCG52285"
FT                   /note="gene_id=mCG52285.1 transcript_id=mCT52468.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1443417..1444465,1445091..1445259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52285"
FT                   /product="mCG52285"
FT                   /note="gene_id=mCG52285.1 transcript_id=mCT52468.1
FT                   protein_id=mCP31939.2"
FT                   /protein_id="EDL41405.1"
FT                   /translation="MSSVSEVNADIRDFLMSINLEQYLLHFREFGFYTVRDCTSINDSV
FT                   LHQIGISPTGHQEELHQNVDSSKDSLFGGVNVKIDPLITKRAVEYTAGEEHTEKGNLTS
FT                   EDYSKALSTNTECLPSGDCPTSGTHSGNGTNGVLESFPPTPFFQFQGEMVVNELYVPSS
FT                   PVHGPMRSRSKLVSRPSRSFLLRHRSVPEIPGSTKSIPGSYFRDRRSNTTSAGKSLTLK
FT                   NSNEDNSTSIFPYGETFLFQRLESSKKRSIKNEFWPHENTVKEEAATTRNSILTQSSIY
FT                   DNRKEKVSEDKVEDIWIPREDKNNLAQDSASESEYSTVEECFQSLRRKNSKASKSRTQK
FT                   AFYLDPFNRHSYPLSSMSGNTEPSSTISNAISPYACFYGSSAAKEKCGWLDKLSPQGYG
FT                   QMHFVY"
FT   assembly_gap    1444555..1445064
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   gene            complement(1449997..1483673)
FT                   /locus_tag="mCG_12892"
FT                   /note="gene_id=mCG12892.1"
FT   mRNA            complement(join(1449997..1450249,1455339..1455459,
FT                   1459212..1459331,1463006..1463059,1465014..1465157,
FT                   1469196..1469305,1483278..1483673))
FT                   /locus_tag="mCG_12892"
FT                   /product="mCG12892"
FT                   /note="gene_id=mCG12892.1 transcript_id=mCT13607.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1450119..1450249,1455339..1455459,
FT                   1459212..1459331,1463006..1463059,1465014..1465157,
FT                   1469196..1469255))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12892"
FT                   /product="mCG12892"
FT                   /note="gene_id=mCG12892.1 transcript_id=mCT13607.2
FT                   protein_id=mCP9886.1"
FT                   /db_xref="GOA:G5E851"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:1916619"
FT                   /db_xref="UniProtKB/TrEMBL:G5E851"
FT                   /protein_id="EDL41406.1"
FT                   /translation="MSINEVSTFYIIKEDTIAMGGAQIMLGLIHNALGTLWLSLHNLED
FT                   KRYSIGHKLMLASICYLFVSGTFFINSGSSSITQGISSVFQHMFAIITNIISIFVAIFG
FT                   LILLGYEFPIFESIGTEYIWSNMAGMMLLQISVMCAITELVIAILVLHWFITAHKIEEP
FT                   SEEIFSGPSHSHLSSPPSTQPSMLELENVSEQSHPKDIEDENDVTN"
FT   assembly_gap    1453391..1453410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1466407..1466426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1480891..1480910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1482203..1482263
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    1491509..1491542
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(1492344..1516508)
FT                   /gene="1700025F22Rik"
FT                   /locus_tag="mCG_12890"
FT                   /note="gene_id=mCG12890.1"
FT   mRNA            complement(join(1492344..1492487,1494208..1494319,
FT                   1495018..1495134,1499417..1499473,1514514..1514605,
FT                   1516086..1516165,1516387..1516508))
FT                   /gene="1700025F22Rik"
FT                   /locus_tag="mCG_12890"
FT                   /product="RIKEN cDNA 1700025F22"
FT                   /note="gene_id=mCG12890.1 transcript_id=mCT13605.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1494212..1494319,1495018..1495134,
FT                   1499417..1499473,1514514..1514567))
FT                   /codon_start=1
FT                   /gene="1700025F22Rik"
FT                   /locus_tag="mCG_12890"
FT                   /product="RIKEN cDNA 1700025F22"
FT                   /note="gene_id=mCG12890.1 transcript_id=mCT13605.2
FT                   protein_id=mCP9908.1"
FT                   /db_xref="GOA:Q9D9Y7"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:1916666"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9Y7"
FT                   /protein_id="EDL41407.1"
FT                   /translation="MNMPQNRLWIKKELRVLGFSLSGSLSIILQKRPSNHTLIWTMTMN
FT                   ILSIFATLVGLFLTTVEMIVTSSVYSTLWQYKSGRVLTEYLFLFSMLELFMASIVTEWT
FT                   YRARQIE"
FT   assembly_gap    1510868..1510887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1520533..1547861)
FT                   /gene="1700060E18Rik"
FT                   /locus_tag="mCG_12891"
FT                   /note="gene_id=mCG12891.1"
FT   mRNA            complement(join(1520533..1521111,1535006..1535125,
FT                   1544071..1544156,1547658..1547861))
FT                   /gene="1700060E18Rik"
FT                   /locus_tag="mCG_12891"
FT                   /product="RIKEN cDNA 1700060E18, transcript variant
FT                   mCT13606"
FT                   /note="gene_id=mCG12891.1 transcript_id=mCT13606.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1520534..1521111,1523646..1523741,
FT                   1535006..1535125,1536304..1536360,1542581..1542721,
FT                   1544041..1544156,1547658..>1547851))
FT                   /gene="1700060E18Rik"
FT                   /locus_tag="mCG_12891"
FT                   /product="RIKEN cDNA 1700060E18, transcript variant
FT                   mCT194111"
FT                   /note="gene_id=mCG12891.1 transcript_id=mCT194111.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1521052..1521111,1523646..1523741,
FT                   1535006..1535125,1536304..1536360,1542581..1542721,
FT                   1544041..>1544142))
FT                   /codon_start=1
FT                   /gene="1700060E18Rik"
FT                   /locus_tag="mCG_12891"
FT                   /product="RIKEN cDNA 1700060E18, isoform CRA_a"
FT                   /note="gene_id=mCG12891.1 transcript_id=mCT194111.0
FT                   protein_id=mCP115048.0 isoform=CRA_a"
FT                   /protein_id="EDL41408.1"
FT                   /translation="RYPRRLETKSTRGNSESMECRNPKVSSANITVLGVIQIMIGIYHV
FT                   LMWYFLLLLYMGQIKGVFGTYEPVTYKMGTSLWGFAFVISGAFTVKAAKYQSRHMILCT
FT                   MSLNILCIIITIVAASLTIVELSHFRSVSYRNYGQAKLGREVSRVLLCSYPLEFAIALL
FT                   YSISSCAYLAGNQEETLESVTEVVEGNS"
FT   CDS             complement(join(1521052..1521111,1535006..1535125,
FT                   1544071..1544091))
FT                   /codon_start=1
FT                   /gene="1700060E18Rik"
FT                   /locus_tag="mCG_12891"
FT                   /product="RIKEN cDNA 1700060E18, isoform CRA_b"
FT                   /note="gene_id=mCG12891.1 transcript_id=mCT13606.2
FT                   protein_id=mCP9882.2 isoform=CRA_b"
FT                   /protein_id="EDL41409.1"
FT                   /translation="MECRNPKILCTMSLNILCIIITIVAASLTIVELSHFRSVSYRNYG
FT                   QAAGNQEETLESVTEVVEGNS"
FT   assembly_gap    1539050..1539181
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            1547929..1639295
FT                   /locus_tag="mCG_148465"
FT                   /note="gene_id=mCG148465.0"
FT   mRNA            join(1547929..1548077,1632047..1632219,1638595..1639295)
FT                   /locus_tag="mCG_148465"
FT                   /product="mCG148465"
FT                   /note="gene_id=mCG148465.0 transcript_id=mCT188728.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    1549292..1549451
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    1551120..1553750
FT                   /estimated_length=2631
FT                   /gap_type="unknown"
FT   assembly_gap    1556518..1556537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1580979..1581766
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    1592313..1592332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1593867..1602804)
FT                   /gene="Ms4a1"
FT                   /locus_tag="mCG_12899"
FT                   /note="gene_id=mCG12899.4"
FT   mRNA            complement(join(1593867..1595930,1597226..1597327,
FT                   1598502..1598738,1600541..1600600,1602101..1602220,
FT                   1602652..1602804))
FT                   /gene="Ms4a1"
FT                   /locus_tag="mCG_12899"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   1, transcript variant mCT13614"
FT                   /note="gene_id=mCG12899.4 transcript_id=mCT13614.3 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(1593867..1595930,1597226..1597602))
FT                   /gene="Ms4a1"
FT                   /locus_tag="mCG_12899"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   1, transcript variant mCT194122"
FT                   /note="gene_id=mCG12899.4 transcript_id=mCT194122.1 created
FT                   on 28-SEP-2004"
FT   CDS             complement(join(1595712..1595930,1597226..1597327,
FT                   1598502..1598738,1600541..1600600,1602101..1602220,
FT                   1602652..1602789))
FT                   /codon_start=1
FT                   /gene="Ms4a1"
FT                   /locus_tag="mCG_12899"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG12899.4 transcript_id=mCT13614.3
FT                   protein_id=mCP9907.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q542S5"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="InterPro:IPR030418"
FT                   /db_xref="MGI:MGI:88321"
FT                   /db_xref="UniProtKB/TrEMBL:Q542S5"
FT                   /protein_id="EDL41412.1"
FT                   /translation="MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKAL
FT                   GAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRK
FT                   SLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEP
FT                   SNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVV
FT                   LLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQE
FT                   SLPVENEIAP"
FT   CDS             complement(join(1595712..1595930,1597226..1597312))
FT                   /codon_start=1
FT                   /gene="Ms4a1"
FT                   /locus_tag="mCG_12899"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG12899.4 transcript_id=mCT194122.1
FT                   protein_id=mCP115111.1 isoform=CRA_a"
FT                   /protein_id="EDL41411.1"
FT                   /translation="MLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIK
FT                   MKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP"
FT   assembly_gap    1599198..1599257
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1605824..1613970
FT                   /estimated_length=8147
FT                   /gap_type="unknown"
FT   gene            complement(<1616093..1623414)
FT                   /gene="Ms4a5"
FT                   /locus_tag="mCG_128843"
FT                   /note="gene_id=mCG128843.2"
FT   mRNA            complement(join(<1616093..1616245,1617169..1617225,
FT                   1618763..1618891,1623155..1623414))
FT                   /gene="Ms4a5"
FT                   /locus_tag="mCG_128843"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   5, transcript variant mCT194530"
FT                   /note="gene_id=mCG128843.2 transcript_id=mCT194530.0
FT                   created on 28-SEP-2004"
FT   mRNA            complement(join(1616093..1616245,1617169..1617225,
FT                   1617444..1617580,1618763..1618891,1623155..1623414))
FT                   /gene="Ms4a5"
FT                   /locus_tag="mCG_128843"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   5, transcript variant mCT130148"
FT                   /note="gene_id=mCG128843.2 transcript_id=mCT130148.2
FT                   created on 28-SEP-2004"
FT   CDS             complement(join(<1616093..1616245,1617169..1617225,
FT                   1618763..1618891,1623155..1623307))
FT                   /codon_start=1
FT                   /gene="Ms4a5"
FT                   /locus_tag="mCG_128843"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG128843.2 transcript_id=mCT194530.0
FT                   protein_id=mCP115559.0 isoform=CRA_a"
FT                   /protein_id="EDL41413.1"
FT                   /translation="MDSKNVHSPLFLVFPPEVTTQEYQTTELTATAYNPQNRVQKIIIR
FT                   KLEILGTTQILFGIMNFSFGVIFLFTLVNPYPRFPFIFISGYPFWGSVLFINSGAFLIA
FT                   LKRKTTDTLIKMSRAMNLLSALGAAAGIILLIFGFLLDGEFICGYSPDGMQCGVITILF
FT                   I"
FT   CDS             complement(join(1617560..1617580,1618763..1618891,
FT                   1623155..1623307))
FT                   /codon_start=1
FT                   /gene="Ms4a5"
FT                   /locus_tag="mCG_128843"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   5, isoform CRA_b"
FT                   /note="gene_id=mCG128843.2 transcript_id=mCT130148.2
FT                   protein_id=mCP63871.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A087WNU2"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="InterPro:IPR030426"
FT                   /db_xref="MGI:MGI:2670985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WNU2"
FT                   /protein_id="EDL41414.1"
FT                   /translation="MDSKNVHSPLFLVFPPEVTTQEYQTTELTATAYNPQNRVQKIIIR
FT                   KLEILGTTQILFGIMNFSFGVIFLFTLVNPYPRFPFIFISGYPFWGSVLNKLVGL"
FT   assembly_gap    1618687..1618706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1624261..1624510
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   CDS             join(1632079..1632219,1638595..1638618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148465"
FT                   /product="mCG148465"
FT                   /note="gene_id=mCG148465.0 transcript_id=mCT188728.0
FT                   protein_id=mCP109164.0"
FT                   /protein_id="EDL41410.1"
FT                   /translation="MRAAGQPQQFGEPMQNLGMAEDIWKKHCWFVAPRKKKRIKENSFL
FT                   EKVSQRPSS"
FT   gene            complement(<1640903..>1653737)
FT                   /locus_tag="mCG_128838"
FT                   /note="gene_id=mCG128838.0"
FT   mRNA            complement(join(<1640903..1644031,1651696..1651824,
FT                   1653600..>1653737))
FT                   /locus_tag="mCG_128838"
FT                   /product="mCG128838"
FT                   /note="gene_id=mCG128838.0 transcript_id=mCT130143.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(1640903..1644031,1651696..1651824,
FT                   1653600..1653737))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128838"
FT                   /product="mCG128838"
FT                   /note="gene_id=mCG128838.0 transcript_id=mCT130143.0
FT                   protein_id=mCP64253.0"
FT                   /protein_id="EDL41415.1"
FT                   /translation="MESPSEEKRRNHVITIDPNETVLTAYPYRPHSSLLDFLKGEPKLL
FT                   GAIQILLSLVIVGFGNILALNFTFSSKEFPLVILTGYPFWGAVIAVFFFPSEGAQNTEH
FT                   PAPEENNTLQFEFQEKSSKDNTASSIKSVFLGGYAFFKLRVSRISSTPKTIQQKSDKGT
FT                   SFMYVPEEQEATPPLSPEQEIKLNALPPPLTPYPSENIPSQKDSTTDHLNDADLSSIIH
FT                   QTSDMQSNLLDYENASVTRFKTPSSHNSLHFSPANLSSQSLMASLSTQVLQYKQPSFHI
FT                   SQSYDLISEYFLSENIPFQDNQSQDTPSQYTPSQDIQFQDMLAQDISFQEIQSQESPNQ
FT                   DVLYQETPPQETPSQGTPYQDLPYQVLLIKDTSPQGTPYQYILTKEIPFQETPSQGTLS
FT                   QESPSQWTLSKGTPSQGTSPKGTPSQVTPPQGTPSQGTPSEGTSLQVSPSEVTPPQGTP
FT                   SEVTPSQGTPSEGTSLQVSPSEVTPPQGTPSEMTPPQGTPSEGTSPQGTPSEETPPQGT
FT                   PSEGTLPQGTPSQGTPPQGTPSEGTPPQGTPSQGTPPQGTPSEGTPSQETLPRETPSEG
FT                   TPPQGTPSEGTPSQETVPQETPPQKLSFQDILTKDRSSQETAYQENPFQDLVTQNRPSQ
FT                   DSQYKETPSQEIFFQDTPFQNTPSQNIQYQDILSQDKISQGSQTQNSVSQEMASSDLQV
FT                   LNTQVQIQQYPEVFYRDIRTEVMELTQEWKSNQGKKPTRRLSLSLPGKHGQVHPKRYSV
FT                   DLQVKSEKPRRYSEDLQSKTSRRKSIDQQIKAWISPKKNTTEKQDAYTQTTDQLPHQQA
FT                   EDQQTEDQQAQDQQADDQQAKEEVPVQQSQDEQIKDQKSIENLLPEEHPNDREDEGQQS
FT                   DKEQPPEEQAQVQPVEDQQPKEQKAPNTQLQNWQGGQVLVKRAPRQLCDNWETQSFQFT
FT                   EKSCSFWSTPSWQPISQRSQDWISQGWRNKDWKAQEWQFEVKPSLDWESQELLERESLR
FT                   QRALYQQIQPQTTIVHQTPGHQLQNYIFQVGLCQGSRQQDSESGVLIEDVNEDDVQSRE
FT                   REPENTEETCQKPTDQQSEDMRPDNYPVSCQSLVPYTYVTCLSNIASEQEVQNNTPCSG
FT                   SSKDLNTTSSTSYQRDQQQSEDSD"
FT   gene            complement(1660438..>1674149)
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /note="gene_id=mCG12902.1"
FT   mRNA            complement(join(1660438..1660984,1661701..1661820,
FT                   1663824..1664030,1667376..1667501,1672660..1672819,
FT                   1673769..1674149))
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, transcript variant mCT13617"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT13617.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1660439..1660984,1661701..1661820,
FT                   1663824..1664030,1665209..1665265,1667376..1667501,
FT                   1672660..1672819,1673769..>1674149))
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, transcript variant mCT194024"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT194024.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1660441..1660984,1661701..1661802,
FT                   1663824..1664030,1665209..1665265,1667376..1667501,
FT                   1672660..1672819,1673769..>1674149))
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, transcript variant mCT194025"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT194025.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1660919..1660984,1661701..1661802,
FT                   1663824..1664030,1665209..1665265,1667376..1667501,
FT                   1672660..1672819,1673769..>1673857))
FT                   /codon_start=1
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, isoform CRA_c"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT194025.0
FT                   protein_id=mCP114989.0 isoform=CRA_c"
FT                   /protein_id="EDL41418.1"
FT                   /translation="LMLQIQPTFGFQCSAIPICPTGNKNPGFICIPGTMRLQLGTKNIG
FT                   WDCFPKDIIIHKREKTGHTYEKEDDLLIGVPSEATVLGTIQLLCALILASFGGILVSAS
FT                   YFNPEVSTTLISGYLFIGSLCFAIAGILSIISEKISTKPFALSSLASNVASSVVAVIGL
FT                   FLFTYCLIALGSAFPHCNSEKKFLSLLSYLKSHHWKNEDKNCYLAYVGAMSALGMMLLF
FT                   TVLEVFLAGYSSIFWWKQVYSNKPGGTFFLPQSQDHTQLVKSNLLQ"
FT   CDS             complement(join(1660919..1660984,1661701..1661820,
FT                   1663824..1664030,1665209..1665265,1667376..1667501,
FT                   1672660..1672819,1673769..>1673857))
FT                   /codon_start=1
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, isoform CRA_b"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT194024.0
FT                   protein_id=mCP114988.0 isoform=CRA_b"
FT                   /protein_id="EDL41417.1"
FT                   /translation="LMLQIQPTFGFQCSAIPICPTGNKNPGFICIPGTMRLQLGTKNIG
FT                   WDCFPKDIIIHKREKTGHTYEKEDDLLIGVPSEATVLGTIQLLCALILASFGGILVSAS
FT                   YFNPEVSTTLISGYLFIGSLCFAIAGILSIISEKISTKPFALSSLASNVASSVVAVIGL
FT                   FLFTYCLIALGSAFPHCNSEKKFLSLLSYLKSHHWKNEDKNCYLAYVGAMACAALQSAL
FT                   GMMLLFTVLEVFLAGYSSIFWWKQVYSNKPGGTFFLPQSQDHTQLVKSNLLQ"
FT   CDS             complement(join(1660919..1660984,1661701..1661820,
FT                   1663824..1664030,1667376..1667501,1672660..1672819,
FT                   1673769..1673854))
FT                   /codon_start=1
FT                   /gene="Ms4a7"
FT                   /locus_tag="mCG_12902"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   7, isoform CRA_a"
FT                   /note="gene_id=mCG12902.1 transcript_id=mCT13617.1
FT                   protein_id=mCP9823.2 isoform=CRA_a"
FT                   /protein_id="EDL41416.1"
FT                   /translation="MLQIQPTFGFQCSAIPICPTGNKNPGFICIPGTMRLQLGTKNIGW
FT                   DCFPKDIIIHKREKTGHTYEKEDDLLIGVPSEATVLGTIQLLCALILASFGGILVSASY
FT                   FNPEVSTTLISGYLFIGSLCALSSLASNVASSVVAVIGLFLFTYCLIALGSAFPHCNSE
FT                   KKFLSLLSYLKSHHWKNEDKNCYLAYVGAMACAALQSALGMMLLFTVLEVFLAGYSSIF
FT                   WWKQVYSNKPGGTFFLPQSQDHTQLVKSNLLQ"
FT   assembly_gap    1665333..1665352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1683349..1683490
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    1700638..1700657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1701784..1703522
FT                   /locus_tag="mCG_1045240"
FT                   /note="gene_id=mCG1045240.0"
FT   mRNA            join(1701784..1701823,1702870..1703522)
FT                   /locus_tag="mCG_1045240"
FT                   /product="mCG1045240"
FT                   /note="gene_id=mCG1045240.0 transcript_id=mCT162944.0
FT                   created on 02-OCT-2002"
FT   CDS             join(1701798..1701823,1702870..1703002)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045240"
FT                   /product="mCG1045240"
FT                   /note="gene_id=mCG1045240.0 transcript_id=mCT162944.0
FT                   protein_id=mCP64214.1"
FT                   /protein_id="EDL41419.1"
FT                   /translation="MLCHSGSDSCMCLCMCIHAYCRGQKKADMSLLISVLETEFWTPAR
FT                   AANHFNH"
FT   gene            1718253..>1732304
FT                   /locus_tag="mCG_128842"
FT                   /note="gene_id=mCG128842.1"
FT   mRNA            join(1718253..1718412,1720840..1720968,1725900..1725956,
FT                   1729778..1729879,1732188..>1732304)
FT                   /locus_tag="mCG_128842"
FT                   /product="mCG128842"
FT                   /note="gene_id=mCG128842.1 transcript_id=mCT130147.1
FT                   created on 02-OCT-2002"
FT   CDS             join(1718269..1718412,1720840..1720968,1725900..1725956,
FT                   1729778..1729879,1732188..>1732304)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128842"
FT                   /product="mCG128842"
FT                   /note="gene_id=mCG128842.1 transcript_id=mCT130147.1
FT                   protein_id=mCP63852.1"
FT                   /protein_id="EDL41420.1"
FT                   /translation="MLVIQGTEQSALEAGYGAQQNGQPLYVNSHSWKRMTEKFLKGEPK
FT                   ILGIVQIVIAIMNLSIGIMMIIATVSTGEIPPSSVYIGYPIWGSLMFIISGSFSIVAGR
FT                   RTTKGLGLDIVVVVLSVLEFCIGVSLSAFGCRVMCCNPGGVMIIMPSNPTKAETANPVT
FT                   LQSGLMPPEHQERNVPENMH"
FT   assembly_gap    1732536..1733709
FT                   /estimated_length=1174
FT                   /gap_type="unknown"
FT   assembly_gap    1740576..1740891
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    1741742..1744233
FT                   /estimated_length=2492
FT                   /gap_type="unknown"
FT   gene            1749012..1760963
FT                   /locus_tag="mCG_12897"
FT                   /note="gene_id=mCG12897.1"
FT   mRNA            join(1749012..1749186,1750564..1750683,1751878..1751934,
FT                   1753229..1753354,1755494..1755595,1760432..1760963)
FT                   /locus_tag="mCG_12897"
FT                   /product="mCG12897"
FT                   /note="gene_id=mCG12897.1 transcript_id=mCT13612.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(1749052..1749186,1750564..1750683,1751878..1751934,
FT                   1753229..1753354,1755494..1755595,1760432..1760572)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12897"
FT                   /product="mCG12897"
FT                   /note="gene_id=mCG12897.1 transcript_id=mCT13612.1
FT                   protein_id=mCP9878.2"
FT                   /db_xref="GOA:Q9D3F6"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:1927656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3F6"
FT                   /protein_id="EDL41421.1"
FT                   /translation="MQGQEQTTMAVVPGGAPPSENSVMKSQMWNENKEKFLKGEPKVLG
FT                   VVQVMIALINLSFGIIILANLSSEPLISVVLMAPIWGPIMFIVSGSLSIAAGVKPTKSL
FT                   IISSLTLNTITSVLAATASIMGVVSVAVGSQFPFRYNYTITKGLDILMLILNMLEFCIA
FT                   VSISAFGCKASCCNSSEVLVVLPSNPAVTVMAPPVTLQPLPPSEHQGKNVPENVYKNHS
FT                   EEIV"
FT   gene            <1771679..>1772833
FT                   /locus_tag="mCG_20342"
FT                   /note="gene_id=mCG20342.1"
FT   mRNA            join(<1771679..1771740,1772332..>1772833)
FT                   /locus_tag="mCG_20342"
FT                   /product="mCG20342"
FT                   /note="gene_id=mCG20342.1 transcript_id=mCT20337.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(1771679..1771740,1772332..1772833)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20342"
FT                   /product="mCG20342"
FT                   /note="gene_id=mCG20342.1 transcript_id=mCT20337.1
FT                   protein_id=mCP13424.1"
FT                   /protein_id="EDL41422.1"
FT                   /translation="MKTRRILSQAASQFLCPMGSRHAPFDLFENRKKKNNIKLYVRRVF
FT                   IMDNCEELIPEYLNFIRGVVDSEDLPLNISHEMLQQNKILKVIRKNLVKKFLELFTELA
FT                   EDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN
FT                   QKHIYFITGETKDQVANSAFVERL"
FT   gene            1777830..1797632
FT                   /gene="Ms4a4b"
FT                   /locus_tag="mCG_12908"
FT                   /note="gene_id=mCG12908.1"
FT   mRNA            join(1777830..1777889,1784123..1784282,1788738..1788857,
FT                   1791882..1791938,1793239..1793364,1795343..1795444,
FT                   1797045..1797632)
FT                   /gene="Ms4a4b"
FT                   /locus_tag="mCG_12908"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   4B"
FT                   /note="gene_id=mCG12908.1 transcript_id=mCT13623.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(1784148..1784282,1788738..1788857,1791882..1791938,
FT                   1793239..1793364,1795343..1795444,1797045..1797185)
FT                   /codon_start=1
FT                   /gene="Ms4a4b"
FT                   /locus_tag="mCG_12908"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   4B"
FT                   /note="gene_id=mCG12908.1 transcript_id=mCT13623.1
FT                   protein_id=mCP9836.1"
FT                   /db_xref="GOA:Q9ES61"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:1913083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ES61"
FT                   /protein_id="EDL41423.1"
FT                   /translation="MQGQEQTTMAVVPGVAVPSKNSVMTSQMWNEKKEKFLKGEPKVLG
FT                   VLQVMIAIINLSLGIIILTTLFSELPTSVMLMVPIWGSIMFIVSGSLSIAAGVTPTKCL
FT                   IVASLTLNTITSVLAATASIMGVVSVAVGSQFPFRYNYTITKGLDVLMLIFNMLEFCLA
FT                   VSVSAFGCEASCCNSREVLVVLPSNPVETVMAPPMTLQPLLPSEHQGTNVPGNVYKNHP
FT                   GEIV"
FT   assembly_gap    1786567..1786586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1803478..1815399
FT                   /locus_tag="mCG_12905"
FT                   /note="gene_id=mCG12905.1"
FT   mRNA            join(1803478..1803641,1805183..1805345,1806487..1806621,
FT                   1809369..1809425,1812263..1812469,1814396..1814496,
FT                   1815303..1815399)
FT                   /locus_tag="mCG_12905"
FT                   /product="mCG12905"
FT                   /note="gene_id=mCG12905.1 transcript_id=mCT13620.1 created
FT                   on 02-OCT-2002"
FT   gene            complement(1804251..>1818675)
FT                   /locus_tag="mCG_145645"
FT                   /note="gene_id=mCG145645.0"
FT   mRNA            complement(join(1804251..1805031,1810880..1810924,
FT                   1818544..>1818675))
FT                   /locus_tag="mCG_145645"
FT                   /product="mCG145645"
FT                   /note="gene_id=mCG145645.0 transcript_id=mCT185069.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1804843..1805031,1810880..>1810894))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145645"
FT                   /product="mCG145645"
FT                   /note="gene_id=mCG145645.0 transcript_id=mCT185069.0
FT                   protein_id=mCP105517.0"
FT                   /protein_id="EDL41425.1"
FT                   /translation="KLQLQREEVEEEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKSWM
FT                   GGEDLGNGESETTIRVHYMNFQ"
FT   CDS             join(1805199..1805345,1806487..1806621,1809369..1809425,
FT                   1812263..1812469,1814396..1814496,1815303..1815309)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12905"
FT                   /product="mCG12905"
FT                   /note="gene_id=mCG12905.1 transcript_id=mCT13620.1
FT                   protein_id=mCP9832.1"
FT                   /protein_id="EDL41424.1"
FT                   /translation="MIPQVVTNETITTISPNGINFPQKDESQPTQQRQDSLKKHLKAEI
FT                   KVIVAIQIMCAVTVLALGIILASVPPVPYFNSVFSVLLKSGYPFIGALFFIASGILSII
FT                   TERKSTKPLVDASLTLNILSVSFAFVGIIIISVSLAGLHPASEQCKQSKELSLIEHDYY
FT                   QPFYNSDRSECAVTKSILTGALSVMLIISVLELGLALLSAMLWLREGVLTSLRM"
FT   gene            1820019..1821231
FT                   /locus_tag="mCG_1045241"
FT                   /note="gene_id=mCG1045241.0"
FT   mRNA            join(1820019..1820368,1820950..1821231)
FT                   /locus_tag="mCG_1045241"
FT                   /product="mCG1045241"
FT                   /note="gene_id=mCG1045241.0 transcript_id=mCT162945.0
FT                   created on 02-OCT-2002"
FT   CDS             1820060..1820239
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045241"
FT                   /product="mCG1045241"
FT                   /note="gene_id=mCG1045241.0 transcript_id=mCT162945.0
FT                   protein_id=mCP64217.1"
FT                   /protein_id="EDL41426.1"
FT                   /translation="MFGKGLNRTQWTVDNTLCYWDNWPPCTGHHLLNTTSSGILVASCC
FT                   FLEPTERASQFLLD"
FT   assembly_gap    1822787..1822806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1826183..1845842
FT                   /locus_tag="mCG_128847"
FT                   /note="gene_id=mCG128847.0"
FT   mRNA            join(1826183..1826258,1836294..1836414,1838932..1838988,
FT                   1840289..1840421,1842425..1842526,1845716..1845842)
FT                   /locus_tag="mCG_128847"
FT                   /product="mCG128847"
FT                   /note="gene_id=mCG128847.0 transcript_id=mCT130152.1
FT                   created on 02-OCT-2002"
FT   CDS             join(1836343..1836414,1838932..1838988,1840289..1840402)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128847"
FT                   /product="mCG128847"
FT                   /note="gene_id=mCG128847.0 transcript_id=mCT130152.1
FT                   protein_id=mCP63934.1"
FT                   /db_xref="GOA:A0A087WS47"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="MGI:MGI:3645380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WS47"
FT                   /protein_id="EDL41427.1"
FT                   /translation="MINMDLDGPVFSVILLVPIWGPIMFIVSGSLSIAAGVKTTKSLVI
FT                   SSLTVNTITSVDSVGCGSNHYWCHQCGCGYIFSPF"
FT   gene            complement(1845889..1846743)
FT                   /locus_tag="mCG_1045242"
FT                   /note="gene_id=mCG1045242.1"
FT   mRNA            complement(1845889..1846743)
FT                   /locus_tag="mCG_1045242"
FT                   /product="mCG1045242"
FT                   /note="gene_id=mCG1045242.1 transcript_id=mCT162946.1
FT                   created on 02-OCT-2002"
FT   CDS             complement(1846251..1846397)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045242"
FT                   /product="mCG1045242"
FT                   /note="gene_id=mCG1045242.1 transcript_id=mCT162946.1
FT                   protein_id=mCP64228.1"
FT                   /protein_id="EDL41428.1"
FT                   /translation="MNMFVYLRIRHSDFNHSLYCNFSIYQLKYALCYYMMRMHTEIKIG
FT                   CYH"
FT   gene            1852762..1864123
FT                   /locus_tag="mCG_12901"
FT                   /note="gene_id=mCG12901.1"
FT   mRNA            join(1852762..1852808,1854379..1854541,1855727..1855861,
FT                   1857966..1858022,1860756..1860953,1862630..1862731,
FT                   1863544..1864123)
FT                   /locus_tag="mCG_12901"
FT                   /product="mCG12901"
FT                   /note="gene_id=mCG12901.1 transcript_id=mCT13616.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(1854395..1854541,1855727..1855861,1857966..1858022,
FT                   1860756..1860953,1862630..1862731,1863544..1863639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12901"
FT                   /product="mCG12901"
FT                   /note="gene_id=mCG12901.1 transcript_id=mCT13616.1
FT                   protein_id=mCP9810.2"
FT                   /protein_id="EDL41429.1"
FT                   /translation="MIPQVVTSETVAMISPNGMSLPQTDKPQPFHQWQDSLKKHLKAEI
FT                   KVMAAIQIMCAVMVLSLGIILASVPSNLHFTSVFSVLLKSGYPFVGALFFIVSGILSIV
FT                   TETKSTKILVDSSLTLNILSVSFAFMGIIIISVSLAGLHPASEQCLQSKELRPTEYHYY
FT                   QFLDRNECFAAKSVLAGVFSLMLISTMLELGLAVLTAMLWWKQSHSNIPGNVMFLPHSS
FT                   NNDSNMESKVLCNPSYEEQLVC"
FT   gene            <1870858..1896508
FT                   /locus_tag="mCG_12900"
FT                   /note="gene_id=mCG12900.1"
FT   mRNA            join(<1870858..1871222,1883314..1883473,1885093..1885212,
FT                   1887659..1887715,1892846..1892968,1894234..1894335,
FT                   1895920..1896508)
FT                   /locus_tag="mCG_12900"
FT                   /product="mCG12900"
FT                   /note="gene_id=mCG12900.1 transcript_id=mCT13615.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(<1871158..1871222,1883314..1883473,1885093..1885212,
FT                   1887659..1887715,1892846..1892968,1894234..1894335,
FT                   1895920..1896060)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12900"
FT                   /product="mCG12900"
FT                   /note="gene_id=mCG12900.1 transcript_id=mCT13615.1
FT                   protein_id=mCP9909.1"
FT                   /protein_id="EDL41430.1"
FT                   /translation="KPSSSIPTNRVPHRNSTTLLKDTVSAALETMQGLAQTTMAVVPGG
FT                   APPSENSVIKSQMWNKNKEKFLKGEPKVLGAIQVMIAFINFSLGIIIILNRVSERFMSV
FT                   LLLAPFWGSIMFIFSGSLSIAAGVKPTKAMIISSLSVNTISSVLAVAASIIGVISVISG
FT                   VFRQFRSQPAIASLDVLMTILNMLEFCIAVSVSAFGCKASCCNSSEVLVVLPSNSAVTV
FT                   TAPPMILQPLPPSECQGKNVPENLYRNQPGEIV"
FT   assembly_gap    1871312..1872143
FT                   /estimated_length=832
FT                   /gap_type="unknown"
FT   assembly_gap    1888205..1888224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1889857..1889876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890888..1890907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1897381..1897823
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    1898796..1899883
FT                   /estimated_length=1088
FT                   /gap_type="unknown"
FT   assembly_gap    1915556..1915575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1924350..1924549
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   gene            complement(1924923..1938084)
FT                   /locus_tag="mCG_12912"
FT                   /note="gene_id=mCG12912.1"
FT   mRNA            complement(join(1924923..1925396,1926332..1926384,
FT                   1928309..1928515,1935130..1935261,1936443..1936605,
FT                   1937971..1938034))
FT                   /locus_tag="mCG_12912"
FT                   /product="mCG12912, transcript variant mCT13627"
FT                   /note="gene_id=mCG12912.1 transcript_id=mCT13627.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1924925..1925499,1926283..1926384,
FT                   1928309..1928515,1935127..1935261,1936443..1936605,
FT                   1937971..1938084))
FT                   /locus_tag="mCG_12912"
FT                   /product="mCG12912, transcript variant mCT130142"
FT                   /note="gene_id=mCG12912.1 transcript_id=mCT130142.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1925393..1925396,1926332..1926384,
FT                   1928309..1928515,1935130..1935261,1936443..1936589))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12912"
FT                   /product="mCG12912, isoform CRA_b"
FT                   /note="gene_id=mCG12912.1 transcript_id=mCT13627.2
FT                   protein_id=mCP9863.2 isoform=CRA_b"
FT                   /protein_id="EDL41432.1"
FT                   /translation="MIPQVVTSETVTVISPNGISFPQTDKPQPSHQSQDSLKKHLKAEI
FT                   KVMAAIQIMCAVMVLALGIILASVPSNLHFTSVFSILLESGYPFVGALVHSSLALSILS
FT                   VLSALTGIAILSVSLAALEPALQQCKLAFTQLDTTQDAYHFFSPEPLNSCFVAKAALTG
FT                   VFSLMLISSVLELGLAV"
FT   CDS             complement(join(1925404..1925499,1926283..1926384,
FT                   1928309..1928515,1935127..1935261,1936443..1936589))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12912"
FT                   /product="mCG12912, isoform CRA_a"
FT                   /note="gene_id=mCG12912.1 transcript_id=mCT130142.1
FT                   protein_id=mCP63908.1 isoform=CRA_a"
FT                   /protein_id="EDL41431.1"
FT                   /translation="MIPQVVTSETVTVISPNGISFPQTDKPQPSHQSQDSLKKHLKAEI
FT                   KVMAAIQIMCAVMVLALGIILASVPSNLHFTSVFSILLESGYPFVGALFVHSSLALSIL
FT                   SVLSALTGIAILSVSLAALEPALQQCKLAFTQLDTTQDAYHFFSPEPLNSCFVAKAALT
FT                   GVFSLMLISSVLELGLAVLTATLWWKQSSSAFSGNVIFLSQNSKNKSSVSSESLCNPTY
FT                   ENILTS"
FT   assembly_gap    1931114..1931133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1950494..1956944)
FT                   /gene="Ms4a2"
FT                   /locus_tag="mCG_12896"
FT                   /note="gene_id=mCG12896.0"
FT   mRNA            complement(join(1950494..1950872,1951717..1951815,
FT                   1952155..1952310,1952918..1952974,1955344..1955478,
FT                   1955984..1956083,1956861..1956944))
FT                   /gene="Ms4a2"
FT                   /locus_tag="mCG_12896"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   2"
FT                   /note="gene_id=mCG12896.0 transcript_id=mCT13611.1 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(1950774..1950872,1951717..1951815,
FT                   1952155..1952310,1952918..1952974,1955344..1955478,
FT                   1955984..1956083,1956861..1956922))
FT                   /codon_start=1
FT                   /gene="Ms4a2"
FT                   /locus_tag="mCG_12896"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   2"
FT                   /note="gene_id=mCG12896.0 transcript_id=mCT13611.1
FT                   protein_id=mCP9871.2"
FT                   /db_xref="GOA:B2RTF7"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="InterPro:IPR030420"
FT                   /db_xref="MGI:MGI:95495"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTF7"
FT                   /protein_id="EDL41433.1"
FT                   /translation="MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTF
FT                   LKKELEFLGATQILVGLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSG
FT                   FLSIISERKNTLYLVRGSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGC
FT                   FVASFTTELVLMMLFLTILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSE
FT                   LEDKGETSSPVDS"
FT   assembly_gap    1959774..1959793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1962275..1962294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1962961..>1974262)
FT                   /gene="Ms4a3"
FT                   /locus_tag="mCG_12913"
FT                   /note="gene_id=mCG12913.3"
FT   mRNA            complement(join(1962961..1963221,1964809..1964910,
FT                   1966223..1966381,1969278..1969334,1971653..1971790,
FT                   1972639..1972748,1974094..1974216))
FT                   /gene="Ms4a3"
FT                   /locus_tag="mCG_12913"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   3, transcript variant mCT13628"
FT                   /note="gene_id=mCG12913.3 transcript_id=mCT13628.2 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(1962962..1963221,1964809..1964910,
FT                   1966223..1966381,1969278..1969334,1971653..1971790,
FT                   1972639..1972766,1974094..>1974262))
FT                   /gene="Ms4a3"
FT                   /locus_tag="mCG_12913"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   3, transcript variant mCT194067"
FT                   /note="gene_id=mCG12913.3 transcript_id=mCT194067.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1963123..1963221,1964809..1964910,
FT                   1966223..1966381,1969278..1969334,1971653..1971790,
FT                   1972639..1972766,1974094..>1974103))
FT                   /codon_start=1
FT                   /gene="Ms4a3"
FT                   /locus_tag="mCG_12913"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG12913.3 transcript_id=mCT194067.0
FT                   protein_id=mCP115049.0 isoform=CRA_b"
FT                   /protein_id="EDL41435.1"
FT                   /translation="ILQGLGISAGGTSSGRHMKPEETGGSVYQPLDESRHVQRGVLQAL
FT                   GAIQILNGILILALGIFLVCLQHVSHHFRHFFFFTFYTGYPLWGAVFFISSGSLTVAAG
FT                   RNPTRMLMQNSFGINIASTTIAFVGTVFLSVHLAFNTQAFKGCQSSPSPDVCISLGSSS
FT                   DGLVSLMLILTLLELSVTISISAMWCLGNVCGLREAITSPPNSVESGILPEGSDSENLN
FT                   TQPQASEE"
FT   CDS             complement(join(1963123..1963221,1964809..1964910,
FT                   1966223..1966381,1969278..1969334,1971653..1971790,
FT                   1972639..1972725))
FT                   /codon_start=1
FT                   /gene="Ms4a3"
FT                   /locus_tag="mCG_12913"
FT                   /product="membrane-spanning 4-domains, subfamily A, member
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG12913.3 transcript_id=mCT13628.2
FT                   protein_id=mCP9819.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q53ZU3"
FT                   /db_xref="InterPro:IPR007237"
FT                   /db_xref="InterPro:IPR030417"
FT                   /db_xref="InterPro:IPR030419"
FT                   /db_xref="MGI:MGI:2158468"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZU3"
FT                   /protein_id="EDL41434.1"
FT                   /translation="MKPEETGGSVYQPLDESRHVQRGVLQALGAIQILNGILILALGIF
FT                   LVCLQHVSHHFRHFFFFTFYTGYPLWGAVFFISSGSLTVAAGRNPTRMLMQNSFGINIA
FT                   STTIAFVGTVFLSVHLAFNTQAFKGCQSSPSPDVCISLGSSSDGLVSLMLILTLLELSV
FT                   TISISAMWCLGNVCGLREAITSPPNSVESGILPEGSDSENLNTQPQASEE"
FT   assembly_gap    1972328..1972398
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            complement(1980704..1993984)
FT                   /locus_tag="mCG_128852"
FT                   /note="gene_id=mCG128852.0"
FT   mRNA            complement(join(1980704..1980987,1983021..1983124,
FT                   1984901..1985082,1993880..1993984))
FT                   /locus_tag="mCG_128852"
FT                   /product="mCG128852"
FT                   /note="gene_id=mCG128852.0 transcript_id=mCT130157.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(1980843..1980987,1983021..1983124,
FT                   1984901..1985082,1993880..1993955))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128852"
FT                   /product="mCG128852"
FT                   /note="gene_id=mCG128852.0 transcript_id=mCT130157.0
FT                   protein_id=mCP64369.1"
FT                   /protein_id="EDL41436.1"
FT                   /translation="MGVSMALEVLVYLAVLVWTCAWDIDVDVSCSQDWMTVSVSAFSQN
FT                   KRNPYIFADELYLGQNCRVTQIHAHQYDFIYPVSHCGIRTKVISNEIVCFETEMYFRPR
FT                   NYCLELQIVPLQCSASRKSVWLMPLSTEEDPKPVKSPFMTDFEATPEELGLLNAHQAAS
FT                   SQNKR"
FT   assembly_gap    1985623..1985642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2000888..2026480)
FT                   /gene="Oosp1"
FT                   /locus_tag="mCG_12911"
FT                   /note="gene_id=mCG12911.2"
FT   mRNA            complement(join(2000888..2001250,2001725..2001844,
FT                   2022770..2022867,2024102..2024283,2026377..2026480))
FT                   /gene="Oosp1"
FT                   /locus_tag="mCG_12911"
FT                   /product="oocyte secreted protein 1"
FT                   /note="gene_id=mCG12911.2 transcript_id=mCT13626.2 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(2001118..2001250,2001725..2001844,
FT                   2022770..2022867,2024102..2024283,2026377..2026452))
FT                   /codon_start=1
FT                   /gene="Oosp1"
FT                   /locus_tag="mCG_12911"
FT                   /product="oocyte secreted protein 1"
FT                   /note="gene_id=mCG12911.2 transcript_id=mCT13626.2
FT                   protein_id=mCP9915.1"
FT                   /protein_id="EDL41437.1"
FT                   /translation="MKPFVGLLGLLLLLSFMKTCADDWTAISLQCADHWFHLRIRPTIF
FT                   HNIFMEPDEVFLGIGCPVTTTWPNDTYEFIYRTYSCGIANKVLCDVTLLKTQLTYISKN
FT                   ASLQAEMSLSCVMHNQSPHFCEAESRGDFTGDPPGWTEDMRARRDEQTVPMVQPNLSTS
FT                   SEDHHVSTEPWASETSRSEAAEVPSFMDQNFSVFHFSRM"
FT   assembly_gap    2005303..2007873
FT                   /estimated_length=2571
FT                   /gap_type="unknown"
FT   assembly_gap    2009237..2009391
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    2010266..2012301
FT                   /estimated_length=2036
FT                   /gap_type="unknown"
FT   gene            2032493..2047265
FT                   /locus_tag="mCG_124933"
FT                   /note="gene_id=mCG124933.0"
FT   mRNA            join(2032493..2032602,2034783..2034961,2036345..2036442,
FT                   2039307..2039363,2040786..2040897,2047024..2047265)
FT                   /locus_tag="mCG_124933"
FT                   /product="mCG124933"
FT                   /note="gene_id=mCG124933.0 transcript_id=mCT126185.0
FT                   created on 03-OCT-2002"
FT   CDS             join(2032530..2032602,2034783..2034961,2036345..2036442,
FT                   2039307..2039363,2040786..2040897,2047024..2047092)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124933"
FT                   /product="mCG124933"
FT                   /note="gene_id=mCG124933.0 transcript_id=mCT126185.0
FT                   protein_id=mCP64000.1"
FT                   /db_xref="GOA:G5E8D7"
FT                   /db_xref="InterPro:IPR033218"
FT                   /db_xref="InterPro:IPR033222"
FT                   /db_xref="MGI:MGI:2684943"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8D7"
FT                   /protein_id="EDL41438.1"
FT                   /translation="MKAFVASGLLLLIFGMWRCSGIEPVSMECDYFTFRVIAKRALFYP
FT                   DDLIGPDELLLGASCPVTSIRPDELEFYYDIHSCGTFIQHAFDGTIVNTWLTYMPRNIS
FT                   IYAELQLQCVIPRISQDELDNKQSSDECVGESESIDVGNLDFHPPPQCWFLVLKRYCII
FT                   CGHFHFPNNWLIPYHGWKDESFQRLWPSLFHR"
FT   assembly_gap    2069381..2069400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2083181..2098970
FT                   /gene="Gif"
FT                   /locus_tag="mCG_12895"
FT                   /note="gene_id=mCG12895.1"
FT   mRNA            join(2083181..2083260,2083962..2084138,2085213..2085326,
FT                   2085712..2085852,2087718..2087899,2093238..2093415,
FT                   2094465..2094666,2095828..2095946,2098720..2098970)
FT                   /gene="Gif"
FT                   /locus_tag="mCG_12895"
FT                   /product="gastric intrinsic factor"
FT                   /note="gene_id=mCG12895.1 transcript_id=mCT13610.1 created
FT                   on 03-OCT-2002"
FT   CDS             join(2083182..2083260,2083962..2084138,2085213..2085326,
FT                   2085712..2085852,2087718..2087899,2093238..2093415,
FT                   2094465..2094666,2095828..2095946,2098720..2098781)
FT                   /codon_start=1
FT                   /gene="Gif"
FT                   /locus_tag="mCG_12895"
FT                   /product="gastric intrinsic factor"
FT                   /note="gene_id=mCG12895.1 transcript_id=mCT13610.1
FT                   protein_id=mCP9851.0"
FT                   /db_xref="GOA:P52787"
FT                   /db_xref="InterPro:IPR002157"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="MGI:MGI:1202394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52787"
FT                   /protein_id="EDL41439.1"
FT                   /translation="MAWLTLYLLSVLWAVAGTSTRAQSSCSVPPDQQPWVDGLQALMEN
FT                   SVTDSDFPNPSILIAMNLAGAYNVEAQKLLTYQLMASDSADLTSGQLALTVMALTSSCR
FT                   DPGSKVSTLLKKMENWSPSSPGAESSAFYGPGLAILALCQKSSEATLPIAVRFAKTLMM
FT                   EPSPFNVDTGAVATLALTCMYNKIPVGSQENYRDLFGQALKAIVEKISLRIKADGIIGD
FT                   IYSTGLAMQALSVTPEQPTKKWDCEKTMHTILNEIKQGKFQNPMSIAQILPSLKGKTYL
FT                   DVPQVTCGPDHEVPPTLTDYPTPVPTSVSNITVIYTINNQLRGVDLLFNVTIEVSVKSG
FT                   SVLLAVLEEAQRKNSMFKFETTMTSWGLIVSSINNIAENVNHKTYWEFLSGKTPLDEGV
FT                   AYYIPFNHEHITANFTQY"
FT   gene            <2100916..>2101281
FT                   /locus_tag="mCG_49721"
FT                   /note="gene_id=mCG49721.0"
FT   mRNA            <2100916..>2101281
FT                   /locus_tag="mCG_49721"
FT                   /product="mCG49721"
FT                   /note="gene_id=mCG49721.0 transcript_id=mCT49904.0 created
FT                   on 03-OCT-2002"
FT   CDS             2100916..2101281
FT                   /codon_start=1
FT                   /locus_tag="mCG_49721"
FT                   /product="mCG49721"
FT                   /note="gene_id=mCG49721.0 transcript_id=mCT49904.0
FT                   protein_id=mCP31978.0"
FT                   /protein_id="EDL41440.1"
FT                   /translation="MKVMLNGTLTIGTMDGANVEMAEEAREENLFIFGMRVEDVEALDQ
FT                   KGYNAREFYERLPELRQVVDHQINSGFFSPKDPDCFKDVVNMLMYHSRYLQTMKPTSNA
FT                   RPRWTIYTAIPSSGQKR"
FT   gene            complement(2101683..2102196)
FT                   /locus_tag="mCG_1045244"
FT                   /note="gene_id=mCG1045244.1"
FT   mRNA            complement(2101683..2102196)
FT                   /locus_tag="mCG_1045244"
FT                   /product="mCG1045244"
FT                   /note="gene_id=mCG1045244.1 transcript_id=mCT162948.1
FT                   created on 03-OCT-2002"
FT   CDS             complement(2101726..2102124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045244"
FT                   /product="mCG1045244"
FT                   /note="gene_id=mCG1045244.1 transcript_id=mCT162948.1
FT                   protein_id=mCP64238.1"
FT                   /protein_id="EDL41441.1"
FT                   /translation="MKCYFLLKSKELSQPSIKLPVLNRGLSYGIKVSLSLFSAPLQGFW
FT                   VLLDTHRLPQMAKKHGLYGSTTHILSTVKGKGQKVVSMKPEAKVPPSRPTRPHTGAGCT
FT                   LQLVTQVLAEHRNTGFTTDPYSHPKLKA"
FT   gene            2105889..2110450
FT                   /gene="Mrpl16"
FT                   /locus_tag="mCG_12894"
FT                   /note="gene_id=mCG12894.1"
FT   mRNA            join(2105889..2106031,2106309..2106374,2108382..2108530,
FT                   2109655..2110450)
FT                   /gene="Mrpl16"
FT                   /locus_tag="mCG_12894"
FT                   /product="mitochondrial ribosomal protein L16, transcript
FT                   variant mCT13609"
FT                   /note="gene_id=mCG12894.1 transcript_id=mCT13609.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<2105919..2106031,2106309..2108530,2109655..2110298)
FT                   /gene="Mrpl16"
FT                   /locus_tag="mCG_12894"
FT                   /product="mitochondrial ribosomal protein L16, transcript
FT                   variant mCT194116"
FT                   /note="gene_id=mCG12894.1 transcript_id=mCT194116.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2105977..2106031,2106309..2106374,2108382..2108530,
FT                   2109655..2110140)
FT                   /codon_start=1
FT                   /gene="Mrpl16"
FT                   /locus_tag="mCG_12894"
FT                   /product="mitochondrial ribosomal protein L16, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12894.1 transcript_id=mCT13609.2
FT                   protein_id=mCP9841.2 isoform=CRA_a"
FT                   /protein_id="EDL41442.1"
FT                   /translation="MWRLLTRVPAPLLRMHFSDSWAALPTSAGLKTLLPVPTFENVSIP
FT                   ERSKLKFVERVPLVPKVRREPKNLKDIRGPSTEATDFTEGNFAILALGGGYLHWGHFEM
FT                   MRLTINRFMDPKNMFAIWRVPAPFKPITRKGVGQRMGGGKGAIDHYVTPVKTGCLVVEM
FT                   GGRCEFEEVKGILNQVAHKLPFPAKAVSRKTLERMHQNQRERELNNQNPWTFEHIATAN
FT                   MFGIRKFLSPYDLTQKGRYWGKFYMPKRV"
FT   CDS             join(<2108363..2108530,2109655..2110140)
FT                   /codon_start=1
FT                   /gene="Mrpl16"
FT                   /locus_tag="mCG_12894"
FT                   /product="mitochondrial ribosomal protein L16, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12894.1 transcript_id=mCT194116.0
FT                   protein_id=mCP115110.0 isoform=CRA_b"
FT                   /protein_id="EDL41443.1"
FT                   /translation="LSLLLLDVSIPERSKLKFVERVPLVPKVRREPKNLKDIRGPSTEA
FT                   TDFTEGNFAILALGGGYLHWGHFEMMRLTINRFMDPKNMFAIWRVPAPFKPITRKGVGQ
FT                   RMGGGKGAIDHYVTPVKTGCLVVEMGGRCEFEEVKGILNQVAHKLPFPAKAVSRKTLER
FT                   MHQNQRERELNNQNPWTFEHIATANMFGIRKFLSPYDLTQKGRYWGKFYMPKRV"
FT   gene            complement(2110625..>2154531)
FT                   /locus_tag="mCG_12909"
FT                   /note="gene_id=mCG12909.2"
FT   mRNA            complement(join(2110625..2112095,2112595..2112677,
FT                   2118323..2118433,2120916..2121050,2121211..2121284,
FT                   2122051..2122159,2123692..2123759,2125079..2125153,
FT                   2127233..2127332,2139199..2139282,2154383..2154530))
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, transcript variant mCT13624"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT13624.2 created
FT                   on 23-APR-2003"
FT   mRNA            complement(join(2110911..2112095,2112595..2112677,
FT                   2114582..2114696,2117090..2117203,2118323..2118433,
FT                   2118549..2118659,2120916..2121050,2121211..2121284,
FT                   2122051..2122159,2123692..2123759,2125079..2125153,
FT                   2125570..2125615,2127233..2127332,2139199..2139282,
FT                   2154383..2154531))
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, transcript variant mCT180704"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT180704.0 created
FT                   on 23-APR-2003"
FT   mRNA            complement(join(2112595..2112677,2118323..2118433,
FT                   2120916..2121050,2121211..2121284,2122051..2122159,
FT                   2123692..2123759,2125079..2125153,2125570..2125615,
FT                   2139199..2139282,2154383..>2154531))
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, transcript variant mCT194036"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT194036.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2112600..2112677,2118323..2118433,
FT                   2120916..2121050,2121211..2121284,2122051..2122159,
FT                   2123692..2123759,2125079..2125153,2125570..2125615,
FT                   2139199..2139282,2154383..>2154445))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, isoform CRA_c"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT194036.0
FT                   protein_id=mCP114992.0 isoform=CRA_c"
FT                   /protein_id="EDL41447.1"
FT                   /translation="DKAPAALTWARMKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDE
FT                   FFSENFHGILSYLLRLSSHETKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSA
FT                   DLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLE
FT                   SGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGAMI
FT                   DRIENNMDQSVGFVERAVADTKKAVKYQSEARRKKIMIMICCIILAIILASTIGGIFA"
FT   CDS             complement(join(2112600..2112677,2118323..2118433,
FT                   2120916..2121050,2121211..2121284,2122051..2122159,
FT                   2123692..2123759,2125079..2125153,2127233..2127332,
FT                   2139199..2139282,2154383..2154412))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, isoform CRA_a"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT13624.2
FT                   protein_id=mCP9884.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q64704"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR031186"
FT                   /db_xref="MGI:MGI:103077"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64704"
FT                   /protein_id="EDL41444.1"
FT                   /translation="MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLN
FT                   IDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEE
FT                   DEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDE
FT                   ELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLV
FT                   ENQGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARRKKIMIMICCIILAIILAST
FT                   IGGIFA"
FT   mRNA            complement(join(2114267..2114696,2117090..2117203,
FT                   2118323..2118433,2118549..2118659,2120916..2121050,
FT                   2121211..2121284,2122051..2122159,2123692..2123759,
FT                   2125079..2125153,2139199..2139282,2154383..2154531))
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, transcript variant mCT174029"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT174029.0 created
FT                   on 23-APR-2003"
FT   CDS             complement(join(2117120..2117203,2118323..2118433,
FT                   2118549..2118659,2120916..2121050,2121211..2121284,
FT                   2122051..2122159,2123692..2123757))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, isoform CRA_b"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT174029.0
FT                   protein_id=mCP96948.0 isoform=CRA_b"
FT                   /protein_id="EDL41445.1"
FT                   /translation="MEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFR
FT                   ERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDI
FT                   VRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKRAMKYQGQA
FT                   RKGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARRKLIIIIVVVVVLLGILALII
FT                   GLSVGLK"
FT   CDS             complement(join(2117120..2117203,2118323..2118433,
FT                   2118549..2118659,2120916..2121050,2121211..2121284,
FT                   2122051..2122159,2123692..2123757))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12909"
FT                   /product="mCG12909, isoform CRA_b"
FT                   /note="gene_id=mCG12909.2 transcript_id=mCT180704.0
FT                   protein_id=mCP103626.0 isoform=CRA_b"
FT                   /protein_id="EDL41446.1"
FT                   /translation="MEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFR
FT                   ERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDI
FT                   VRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKRAMKYQGQA
FT                   RKGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARRKLIIIIVVVVVLLGILALII
FT                   GLSVGLK"
FT   assembly_gap    2126826..2126878
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    2133463..2133486
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    2135277..2135769
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   gene            <2153936..2175043
FT                   /locus_tag="mCG_146172"
FT                   /note="gene_id=mCG146172.0"
FT   mRNA            join(<2153936..2154031,2154344..2154449,2160052..2160109,
FT                   2174609..2175043)
FT                   /locus_tag="mCG_146172"
FT                   /product="mCG146172"
FT                   /note="gene_id=mCG146172.0 transcript_id=mCT186275.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<2154360..2154449,2160052..2160109,2174609..2174727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146172"
FT                   /product="mCG146172"
FT                   /note="gene_id=mCG146172.0 transcript_id=mCT186275.0
FT                   protein_id=mCP107438.0"
FT                   /protein_id="EDL41448.1"
FT                   /translation="SPKRRGLTAFSCSSRSFILAQVRAAGALSQALCVSTVSKLHTTST
FT                   WQQPATESNVRIIQHTSAFSSQHRDLKPENTRNPSTFFIQKKE"
FT   assembly_gap    2154532..2154583
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    2155915..2155934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2158788..2158873
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    2161404..2161423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2164046..2164065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2165083..2165102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2166270..2167304
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    2168586..2168605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2169879..2170367
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   gene            complement(<2171862..>2172809)
FT                   /locus_tag="mCG_142299"
FT                   /note="gene_id=mCG142299.0"
FT   mRNA            complement(<2171862..>2172809)
FT                   /locus_tag="mCG_142299"
FT                   /product="mCG142299"
FT                   /note="gene_id=mCG142299.0 transcript_id=mCT179815.0
FT                   created on 07-FEB-2003"
FT   CDS             complement(2171862..2172809)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142299"
FT                   /product="mCG142299"
FT                   /note="gene_id=mCG142299.0 transcript_id=mCT179815.0
FT                   protein_id=mCP102737.0"
FT                   /db_xref="GOA:Q8VGJ6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031251"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGJ6"
FT                   /protein_id="EDL41449.1"
FT                   /translation="MEEGNQTGMVLFHFRPFSKLPEVQMLIFVLFLMMYLVSIGGNMSI
FT                   VLTIWTNRCLHTPMYFFLANLASLEIFYSSTIAPLTLASILSTERTVVSLAGCGAQMFF
FT                   FIFLGSADCILLAVMAYDRFVAICHPLRYTLIMSWHLCVQLALGSLLLGFILAMQLTVL
FT                   IFRLPFCSSKEISLFYCDVLPVMRLACADTHVHEATLFVVSVIVLTIPFLLITLSYVFI
FT                   VDAILKIRSAEGRHKAFSTCSSHLTVVLLQYGCGSLIYLCPSSSYSPERGQVVSVVYTF
FT                   ITPVLNPLIYSMRNRELKDALRKVVISFLLLEKQ"
FT   assembly_gap    2177870..2177889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2179129..2179148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2185134..2185153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2186156..2186175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2188029..2188048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2189223..2189242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2190499..2190518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2191687..2191945
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    2220254..2220304
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            complement(<2221490..>2222260)
FT                   /gene="Olfr1419"
FT                   /locus_tag="mCG_60896"
FT                   /note="gene_id=mCG60896.1"
FT   mRNA            complement(<2221490..>2222260)
FT                   /gene="Olfr1419"
FT                   /locus_tag="mCG_60896"
FT                   /product="olfactory receptor 1419"
FT                   /note="gene_id=mCG60896.1 transcript_id=mCT61079.1 created
FT                   on 03-OCT-2002"
FT   CDS             complement(2221490..2222260)
FT                   /codon_start=1
FT                   /gene="Olfr1419"
FT                   /locus_tag="mCG_60896"
FT                   /product="olfactory receptor 1419"
FT                   /note="gene_id=mCG60896.1 transcript_id=mCT61079.1
FT                   protein_id=mCP31938.1"
FT                   /protein_id="EDL41450.1"
FT                   /translation="MGKMLISLPSCGAQMFFFILLGGSDCVLLAIMAYDRYVAICHPLH
FT                   YSLIMSWQLCGQMALGSLGLGFLLSLPLTILICHLPFCGHNEIYHFFCDMPAVMRLACT
FT                   DTHIHQAALFAISVAAVAIPFLLICLSYGCIVATILRMTSAEGKRRAFSTCSSHLLVVV
FT                   LQYGCCTLIYLRPSSSYSPEEGRAVSVVYTFFSPLLNPLIYSLRNQEVTDAVKRLLTRM
FT                   FWFRKPERFLPGGNYSLNKGEHSMMEKKLKINRP"
FT   gene            complement(2228103..2229961)
FT                   /locus_tag="mCG_12888"
FT                   /note="gene_id=mCG12888.2"
FT   mRNA            complement(join(2228103..2229127,2229263..2229747,
FT                   2229770..2229961))
FT                   /locus_tag="mCG_12888"
FT                   /product="mCG12888"
FT                   /note="gene_id=mCG12888.2 transcript_id=mCT13603.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(2228922..2229127,2229263..2229665))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12888"
FT                   /product="mCG12888"
FT                   /note="gene_id=mCG12888.2 transcript_id=mCT13603.2
FT                   protein_id=mCP9893.2"
FT                   /protein_id="EDL41451.1"
FT                   /translation="MAEQSAPKVVLKSTIKMSLNERFTNMLKNKQPMPVNIRASMQQQQ
FT                   LASARNRRLAQQIENRPSFQAALKLKQKSLKQRLGKSDIQARLGRPIGALARGAIGGRG
FT                   LPIIQRGLPRGGLRGGRATRTLLRGGMSLRGRGMIGWGREGFGGRGRGRGRGRGALTRP
FT                   VLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND"
FT   gene            <2247227..>2248153
FT                   /gene="Olfr1420"
FT                   /locus_tag="mCG_1045246"
FT                   /note="gene_id=mCG1045246.1"
FT   mRNA            <2247227..>2248153
FT                   /gene="Olfr1420"
FT                   /locus_tag="mCG_1045246"
FT                   /product="olfactory receptor 1420"
FT                   /note="gene_id=mCG1045246.1 transcript_id=mCT162950.1
FT                   created on 03-OCT-2002"
FT   CDS             2247227..>2248153
FT                   /codon_start=1
FT                   /gene="Olfr1420"
FT                   /locus_tag="mCG_1045246"
FT                   /product="olfactory receptor 1420"
FT                   /note="gene_id=mCG1045246.1 transcript_id=mCT162950.1
FT                   protein_id=mCP64260.1"
FT                   /db_xref="GOA:Q8VF55"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VF55"
FT                   /protein_id="EDL41452.1"
FT                   /translation="MEIINKTAKVQFFFRPFSPDPGVQMVIFVTFLVMYLTSLSGNATI
FT                   AVIVHINHSLHTPMYFFLANLAVLEIFYTSSIAPLALANLLSMGKTPVSITGCGTQMFF
FT                   FVFLGGADCVLLAVMAYDRFVAICYPLRYTLIMSWSLCVEMMVGSLVLGFLLSLPLTIL
FT                   IFHLPFCHNNEIYHFYCDMPAVIRLACGDTHVHRTALYIISFIVLSIPLTLISISYVFI
FT                   ITAILRIRSAEGRHRAFSTCSSHIVVVLLQYGCTSFIYLSPSSSYSPEMGRMVSVVYTF
FT                   ITPILNPLIYSMRNKELKDALRKALRKF"
FT   assembly_gap    2256854..2256873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2257921..2257940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2263263..2263282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264299..2264318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2269044..2299676
FT                   /gene="AV312086"
FT                   /locus_tag="mCG_12887"
FT                   /note="gene_id=mCG12887.1"
FT   mRNA            join(2269044..2269156,2274876..2275093,2275503..2275583,
FT                   2276066..2276260,2277164..2277265,2278096..2278185,
FT                   2278509..2278726,2279845..2279934,2284599..2284779,
FT                   2286574..2286697,2287180..2287277,2288732..2288791,
FT                   2290718..2290866,2292259..2292418,2294507..2294662,
FT                   2297233..2297324,2297429..2297578,2297915..2299676)
FT                   /gene="AV312086"
FT                   /locus_tag="mCG_12887"
FT                   /product="expressed sequence AV312086, transcript variant
FT                   mCT13602"
FT                   /note="gene_id=mCG12887.1 transcript_id=mCT13602.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<2274876..2275093,2275503..2275583,2276066..2276260,
FT                   2276618..2276691,2277164..2277265,2278096..2278185,
FT                   2278509..2278726,2279845..2279934,2284599..2284779,
FT                   2286574..2286697,2287180..2287277,2288732..2288791,
FT                   2290718..2290866,2292259..2292418,2294507..2294662,
FT                   2297233..2297324,2297429..2297578,2297915..2299550)
FT                   /gene="AV312086"
FT                   /locus_tag="mCG_12887"
FT                   /product="expressed sequence AV312086, transcript variant
FT                   mCT194081"
FT                   /note="gene_id=mCG12887.1 transcript_id=mCT194081.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2274974..2275093,2275503..2275583,2276066..2276260,
FT                   2277164..2277265,2278096..2278185,2278509..2278726,
FT                   2279845..2279934,2284599..2284779,2286574..2286697,
FT                   2287180..2287277,2288732..2288791,2290718..2290866,
FT                   2292259..2292418,2294507..2294662,2297233..2297324,
FT                   2297429..2297578,2297915..2297936)
FT                   /codon_start=1
FT                   /gene="AV312086"
FT                   /locus_tag="mCG_12887"
FT                   /product="expressed sequence AV312086, isoform CRA_a"
FT                   /note="gene_id=mCG12887.1 transcript_id=mCT13602.2
FT                   protein_id=mCP9830.2 isoform=CRA_a"
FT                   /protein_id="EDL41453.1"
FT                   /translation="MDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGS
FT                   LNSSIWDGSEVLRRIRGPLLAQEMPTVSVLEYALPQRPLQGPEDDRDLSERALPRRSTS
FT                   PIIGSPPVRAVPIGTPPKQMAVPSFNQQILCPKPVHVRPPMPPRYPAPYGERISPNQLC
FT                   SVPNSSLLGHPFPPNVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMN
FT                   PKLLQGRVGQMLPPAPSFRAFFSAPPPATPPPQQHPPGPGPHLQNLRPQAPMFRADTTH
FT                   LHPQHRRLLHQRQLQSRNQHRNLNGTGDRGGHQSSHQDHLRKDPYANLMLQREKDWVSK
FT                   IQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYQ
FT                   PVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLL
FT                   LDVEDYERRYLLSLEEERPALMDERKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRK
FT                   GKRMVARILPFLSTEQAADILMATARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVT
FT                   VTSLLQQLMNLPQSASAPAPSNSHLTAVLQNKFGLSLLLILLSRGEDLQSSDPAIESTQ
FT                   NNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGI
FT                   R"
FT   CDS             join(<2276671..2276691,2277164..2277265,2278096..2278185,
FT                   2278509..2278726,2279845..2279934,2284599..2284779,
FT                   2286574..2286697,2287180..2287277,2288732..2288791,
FT                   2290718..2290866,2292259..2292418,2294507..2294662,
FT                   2297233..2297324,2297429..2297578,2297915..2297936)
FT                   /codon_start=1
FT                   /gene="AV312086"
FT                   /locus_tag="mCG_12887"
FT                   /product="expressed sequence AV312086, isoform CRA_b"
FT                   /note="gene_id=mCG12887.1 transcript_id=mCT194081.0
FT                   protein_id=mCP115047.0 isoform=CRA_b"
FT                   /protein_id="EDL41454.1"
FT                   /translation="KGRPIWKILCPKPVHVRPPMPPRYPAPYGERISPNQLCSVPNSSL
FT                   LGHPFPPNVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKLLQGR
FT                   VGQMLPPAPSFRAFFSAPPPATPPPQQHPPGPGPHLQNLRPQAPMFRADTTHLHPQHRR
FT                   LLHQRQLQSRNQHRNLNGTGDRGGHQSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQ
FT                   STDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYQPVQFEGS
FT                   LGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYE
FT                   RRYLLSLEEERPALMDERKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVAR
FT                   ILPFLSTEQAADILMATARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVTVTSLLQQ
FT                   LMNLPQSASAPAPSNSHLTAVLQNKFGLSLLLILLSRGEDLQSSDPAIESTQNNQWTEV
FT                   MFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR"
FT   assembly_gap    2309367..2310452
FT                   /estimated_length=1086
FT                   /gap_type="unknown"
FT   assembly_gap    2322579..2322606
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            <2322608..2350694
FT                   /locus_tag="mCG_22485"
FT                   /note="gene_id=mCG22485.3"
FT   mRNA            join(<2322608..2322855,2327247..2327455,2330218..2330468,
FT                   2334363..2334561,2334798..2334900,2335192..2335246,
FT                   2335430..2335561,2340504..2340749,2340992..2341112,
FT                   2344941..2345044,2345797..2345892,2347186..2347367,
FT                   2348180..2348400,2348485..2350694)
FT                   /locus_tag="mCG_22485"
FT                   /product="mCG22485"
FT                   /note="gene_id=mCG22485.3 transcript_id=mCT22656.3 created
FT                   on 09-APR-2003"
FT   CDS             join(<2322608..2322855,2327247..2327455,2330218..2330468,
FT                   2334363..2334561,2334798..2334900,2335192..2335246,
FT                   2335430..2335561,2340504..2340749,2340992..2341112,
FT                   2344941..2345044,2345797..2345892,2347186..2347367,
FT                   2348180..2348400,2348485..2348627)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22485"
FT                   /product="mCG22485"
FT                   /note="gene_id=mCG22485.3 transcript_id=mCT22656.3
FT                   protein_id=mCP9815.3"
FT                   /protein_id="EDL41455.1"
FT                   /translation="GDAGPGSGVAAATATAAGGPGPGAGGVAAGGPGSAPPAAGSGGSG
FT                   AGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANIT
FT                   VEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEESVSQ
FT                   TDKTELQSTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLKLPAESNEKIKQVNE
FT                   RATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLE
FT                   RAFRGATVLPANPPGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTG
FT                   SNISGASSDVSLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMP
FT                   VNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFN
FT                   PLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLS
FT                   IMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFV
FT                   PYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGENGGDARQRGHEA
FT                   EDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEA
FT                   NAEKQRLEEKQRLSRKKREAEAAKATEDGTPHDPYKALWFERKKDPVTRELTHIYSGEY
FT                   WECKEKQDWGSCPDIF"
FT   assembly_gap    2337942..2337961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2356981..2357006
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2357835..2357854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360571..2360641
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2364703..2364820
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            complement(2377272..2377806)
FT                   /locus_tag="mCG_49929"
FT                   /note="gene_id=mCG49929.2"
FT   mRNA            complement(2377272..2377806)
FT                   /locus_tag="mCG_49929"
FT                   /product="mCG49929"
FT                   /note="gene_id=mCG49929.2 transcript_id=mCT50112.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(2377455..2377592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49929"
FT                   /product="mCG49929"
FT                   /note="gene_id=mCG49929.2 transcript_id=mCT50112.2
FT                   protein_id=mCP31918.2"
FT                   /protein_id="EDL41456.1"
FT                   /translation="MQKPWRDVPYWLASPGLLSLFSYRTKTTSPEMVPPTRGLSPLITN
FT                   "
FT   assembly_gap    2387804..2387823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2392429..>2393187)
FT                   /gene="Olfr1423"
FT                   /locus_tag="mCG_53440"
FT                   /note="gene_id=mCG53440.1"
FT   mRNA            complement(<2392429..>2393187)
FT                   /gene="Olfr1423"
FT                   /locus_tag="mCG_53440"
FT                   /product="olfactory receptor 1423"
FT                   /note="gene_id=mCG53440.1 transcript_id=mCT53623.1 created
FT                   on 03-OCT-2002"
FT   CDS             complement(2392429..2393187)
FT                   /codon_start=1
FT                   /gene="Olfr1423"
FT                   /locus_tag="mCG_53440"
FT                   /product="olfactory receptor 1423"
FT                   /note="gene_id=mCG53440.1 transcript_id=mCT53623.1
FT                   protein_id=mCP31922.1"
FT                   /protein_id="EDL41457.1"
FT                   /translation="MYFLLRNLAVLDICFSSITAPKVLVDLLAKKKTISYAKCMTQMFF
FT                   FHLLGGADIFSLSVMAFDRYMAISKPLHYVTIMSSKRCTALIAASWVGGFVHSIVQISL
FT                   LLPLPFCGPNVLDTFYCDVPQVLKLACTDTFVLELLMISNNGLVTTLWFIFLLVSYMVI
FT                   LMMLRSQAGEDRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISP
FT                   LLNPLIYTLRNQEMKSAIRRLKRKLTPLEK"
FT   assembly_gap    2408281..2408300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2413172..2413191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2414258..2414754
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    2439376..2439395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2446675..>2447544)
FT                   /locus_tag="mCG_55174"
FT                   /note="gene_id=mCG55174.0"
FT   mRNA            complement(<2446675..>2447544)
FT                   /locus_tag="mCG_55174"
FT                   /product="mCG55174"
FT                   /note="gene_id=mCG55174.0 transcript_id=mCT55357.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(2446675..2447544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55174"
FT                   /product="mCG55174"
FT                   /note="gene_id=mCG55174.0 transcript_id=mCT55357.0
FT                   protein_id=mCP31899.0"
FT                   /protein_id="EDL41458.1"
FT                   /translation="MVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLRNLSVA
FT                   DICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDVFSLSVMALDRYVAISK
FT                   PLHYVTIMSRGRCIGLIVASWVGGFAHSIVQISLLLTLPFCGPNVLDTFYCDVPQVIKL
FT                   ACTDIFVLELLMISNNGLVATLWFVLLVVSYTVILMMLRSHSGEGRKKAISTCTSHITV
FT                   VTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLRKRL
FT                   EPFDREEQ"
FT   assembly_gap    2448517..2448536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2467450..>2468394)
FT                   /gene="Olfr1428"
FT                   /locus_tag="mCG_53442"
FT                   /note="gene_id=mCG53442.0"
FT   mRNA            complement(<2467450..>2468394)
FT                   /gene="Olfr1428"
FT                   /locus_tag="mCG_53442"
FT                   /product="olfactory receptor 1428"
FT                   /note="gene_id=mCG53442.0 transcript_id=mCT53625.1 created
FT                   on 07-OCT-2002"
FT   CDS             complement(2467450..2468394)
FT                   /codon_start=1
FT                   /gene="Olfr1428"
FT                   /locus_tag="mCG_53442"
FT                   /product="olfactory receptor 1428"
FT                   /note="gene_id=mCG53442.0 transcript_id=mCT53625.1
FT                   protein_id=mCP31945.1"
FT                   /db_xref="GOA:Q7TQS0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQS0"
FT                   /protein_id="EDL41459.1"
FT                   /translation="MSQINHTNVKEFVFLALTRIRELEFFLFSVFFLVYVTTVLGNTLI
FT                   VVTITAESRLHTPMYFLLRNKSILDIVFSSITVPKFLVDLLSERKAISYNGCLTQIFFF
FT                   HFAGGADIFFLSVMAYDRYLAIAKPLHYVTIMRREVWLALVVASWVGGGLHSIVQIILM
FT                   LPLPFCGPNTLDAFYCDIPQVVKLACTDTFALELLMISNNGLVTLLWFFLLLGSYTIIL
FT                   VMLRFHSGEGRNKALSTCTSHIMVVTLHFVPCVYIYCRPFTTLPMDTAISINNTVITPM
FT                   LNPMIYTLRNQEMKSAMKRLQRRLGPSESNKLG"
FT   gene            complement(<2478648..>2497902)
FT                   /locus_tag="mCG_51958"
FT                   /note="gene_id=mCG51958.1"
FT   mRNA            complement(join(<2478648..2479360,2497821..>2497902))
FT                   /locus_tag="mCG_51958"
FT                   /product="mCG51958"
FT                   /note="gene_id=mCG51958.1 transcript_id=mCT52141.1 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(2478648..2479360,2497821..2497902))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51958"
FT                   /product="mCG51958"
FT                   /note="gene_id=mCG51958.1 transcript_id=mCT52141.1
FT                   protein_id=mCP31943.1"
FT                   /protein_id="EDL41460.1"
FT                   /translation="MIGVGLGTRSFPRRSLSRPGVRVPEKGTPKMLSDFFREQKTISFL
FT                   GCGAQFFFFVGLGLTECFLLTAMAYDRYAAISNPLLYTTIMPQGLCMRMVAGAYLGGFL
FT                   SSFIQASSIFQLHFCGPNVINHFFCDLPPILALSCSNTFLSQVVNFLIVITVGGTSFLI
FT                   LLISYSYIVSAVLKIHSVRGRWKAFNTCASHLMAVTMLFGTALFMYLRPSSSYSFSRDK
FT                   VVSVFYSLVIPMLNPLIYSLRNKEIKDALWKVMERKKVFPNL"
FT   assembly_gap    2496020..2496268
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2501794..2501813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2502891..2502910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2503374..2505039
FT                   /locus_tag="mCG_1045247"
FT                   /note="gene_id=mCG1045247.1"
FT   mRNA            join(<2503374..2504004,2504030..2505039)
FT                   /locus_tag="mCG_1045247"
FT                   /product="mCG1045247"
FT                   /note="gene_id=mCG1045247.1 transcript_id=mCT162951.1
FT                   created on 07-OCT-2002"
FT   CDS             <2504056..2504379
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045247"
FT                   /product="mCG1045247"
FT                   /note="gene_id=mCG1045247.1 transcript_id=mCT162951.1
FT                   protein_id=mCP64271.0 partial"
FT                   /protein_id="EDL41461.1"
FT                   /translation="SIDPRCVVMLFSPIGPLWVGLIVLVLFVLIYGLCYCLNQEAVKTG
FT                   QKILIEQQENMSEEEKGLKKKKEKERRHXXXXXXXKRGNCGERVWRQSQRRQGLQLSHM
FT                   TCT"
FT   assembly_gap    2504276..2504295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2507632..2528139)
FT                   /pseudo
FT                   /locus_tag="mCG_1045071"
FT                   /note="gene_id=mCG1045071.0"
FT   mRNA            complement(join(2507632..2507859,2527322..2527506,
FT                   2527707..2528139))
FT                   /pseudo
FT                   /locus_tag="mCG_1045071"
FT                   /note="gene_id=mCG1045071.0 transcript_id=mCT162775.0
FT                   created on 07-OCT-2002"
FT   assembly_gap    2509894..2513234
FT                   /estimated_length=3341
FT                   /gap_type="unknown"
FT   assembly_gap    2520195..2520377
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    2529812..2529831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2531350..2531790
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    2534234..2534253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2537620..2537639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2541741..2554810)
FT                   /pseudo
FT                   /locus_tag="mCG_54593"
FT                   /note="gene_id=mCG54593.1"
FT   mRNA            complement(join(2541741..2542092,2542109..2542175,
FT                   2542221..2542390,2554711..2554810))
FT                   /pseudo
FT                   /locus_tag="mCG_54593"
FT                   /note="gene_id=mCG54593.1 transcript_id=mCT54776.1 created
FT                   on 07-OCT-2002"
FT   assembly_gap    2556605..2556624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2566490..2570081)
FT                   /locus_tag="mCG_1045248"
FT                   /note="gene_id=mCG1045248.0"
FT   mRNA            complement(join(<2566490..2566658,2570022..2570081))
FT                   /locus_tag="mCG_1045248"
FT                   /product="mCG1045248"
FT                   /note="gene_id=mCG1045248.0 transcript_id=mCT162952.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(<2566490..2566528)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045248"
FT                   /product="mCG1045248"
FT                   /note="gene_id=mCG1045248.0 transcript_id=mCT162952.0
FT                   protein_id=mCP64275.1"
FT                   /protein_id="EDL41462.1"
FT                   /translation="MCIHPQIYVECII"
FT   assembly_gap    2569020..2569465
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   gene            2573502..>2574676
FT                   /locus_tag="mCG_1045072"
FT                   /note="gene_id=mCG1045072.1"
FT   mRNA            join(2573502..2573539,2573973..>2574676)
FT                   /locus_tag="mCG_1045072"
FT                   /product="mCG1045072"
FT                   /note="gene_id=mCG1045072.1 transcript_id=mCT162776.1
FT                   created on 07-OCT-2002"
FT   CDS             join(2573506..2573539,2573973..2574676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045072"
FT                   /product="mCG1045072"
FT                   /note="gene_id=mCG1045072.1 transcript_id=mCT162776.1
FT                   protein_id=mCP64077.1"
FT                   /protein_id="EDL41463.1"
FT                   /translation="MKYKCDSVMKTSPKMLSNFFQENQTISFVGCIVQYFILSTMGLTE
FT                   CCLMTAMAYDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLTGSVSQICALLQLYFCG
FT                   PNVIRHFFCDISQLLNLSCSDAFFVQVLLAILTMCFGIANALATMLSYGFIVLSILKIT
FT                   SAKGRSKAFNTCASHLTAVSLFYSTGIFVYLRSSSGSSSSFDRFTSVFYTVVIPMLNPL
FT                   IYSLRNKEIKDAMKRLQKKKICN"
FT   assembly_gap    2576514..2576836
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   gene            complement(<2592690..>2593537)
FT                   /locus_tag="mCG_1045073"
FT                   /note="gene_id=mCG1045073.1"
FT   mRNA            complement(<2592690..>2593537)
FT                   /locus_tag="mCG_1045073"
FT                   /product="mCG1045073"
FT                   /note="gene_id=mCG1045073.1 transcript_id=mCT162777.1
FT                   created on 14-APR-2003"
FT   CDS             complement(2592690..>2593535)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045073"
FT                   /product="mCG1045073"
FT                   /note="gene_id=mCG1045073.1 transcript_id=mCT162777.1
FT                   protein_id=mCP64090.2"
FT                   /protein_id="EDL41464.1"
FT                   /translation="YFFLSFLSFIDICYSSSISPRILSDFLKTEKTISFIACATQNFVL
FT                   AWMGASECCLLTAMAYDRYVAIGSPLQYSAIMAPSLCWRMVAGVYGSGFFISFVQTVAC
FT                   FNLYYCGPNVIRHFFCDIPQIIPLSCSDPFISQLVLFLAALFVGFGSFLVIIFSYVFIA
FT                   VSILKVASFEGCVKAFKTCGSHLAAVTLFYGTVFSVYMHHSSQHSTKQDKVLSVVYTIL
FT                   IPMVNPLIYSLRNTEIKEALKRVLKKAVHLPQKHSIWAGSILKRKAGVKTLRPSVDLSN
FT                   "
FT   assembly_gap    2593538..2593557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2595160..2595817
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    2598419..2598567
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    2599932..2599951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2602934..2602953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2605348..2607407
FT                   /locus_tag="mCG_1045042"
FT                   /note="gene_id=mCG1045042.1"
FT   mRNA            join(2605348..2605385,2605770..2607407)
FT                   /locus_tag="mCG_1045042"
FT                   /product="mCG1045042"
FT                   /note="gene_id=mCG1045042.1 transcript_id=mCT162746.1
FT                   created on 07-OCT-2002"
FT   CDS             2605825..2606865
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045042"
FT                   /product="mCG1045042"
FT                   /note="gene_id=mCG1045042.1 transcript_id=mCT162746.1
FT                   protein_id=mCP64489.0"
FT                   /protein_id="EDL41465.1"
FT                   /translation="MRESLLHGIYAYGFEKPSAIQQRATLPCIKGCDVIAQAQSGTGKT
FT                   ATFALSILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGATDVHA
FT                   EVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFP
FT                   KLNSNTQVVLLSTTMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKL
FT                   DTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFC
FT                   SGSSRVLIPTDLLARGIDVQQVSLIINYDLPTNRENYIRSGRGGRFGRKGVANGDRRRQ
FT                   EDSSRH"
FT   assembly_gap    2608700..2608719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2609984..2610003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2611191..2611210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2613549..2613769
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    2665960..2665979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2668277..2671132)
FT                   /pseudo
FT                   /locus_tag="mCG_56382"
FT                   /note="gene_id=mCG56382.1"
FT   mRNA            complement(join(2668277..2668596,2668874..2669050,
FT                   2671009..2671132))
FT                   /pseudo
FT                   /locus_tag="mCG_56382"
FT                   /note="gene_id=mCG56382.1 transcript_id=mCT56565.1 created
FT                   on 07-OCT-2002"
FT   assembly_gap    2676633..2676701
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2697792..2701740
FT                   /estimated_length=3949
FT                   /gap_type="unknown"
FT   assembly_gap    2720757..2720776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2725221..>2726138
FT                   /gene="Olfr1440"
FT                   /locus_tag="mCG_66520"
FT                   /note="gene_id=mCG66520.2"
FT   mRNA            2725221..>2726138
FT                   /gene="Olfr1440"
FT                   /locus_tag="mCG_66520"
FT                   /product="olfactory receptor 1440"
FT                   /note="gene_id=mCG66520.2 transcript_id=mCT66703.2 created
FT                   on 07-OCT-2002"
FT   CDS             2725383..>2726138
FT                   /codon_start=1
FT                   /gene="Olfr1440"
FT                   /locus_tag="mCG_66520"
FT                   /product="olfactory receptor 1440"
FT                   /note="gene_id=mCG66520.2 transcript_id=mCT66703.2
FT                   protein_id=mCP31985.2"
FT                   /protein_id="EDL41466.1"
FT                   /translation="MYFFLSNLSFLDFCYISSTTPKMLSGFFQKSKSISFVGCTMQYFI
FT                   FSSLGLSECCLLAAMAYDRYAAICNPLLYTAIMSPSLCVHMVVGAYSTGLLGSLIQLCA
FT                   ILQLHFCGPNIINHFFCDLPQLLVLSCSETFPLQVLKFVIAVIFGVASVIVILISYGYI
FT                   IGTILNISSVEGRSKAFNTCASHLTAVTLFFGSGLFVYMRPSSNSSQGYDKMASVFYTV
FT                   VIPMLNPLIYSLRNKEIKDALQRCKNKCFS"
FT   assembly_gap    2747753..2747772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2753221..>2754177
FT                   /gene="Olfr1441"
FT                   /locus_tag="mCG_55729"
FT                   /note="gene_id=mCG55729.1"
FT   mRNA            <2753221..>2754177
FT                   /gene="Olfr1441"
FT                   /locus_tag="mCG_55729"
FT                   /product="olfactory receptor 1441"
FT                   /note="gene_id=mCG55729.1 transcript_id=mCT55912.1 created
FT                   on 07-OCT-2002"
FT   CDS             2753221..2754177
FT                   /codon_start=1
FT                   /gene="Olfr1441"
FT                   /locus_tag="mCG_55729"
FT                   /product="olfactory receptor 1441"
FT                   /note="gene_id=mCG55729.1 transcript_id=mCT55912.1
FT                   protein_id=mCP31989.1"
FT                   /db_xref="GOA:Q8VFV3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFV3"
FT                   /protein_id="EDL41467.1"
FT                   /translation="MAVGRNISVVTNFILLGFLERPQLQIVLFVLFLGIYLVTLAGNLG
FT                   LIVLIRMDSHLHSPMYFFLSNLSFVDVSYTSSIAPKMLCDFFREQKSITFIGCAIQLFF
FT                   FVGMGGTECCLLAAMAYDRYVAISNPLLYPSLMSPTICVGMAITVYTGGFLTGLIQTSS
FT                   IFRLHFCGPRVINHFFCDLPPLMSLSCSSTFFSQVVNFLVVCVVGGASALVVLVSYGYI
FT                   IAAVMRIHSTHGQMKAFNTCASYLTTVILFYGSGLFSYLHSNAGYSQDKNKVVSMFYGA
FT                   VIPMLNPIIYSLRNKEIKEALKKLKKRKKQMSCLCAM"
FT   gene            2758812..2762102
FT                   /gene="Pfpl"
FT                   /locus_tag="mCG_22482"
FT                   /note="gene_id=mCG22482.2"
FT   mRNA            join(2758812..2758958,2759247..2762102)
FT                   /gene="Pfpl"
FT                   /locus_tag="mCG_22482"
FT                   /product="pore forming protein-like"
FT                   /note="gene_id=mCG22482.2 transcript_id=mCT22336.2 created
FT                   on 04-OCT-2002"
FT   CDS             2759297..2761405
FT                   /codon_start=1
FT                   /gene="Pfpl"
FT                   /locus_tag="mCG_22482"
FT                   /product="pore forming protein-like"
FT                   /note="gene_id=mCG22482.2 transcript_id=mCT22336.2
FT                   protein_id=mCP9903.2"
FT                   /db_xref="GOA:Q5RKV8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="MGI:MGI:1860266"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RKV8"
FT                   /protein_id="EDL41468.1"
FT                   /translation="MNSFIVTVLIWTTVAYAEEEKALKEIHEYGFQKCQNALNLPVLEV
FT                   LPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSW
FT                   ENYRSTTSFSINLNLDYRPRVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANP
FT                   NAELNLGFKKELMEICDRLEKNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVK
FT                   SSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGI
FT                   PFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAES
FT                   YYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLD
FT                   FHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKA
FT                   EVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLD
FT                   HELGPKYSVPFGGFFSCTKGNPLYGSFTSGDLEKSFLPKCPGGFSQQLAAIIDGCQVSY
FT                   CVKAGVFTRASLAPARLPPYTQLPMSQLSTDSVEMTGESPISWVKDPYTLQWNLEESSK
FT                   SGRLSGGSTAAITIVVILALGVLTAMAIYGNRRFKKNKPNGLPRQQALLPFPRVRVFPD
FT                   GVQDPNPA"
FT   assembly_gap    2771800..2771819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2779840..2779859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2786239..2790700
FT                   /locus_tag="mCG_55704"
FT                   /note="gene_id=mCG55704.1"
FT   mRNA            join(<2786239..2786279,2786451..2790700)
FT                   /locus_tag="mCG_55704"
FT                   /product="mCG55704"
FT                   /note="gene_id=mCG55704.1 transcript_id=mCT55887.1 created
FT                   on 07-OCT-2002"
FT   CDS             <2786589..2788760
FT                   /codon_start=1
FT                   /locus_tag="mCG_55704"
FT                   /product="mCG55704"
FT                   /note="gene_id=mCG55704.1 transcript_id=mCT55887.1
FT                   protein_id=mCP31947.1"
FT                   /protein_id="EDL41469.1"
FT                   /translation="GWYMAKTICAMNSFMALVLIWMIIACAEADKPLGETGTTGFQICK
FT                   NALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNL
FT                   EMNSEVLESWMNYQSTTSLSINTELALFSRVNGKFSTEFQRMKTLQVKDQAVTTRVQVR
FT                   NRIYTVKTTPTSELSLGFTKALMDICDQLEKNQTKMATYLAELLILNYGTHVITSVDAG
FT                   AALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRT
FT                   NSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKL
FT                   SKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELS
FT                   GDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCED
FT                   VFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESL
FT                   KVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKKCPGGFSQHLAVIS
FT                   DGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTNSETARSWIKDPQTN
FT                   QWKLGEPLELRRAMTVIHGDSNGMSGGEAAGITLGVTIALGIVITLAIYGTRKYKKKEY
FT                   QEIEEQESLVGSLATDATVLNGEEDPSPA"
FT   gene            complement(2794552..2817646)
FT                   /gene="Dtx4"
FT                   /locus_tag="mCG_124922"
FT                   /note="gene_id=mCG124922.1"
FT   mRNA            complement(join(2794552..2795125,2798655..2798744,
FT                   2803520..2803681,2807466..2807618,2808438..2808499,
FT                   2810731..2810892,2811897..2811958,2817300..2817646))
FT                   /gene="Dtx4"
FT                   /locus_tag="mCG_124922"
FT                   /product="deltex 4 homolog (Drosophila)"
FT                   /note="gene_id=mCG124922.1 transcript_id=mCT126174.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(2794892..2795125,2798655..2798744,
FT                   2803520..2803681,2807466..2807618,2808438..2808499,
FT                   2810731..2810892,2811897..2811958,2817300..2817634))
FT                   /codon_start=1
FT                   /gene="Dtx4"
FT                   /locus_tag="mCG_124922"
FT                   /product="deltex 4 homolog (Drosophila)"
FT                   /note="gene_id=mCG124922.1 transcript_id=mCT126174.1
FT                   protein_id=mCP64366.1"
FT                   /protein_id="EDL41470.1"
FT                   /translation="MSVKAAVVHGGTGPPAVRKNMALSGVGKLPQPPGPGAKPLDTTGT
FT                   IRGPGKTAPSQVIRRQVSNAPAGATVGSPASPQGSNRKTGRVALATLNRSNLQRLAIAQ
FT                   SRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSK
FT                   SEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGY
FT                   KGPQPTVKPDLVGKLSRCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPG
FT                   KMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
FT                   RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDN
FT                   VLAELAAQGISEDSTSHEKD"
FT   assembly_gap    2802217..2802236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2820405..2820651
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    2827566..2832275
FT                   /estimated_length=4710
FT                   /gap_type="unknown"
FT   assembly_gap    2838430..2838750
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    2840490..2840742
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            2842825..>2846648
FT                   /locus_tag="mCG_1045251"
FT                   /note="gene_id=mCG1045251.0"
FT   mRNA            join(2842825..2842986,2846310..>2846648)
FT                   /locus_tag="mCG_1045251"
FT                   /product="mCG1045251"
FT                   /note="gene_id=mCG1045251.0 transcript_id=mCT162955.0
FT                   created on 07-OCT-2002"
FT   CDS             2846406..2846648
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045251"
FT                   /product="mCG1045251"
FT                   /note="gene_id=mCG1045251.0 transcript_id=mCT162955.0
FT                   protein_id=mCP63787.1"
FT                   /protein_id="EDL41471.1"
FT                   /translation="MSVQCSATADSKAPGCCIRGGDRIKCLGSERTAMRHCLLTCHAWC
FT                   SDKLTAYTNAYTELHKFKPVPIAASRRENPRGLPY"
FT   assembly_gap    2850255..2850291
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(<2851844..>2853508)
FT                   /locus_tag="mCG_65857"
FT                   /note="gene_id=mCG65857.0"
FT   mRNA            complement(<2851844..>2853508)
FT                   /locus_tag="mCG_65857"
FT                   /product="mCG65857"
FT                   /note="gene_id=mCG65857.0 transcript_id=mCT66040.1 created
FT                   on 07-OCT-2002"
FT   CDS             complement(2851844..2853508)
FT                   /codon_start=1
FT                   /locus_tag="mCG_65857"
FT                   /product="mCG65857"
FT                   /note="gene_id=mCG65857.0 transcript_id=mCT66040.1
FT                   protein_id=mCP31937.1"
FT                   /protein_id="EDL41472.1"
FT                   /translation="MESRKRESEVTNLQNQWEYSLKKCRQDQTYKTIIITLDGNQQKNE
FT                   KLKYELTHKMTDSLYAALNTLNAVKNEIESQEDKEMLVYGQEGIKGYINLGMPLCCFPE
FT                   DSHVVITFSKMKKEQKEDKQVYRWQDHVCTDCVKFYIHAVGKRNKRILKCRELHQEGKK
FT                   LCIYGFKGDTIKETLRKDGRFYSFVESDHWKLIKDFDTIIENTQIVDELEGKLFQVELE
FT                   IVKCPQAADPIDLEKPSYRKLKEYIVDKYPTLKKECEKLRAYIKEESQRTSSFEIHKEN
FT                   FRKLTKNSTPAKVLKLLSQFSDSVGLIIWNNGENEGCATCFVFTGLYILTCRHVINDIV
FT                   GEGIEQSKWADKISQYVKVTFDYEELLEKDSFFFVEPWFEISDYIIDYAVLKLKGNGLE
FT                   PAGLYNGITPVPSSGLIYIIGHPDVKQKLSDGCVVISQDEHIQETKSMKGLNTMQYIYI
FT                   YTQRSFQETVHEPGVATCDNTFYCGSSGSPVFDSKGSLVAMHTAGFICEYESGVSSIVE
FT                   FGPSMECILSDIQQKHKIWYDEECVNQQDVDMKSQNY"
FT   gene            <2861719..>2867454
FT                   /locus_tag="mCG_1045252"
FT                   /note="gene_id=mCG1045252.0"
FT   mRNA            join(<2861719..2861880,2867269..>2867454)
FT                   /locus_tag="mCG_1045252"
FT                   /product="mCG1045252"
FT                   /note="gene_id=mCG1045252.0 transcript_id=mCT162956.0
FT                   created on 07-OCT-2002"
FT   CDS             join(2861719..2861880,2867269..2867454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045252"
FT                   /product="mCG1045252"
FT                   /note="gene_id=mCG1045252.0 transcript_id=mCT162956.0
FT                   protein_id=mCP63790.0"
FT                   /protein_id="EDL41473.1"
FT                   /translation="MKTLLIQPHGGFQPPQQQSQQLNLVPPPEYEEATADSNESSVNIN
FT                   PFYSSPEAMLSFWAIRTEGLWSADVLGRPQAATLGDALGSKESQGCLTVSGDRSEGPSS
FT                   VEAEASPSNII"
FT   gene            complement(2862612..2863928)
FT                   /locus_tag="mCG_1045253"
FT                   /note="gene_id=mCG1045253.0"
FT   mRNA            complement(join(2862612..2863053,2863815..2863928))
FT                   /locus_tag="mCG_1045253"
FT                   /product="mCG1045253"
FT                   /note="gene_id=mCG1045253.0 transcript_id=mCT162957.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(2862698..2862784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045253"
FT                   /product="mCG1045253"
FT                   /note="gene_id=mCG1045253.0 transcript_id=mCT162957.0
FT                   protein_id=mCP63801.1"
FT                   /protein_id="EDL41474.1"
FT                   /translation="MGTHSSGHITIGYICLIYSCCCFLQTGN"
FT   gene            complement(2893266..2922049)
FT                   /locus_tag="mCG_1045255"
FT                   /note="gene_id=mCG1045255.1"
FT   mRNA            complement(join(2893266..2893489,2910496..2910614,
FT                   2921855..2922049))
FT                   /locus_tag="mCG_1045255"
FT                   /product="mCG1045255"
FT                   /note="gene_id=mCG1045255.1 transcript_id=mCT162959.1
FT                   created on 07-OCT-2002"
FT   gene            2897572..2914031
FT                   /gene="4632417K18Rik"
FT                   /locus_tag="mCG_22479"
FT                   /note="gene_id=mCG22479.1"
FT   mRNA            join(2897572..2897629,2901109..2901189,2908193..2908392,
FT                   2911105..2914031)
FT                   /gene="4632417K18Rik"
FT                   /locus_tag="mCG_22479"
FT                   /product="RIKEN cDNA 4632417K18"
FT                   /note="gene_id=mCG22479.1 transcript_id=mCT22333.2 created
FT                   on 07-OCT-2002"
FT   assembly_gap    2899970..2900182
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    2901344..2901363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2902736..2902755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2905212..2905231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(2908315..2908392,2911105..2912868)
FT                   /codon_start=1
FT                   /gene="4632417K18Rik"
FT                   /locus_tag="mCG_22479"
FT                   /product="RIKEN cDNA 4632417K18"
FT                   /note="gene_id=mCG22479.1 transcript_id=mCT22333.2
FT                   protein_id=mCP9879.2"
FT                   /protein_id="EDL41476.1"
FT                   /translation="MSCKKRKSQISFNPRKNKKIKDYFSQVPKEEQNDPNTVKVDSKKM
FT                   PRDITNTRDQRPLSPRKTRQDQTPPLNKKITVTLGVNSRKHKNMKYELTCRETSSLYAA
FT                   LNTLSAVREEVESQKGREMLVCGKEGIEGYLNLGMPVCCIPEGSHVVITFCQCKSKTQE
FT                   NKQFFESQDQASTNYVRFCIHAVGSKRKKILKCGELQKEGNKLCVYGFKGETIRDTLRK
FT                   DGRFCTFIESDDWKLINDLDTIIENTQPVDELEGKLFQVAAELPKNPRVVSVTQNSGSE
FT                   NRNFHKLEEYIVNEYTTLKEEGKKLRAYIKEKSEKRKKKASLFKVHKEHFGKMTRNSTP
FT                   VKVVKHLSRVSDSVGFLWWNNNGNAGCATCFVFKELYILTCQHVIASIVGEGIDSSEWA
FT                   NIISQCVKVTFDYEELLPTGDKFFMVKPWFEISDKHLDYAVLELKENGQEVPAGLYHRI
FT                   RPVPHSGLIYIIGHPEGEKKSIDCCTVVPQSSRRKKCQENFQAREEAGFCFSTSFIHMY
FT                   TQRSFQEMLHNSDVVTYDTSFFGGSSGSPVFDSNGSLVAMHAAGITCTYQAGVSNIIEF
FT                   GSIMESIDDHMKQDKYKEWYNTISGNVQNVEMLSIDF"
FT   CDS             complement(join(2910557..2910614,2921855..2921973))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045255"
FT                   /product="mCG1045255"
FT                   /note="gene_id=mCG1045255.1 transcript_id=mCT162959.1
FT                   protein_id=mCP63817.1"
FT                   /protein_id="EDL41475.1"
FT                   /translation="MVTPSVLSPLGARQRRWHSSLPGAPLRGFQVSPLPGRTPRPGAHR
FT                   SLEKASDPLNWSY"
FT   assembly_gap    2916737..2916756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2918292..2918311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2920051..2920305
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            2925863..2978353
FT                   /locus_tag="mCG_124923"
FT                   /note="gene_id=mCG124923.0"
FT   mRNA            join(2925863..2926008,2939379..2939522,2944356..2944463,
FT                   2949634..2949760,2950573..2950747,2952735..2953118,
FT                   2959561..2959627,2972321..2972428,2974160..2974286,
FT                   2977355..2978353)
FT                   /locus_tag="mCG_124923"
FT                   /product="mCG124923"
FT                   /note="gene_id=mCG124923.0 transcript_id=mCT126175.0
FT                   created on 07-OCT-2002"
FT   CDS             join(2939397..2939522,2944356..2944463,2949634..2949760,
FT                   2950573..2950747,2952735..2953118,2959561..2959627,
FT                   2972321..2972428,2974160..2974286,2977355..2977788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124923"
FT                   /product="mCG124923"
FT                   /note="gene_id=mCG124923.0 transcript_id=mCT126175.0
FT                   protein_id=mCP63861.1"
FT                   /protein_id="EDL41477.1"
FT                   /translation="MLHLRSSQMLQMLESSLRKYLPESLKVNMGYSLGNGLLSKKRVYG
FT                   TVFHMNQGNPFKLKALVDKWPDFNTVVVRPREQEMGDDLDQHTNTYQIYSKDPKHCLEF
FT                   LGTPDVINWKQHLQIQSSQSNLNEAIMDLAAGKMVKVKRTQCILYMMPETAKKLVPSLL
FT                   EDKEYLDHQSGRPRAIDQEMFKLSTLDVTHAPLVDKFWQFGGNERSQRFIGRCIQIFPS
FT                   SCLLGPEGTPVSWALMDQTGEIRMAGTVPDYRAQGLISHIIYAQTLAMDKRGYPVYNHT
FT                   EQTNKVIQKMSHTLHHVPMPCDWNQCLLYQTFISQKSIFTKIAETAFQVYGTVYHMIHG
FT                   NPFNLKALVDKWPDFNTVVVRPQEQEMTDDLDFYINTYQVYSKDPQNCQEFLESSEVIN
FT                   WKQHLQIQNFAFSSWALYSDQDKFKLSSLDVVHAALVNKFWLFGGNERSQRFIERCIKN
FT                   FPSSCVLGPEGTPASWTLMDQTGEMRMGGTMPEYRLQGLVSFVVHSQDQIMTKRGYPVY
FT                   SHTEKSNIAMQKMSYTLQHLPMPCAWNQWKCMPM"
FT   assembly_gap    2941899..2942020
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    2973349..2973519
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    2994644..2994840
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            <3000607..>3001527
FT                   /gene="Olfr1442"
FT                   /locus_tag="mCG_66521"
FT                   /note="gene_id=mCG66521.0"
FT   mRNA            <3000607..>3001527
FT                   /gene="Olfr1442"
FT                   /locus_tag="mCG_66521"
FT                   /product="olfactory receptor 1442"
FT                   /note="gene_id=mCG66521.0 transcript_id=mCT66704.0 created
FT                   on 08-OCT-2002"
FT   CDS             3000607..3001527
FT                   /codon_start=1
FT                   /gene="Olfr1442"
FT                   /locus_tag="mCG_66521"
FT                   /product="olfactory receptor 1442"
FT                   /note="gene_id=mCG66521.0 transcript_id=mCT66704.0
FT                   protein_id=mCP31997.0"
FT                   /protein_id="EDL41478.1"
FT                   /translation="MTGFILLGLTNAPELRAPLFIIISFIYFTNVIGNLGMIVLILWDS
FT                   RLHTPMYCFLANLSLVDIFYSSAVAPTILAGLLVGNIVVSYNACVAQMISFSAFVTTED
FT                   LLLAAMAYDRYAAVCKPLHYTTIMTPTVCICLIMACYAGGFLNSSIHTGDTFRLSFCGS
FT                   NAVHHFFCDVPAVMTLSCSDRHVSEIVLIYGAGFIICSALLVILISYTFIFITIFRMRS
FT                   AAGYQKAMSTCVSHFTAVSIFYGTVIFMYLQPTSSHSMDTDKTVSVFYTMVIPMLNPMV
FT                   YSLRNKEVKSAFKKVVEKAKYSLGF"
FT   gene            <3006492..>3007430
FT                   /locus_tag="mCG_59038"
FT                   /note="gene_id=mCG59038.0"
FT   mRNA            <3006492..>3007430
FT                   /locus_tag="mCG_59038"
FT                   /product="mCG59038"
FT                   /note="gene_id=mCG59038.0 transcript_id=mCT59221.1 created
FT                   on 08-OCT-2002"
FT   CDS             3006492..3007430
FT                   /codon_start=1
FT                   /locus_tag="mCG_59038"
FT                   /product="mCG59038"
FT                   /note="gene_id=mCG59038.0 transcript_id=mCT59221.1
FT                   protein_id=mCP32002.0"
FT                   /db_xref="GOA:Q8VFW8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031277"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFW8"
FT                   /protein_id="EDL41479.1"
FT                   /translation="MENRTEVTEFILLGVTNAPALQTPLFILFTLIYFINMTGNLGMLV
FT                   LILWDSRLHTPMYIFLGNLSLVDIFYSSAVTPTVVAGLLVGNQAISYNACAAQMFLFVV
FT                   FATAENFLLAAMAYDRYAAVCKPLHYTTTMTPTTCACLTMACYAGGFLNSSIHTGDTFR
FT                   LYFCKSNVVHHFFCDVPAVMVLSCSDRHISEMVLLYGASFVICSALLVILISYIFIFIT
FT                   IFKMRSAAGYQKAMSTCVSHFTAVSIFYGTLIFMYLQPSSSHSMDTDKIVSVFYTMVIP
FT                   MLNPVVYSLRNKEVKSAFKKVVEKAKYTLGF"
FT   gene            3012552..>3013407
FT                   /locus_tag="mCG_1045256"
FT                   /note="gene_id=mCG1045256.1"
FT   mRNA            join(3012552..3012758,3012949..>3013407)
FT                   /locus_tag="mCG_1045256"
FT                   /product="mCG1045256"
FT                   /note="gene_id=mCG1045256.1 transcript_id=mCT162960.1
FT                   created on 08-OCT-2002"
FT   CDS             join(3012639..3012758,3012949..>3013407)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045256"
FT                   /product="mCG1045256"
FT                   /note="gene_id=mCG1045256.1 transcript_id=mCT162960.1
FT                   protein_id=mCP63830.1"
FT                   /protein_id="EDL41480.1"
FT                   /translation="MLVRRSVGDRVRKLLGRSEANVCSQEVPVPITSEGQTPIKMPPSE
FT                   DSNEEKWAQLVATQYLFLNEYLKERLKERMKEGTDNSESEASDEEPVPSSTSAGRTHST
FT                   KMAEKKKKRERKDAYMHSRRSSVKRNDDIKKQVDWHHEQLKELLKNDIKEILKEQLATE
FT                   HARMRKLLRKDVKKMSELIRNELTHICTEQ"
FT   gene            3022172..3046517
FT                   /gene="Keg1"
FT                   /locus_tag="mCG_22481"
FT                   /note="gene_id=mCG22481.1"
FT   mRNA            join(3022172..3022231,3035991..3036080,3037376..3037483,
FT                   3040901..3041027,3042292..3042463,3045179..3046517)
FT                   /gene="Keg1"
FT                   /locus_tag="mCG_22481"
FT                   /product="kidney expressed gene 1"
FT                   /note="gene_id=mCG22481.1 transcript_id=mCT22335.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(3036003..3036080,3037376..3037483,3040901..3041027,
FT                   3042292..3042463,3045179..3045581)
FT                   /codon_start=1
FT                   /gene="Keg1"
FT                   /locus_tag="mCG_22481"
FT                   /product="kidney expressed gene 1"
FT                   /note="gene_id=mCG22481.1 transcript_id=mCT22335.1
FT                   protein_id=mCP9898.1"
FT                   /protein_id="EDL41481.1"
FT                   /translation="MFCLQSSQALQVLENSLRKHLPESLKVYGTVFHINQGNPFKLKTL
FT                   VDKWPDFNTVVIRPQEEDMTDDLDHYNNTYLVYSKDPKHCQEFLGSSEVINWKQHLQIQ
FT                   SSQSDLGKVIESLGATNLGKVKHKQCFLYMVCQTAKKLAPSLMDAKNLVVSRNKLTPLD
FT                   QQLFKFASLDVTHAALVNSLWHFGGNEKSQKFIERCIFTFPSFCIMGPEGTPVSWTLMD
FT                   HTGELRMGGTLPKYRRQSLIYHVASQQIQTLEKLGFPMYAHVDKANFTVQRMVGLLGQI
FT                   LLPCTWNQWNCVPL"
FT   assembly_gap    3051726..3051745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3072188..3072207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3079527..3079546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3081580..3081619
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            complement(3090294..>3123814)
FT                   /locus_tag="mCG_1050439"
FT                   /note="gene_id=mCG1050439.0"
FT   mRNA            complement(join(3090294..3091014,3091915..3092040,
FT                   3096811..3097183,3097637..3097736,3101454..3101568,
FT                   3102629..3102707,3103046..3103096,3103494..3103628,
FT                   3104576..3104680,3105258..3105294,3105527..3105733,
FT                   3118899..3118927,3123625..>3123814))
FT                   /locus_tag="mCG_1050439"
FT                   /product="mCG1050439"
FT                   /note="gene_id=mCG1050439.0 transcript_id=mCT22659.2
FT                   created on 18-JUN-2004"
FT   gene            complement(3090294..3092266)
FT                   /locus_tag="mCG_1050440"
FT                   /note="gene_id=mCG1050440.0"
FT   mRNA            complement(join(3090294..3091014,3091915..3092266))
FT                   /locus_tag="mCG_1050440"
FT                   /product="mCG1050440"
FT                   /note="gene_id=mCG1050440.0 transcript_id=mCT194466.0
FT                   created on 18-JUN-2004"
FT   CDS             complement(join(3090532..3091014,3091915..3092028))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050440"
FT                   /product="mCG1050440"
FT                   /note="gene_id=mCG1050440.0 transcript_id=mCT194466.0
FT                   protein_id=mCP115495.0"
FT                   /db_xref="GOA:Q544D1"
FT                   /db_xref="InterPro:IPR000151"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:88439"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D1"
FT                   /protein_id="EDL41483.1"
FT                   /translation="MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLN
FT                   KNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGD
FT                   FHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQ
FT                   ELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM"
FT   CDS             complement(join(3092032..3092040,3096811..3097183,
FT                   3097637..3097736,3101454..3101568,3102629..3102707,
FT                   3103046..3103096,3103494..3103628,3104576..3104680,
FT                   3105258..3105294,3105527..3105733,3118899..3118927,
FT                   3123625..>3123812))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050439"
FT                   /product="mCG1050439"
FT                   /note="gene_id=mCG1050439.0 transcript_id=mCT22659.2
FT                   protein_id=mCP9913.3"
FT                   /protein_id="EDL41482.1"
FT                   /translation="RDRGRTAAAAAAAAAAVSRRRKAEYPRRRRSSPSNRPPDGPGHQP
FT                   AAAKPPSPAQGKKSPRLQCIEKLTTDKDPKEEKEDDSVLPQEVSITTTRASRSWRSSSR
FT                   TSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDYDVPEEHQSPGGISSDEEEEEEE
FT                   EMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEE
FT                   NEIREDEEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIK
FT                   YQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRM
FT                   IHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAK
FT                   SHPEVLIAEALAANAGALITSTDILGTNPEPLTQPADGQGLPLLPEPLGNSTAGECLLL
FT                   EAEGMSKSYCSGTERLI"
FT   gene            complement(3092643..>3123814)
FT                   /locus_tag="mCG_22489"
FT                   /note="gene_id=mCG22489.3"
FT   mRNA            complement(join(3092643..3097183,3097637..3097736,
FT                   3101454..3101568,3102629..3102707,3103046..3103096,
FT                   3103494..3103628,3104576..3104680,3105258..3105294,
FT                   3105527..3105733,3118899..3118927,3123625..>3123814))
FT                   /locus_tag="mCG_22489"
FT                   /product="mCG22489, transcript variant mCT22660"
FT                   /note="gene_id=mCG22489.3 transcript_id=mCT22660.3 created
FT                   on 18-JUN-2004"
FT   CDS             complement(join(3096673..3097183,3097637..3097736,
FT                   3101454..3101568,3102629..3102707,3103046..3103096,
FT                   3103494..3103628,3104576..3104680,3105258..3105294,
FT                   3105527..3105733,3118899..3118927,3123625..>3123812))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22489"
FT                   /product="mCG22489, isoform CRA_b"
FT                   /note="gene_id=mCG22489.3 transcript_id=mCT22660.3
FT                   protein_id=mCP9812.3 isoform=CRA_b"
FT                   /protein_id="EDL41485.1"
FT                   /translation="RDRGRTAAAAAAAAAAVSRRRKAEYPRRRRSSPSNRPPDGPGHQP
FT                   AAAKPPSPAQGKKSPRLQCIEKLTTDKDPKEEKEDDSVLPQEVSITTTRASRSWRSSSR
FT                   TSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDYDVPEEHQSPGGISSDEEEEEEE
FT                   EMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEE
FT                   NEIREDEEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIK
FT                   YQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRM
FT                   IHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAK
FT                   SHPEVLIAEALAANAGALITSTDILGTNPEPLTQPADGQGLPLLPEPLGNSTAGECLLL
FT                   EAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDTDSTG
FT                   P"
FT   mRNA            complement(join(3098145..3101568,3102629..3102707,
FT                   3103046..3103096,3103494..3103628,3104576..3104680,
FT                   3105258..3105294,3105527..3105733,3118899..3118927,
FT                   3123625..>3123814))
FT                   /locus_tag="mCG_22489"
FT                   /product="mCG22489, transcript variant mCT182217"
FT                   /note="gene_id=mCG22489.3 transcript_id=mCT182217.1 created
FT                   on 18-JUN-2004"
FT   CDS             complement(join(3101401..3101568,3102629..3102707,
FT                   3103046..3103096,3103494..3103628,3104576..3104680,
FT                   3105258..3105294,3105527..3105733,3118899..3118927,
FT                   3123625..>3123812))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22489"
FT                   /product="mCG22489, isoform CRA_a"
FT                   /note="gene_id=mCG22489.3 transcript_id=mCT182217.1
FT                   protein_id=mCP105113.1 isoform=CRA_a"
FT                   /protein_id="EDL41484.1"
FT                   /translation="RDRGRTAAAAAAAAAAVSRRRKAEYPRRRRSSPSNRPPDGPGHQP
FT                   AAAKPPSPAQGKKSPRLQCIEKLTTDKDPKEEKEDDSVLPQEVSITTTRASRSWRSSSR
FT                   TSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDYDVPEEHQSPGGISSDEEEEEEE
FT                   EMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEE
FT                   NEIREDEEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIK
FT                   YQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTGTFLSIRGLPNSQANCT"
FT   assembly_gap    3123826..3124020
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            3127098..3160865
FT                   /gene="Lpxn"
FT                   /locus_tag="mCG_22486"
FT                   /note="gene_id=mCG22486.1"
FT   mRNA            join(3127098..3127184,3132404..3132561,3139713..3139759,
FT                   3147660..3147759,3150962..3151129,3151817..3151990,
FT                   3152108..3152189,3159633..3159772,3160110..3160865)
FT                   /gene="Lpxn"
FT                   /locus_tag="mCG_22486"
FT                   /product="leupaxin, transcript variant mCT22657"
FT                   /note="gene_id=mCG22486.1 transcript_id=mCT22657.1 created
FT                   on 08-OCT-2002"
FT   mRNA            join(<3127113..3127184,3132404..3132561,3139713..3139759,
FT                   3147660..3147759,3150962..3151129,3151817..3151990,
FT                   3152108..3152189,3159633..3159781,3160110..3160832)
FT                   /gene="Lpxn"
FT                   /locus_tag="mCG_22486"
FT                   /product="leupaxin, transcript variant mCT194135"
FT                   /note="gene_id=mCG22486.1 transcript_id=mCT194135.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3127115..3127184,3132404..3132561,3139713..3139759,
FT                   3147660..3147759,3150962..3151129,3151817..3151990,
FT                   3152108..3152189,3159633..3159781,3160110..3160379)
FT                   /codon_start=1
FT                   /gene="Lpxn"
FT                   /locus_tag="mCG_22486"
FT                   /product="leupaxin, isoform CRA_a"
FT                   /note="gene_id=mCG22486.1 transcript_id=mCT194135.0
FT                   protein_id=mCP115097.0 isoform=CRA_a"
FT                   /protein_id="EDL41486.1"
FT                   /translation="TCQQSSSQSSRLEHRRYRTMEELDALLEELERCTFQDSEEYSNPV
FT                   SCHLDQQSTEESKIPQTPKTLSSQGNTSPLKVQLVYATNIQEPNVYSEVQEPKESVLPP
FT                   KTSAAAQLDELMAHLSEMQAKVSVKADTSRKPLPDQQDHKASLDSMLGDLEQELQDLGI
FT                   ATVPKGYCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSSPFFERSGLAYCSKDY
FT                   HRLFSPRCAYCAAPITDKVLTAMNKTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDF
FT                   LAMFSPKCGGCNRPVLENYLSAMNTVWHPECFVCGDCFSSFSSGSFFELDGRPFCELHY
FT                   HHRRGTLCHDCGQPITGRCISAMGHKFHPEHFVCAFCLTQLPKGIFKEQNNKTYCEKCF
FT                   TKLFSQ"
FT   CDS             join(3127172..3127184,3132404..3132561,3139713..3139759,
FT                   3147660..3147759,3150962..3151129,3151817..3151990,
FT                   3152108..3152189,3159633..3159772,3160110..3160379)
FT                   /codon_start=1
FT                   /gene="Lpxn"
FT                   /locus_tag="mCG_22486"
FT                   /product="leupaxin, isoform CRA_b"
FT                   /note="gene_id=mCG22486.1 transcript_id=mCT22657.1
FT                   protein_id=mCP9838.2 isoform=CRA_b"
FT                   /protein_id="EDL41487.1"
FT                   /translation="MEELDALLEELERCTFQDSEEYSNPVSCHLDQQSTEESKIPQTPK
FT                   TLSSQGNTSPLKVQLVYATNIQEPNVYSEVQEPKESVLPPKTSAAAQLDELMAHLSEMQ
FT                   AKVSVKADTSRKPLPDQQDHKASLDSMLGDLEQELQDLGIATVPKGYCASCQKPIAGKV
FT                   IHALGQSWHPEHFVCTHCKEELGSSPFFERSGLAYCSKDYHRLFSPRCAYCAAPITDKV
FT                   LTAMNKTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENY
FT                   LSAMNTVWHPECFDCFSSFSSGSFFELDGRPFCELHYHHRRGTLCHDCGQPITGRCISA
FT                   MGHKFHPEHFVCAFCLTQLPKGIFKEQNNKTYCEKCFTKLFSQ"
FT   assembly_gap    3141558..3142862
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    3149825..3149844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3163315..3163334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3164613..3164632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3166012..3166031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3176284..>3176625
FT                   /locus_tag="mCG_50410"
FT                   /note="gene_id=mCG50410.0"
FT   mRNA            <3176284..>3176625
FT                   /locus_tag="mCG_50410"
FT                   /product="mCG50410"
FT                   /note="gene_id=mCG50410.0 transcript_id=mCT50593.0 created
FT                   on 08-OCT-2002"
FT   CDS             3176284..3176625
FT                   /codon_start=1
FT                   /locus_tag="mCG_50410"
FT                   /product="mCG50410"
FT                   /note="gene_id=mCG50410.0 transcript_id=mCT50593.0
FT                   protein_id=mCP31944.0"
FT                   /protein_id="EDL41488.1"
FT                   /translation="MASASELACIYSALILHEDDEVMVTEDKINALIKAALIKPFWPSL
FT                   FAKALANVNIGSLICSVGAGGPAPAAGAAPAGSPAPSTAAAPAEEKKVETKKEESEEFE
FT                   DDMGFGLFD"
FT   gene            <3191201..>3192160
FT                   /gene="Olfr1444"
FT                   /locus_tag="mCG_57680"
FT                   /note="gene_id=mCG57680.1"
FT   mRNA            <3191201..>3192160
FT                   /gene="Olfr1444"
FT                   /locus_tag="mCG_57680"
FT                   /product="olfactory receptor 1444"
FT                   /note="gene_id=mCG57680.1 transcript_id=mCT57863.1 created
FT                   on 08-OCT-2002"
FT   CDS             3191201..3192160
FT                   /codon_start=1
FT                   /gene="Olfr1444"
FT                   /locus_tag="mCG_57680"
FT                   /product="olfactory receptor 1444"
FT                   /note="gene_id=mCG57680.1 transcript_id=mCT57863.1
FT                   protein_id=mCP31910.1"
FT                   /db_xref="GOA:Q0VEZ4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031278"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEZ4"
FT                   /protein_id="EDL41489.1"
FT                   /translation="MTSMENITEVTEFILLGLTDDPNLQVPLLLIFLFIYLVTLIGNGG
FT                   MMVIIFSDSHLHTPMYFFLSNLSFVDLGYSSAVAPKMVAALQSGNKVISYNGCAAQFFF
FT                   FVGFATVECYLLASMAYDRHAAVCRPLHYTTTMTTGVCTILTIGSYTCGFLNASIHAAD
FT                   TFKLSFCGSNKINHFFCDIPPLLALACSSTHISKLVVFFVVGFNVFFTLLVIIISYFFI
FT                   YIAIQNMKSSEGRKKAFSTCASHLTAVSIFYGTIIFMYLQPSSGQSMDTDKIASVFYTV
FT                   VIPMLNPLIYSLRNREVKSALWKILNRFYPASFSVSRK"
FT   assembly_gap    3207080..3207258
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            <3213352..>3214296
FT                   /locus_tag="mCG_66522"
FT                   /note="gene_id=mCG66522.0"
FT   mRNA            <3213352..>3214296
FT                   /locus_tag="mCG_66522"
FT                   /product="mCG66522"
FT                   /note="gene_id=mCG66522.0 transcript_id=mCT66705.0 created
FT                   on 08-OCT-2002"
FT   CDS             3213352..3214296
FT                   /codon_start=1
FT                   /locus_tag="mCG_66522"
FT                   /product="mCG66522"
FT                   /note="gene_id=mCG66522.0 transcript_id=mCT66705.0
FT                   protein_id=mCP32000.0"
FT                   /db_xref="GOA:Q8VFW9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFW9"
FT                   /protein_id="EDL41490.1"
FT                   /translation="MENSTEVTEFILTGLTDNPELQIPLFIVFLLIYLSTVLGNLGMVG
FT                   LILLDSHLHTPMYLFLSHLSLVDFGYSSAVTPKVMPGLLSIDKTITHNACGTQFFFFVS
FT                   FITTESFLLAAMAYDRYAAVCKPLQYTTTMTTNTCACLTIGSYVCGVLNSSIHTGNIFR
FT                   LSFCKFNVIDHFFCDAPPLLALSCSDTSVSEMVILFVVGFNDIFSIVVIPISYLFIFIT
FT                   ILRMRSSEGRQKAFSTCASHLTVVFIFYGSGIFMYLQPSSSHTMGTDKMASVFYTMIIP
FT                   MLNPLVYSLRNKEVKSAFKKAVEKAKISLAFTF"
FT   gene            complement(<3219130..>3220047)
FT                   /locus_tag="mCG_1045082"
FT                   /note="gene_id=mCG1045082.0"
FT   mRNA            complement(<3219130..>3220047)
FT                   /locus_tag="mCG_1045082"
FT                   /product="mCG1045082"
FT                   /note="gene_id=mCG1045082.0 transcript_id=mCT162786.1
FT                   created on 08-OCT-2002"
FT   CDS             complement(3219130..3220047)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045082"
FT                   /product="mCG1045082"
FT                   /note="gene_id=mCG1045082.0 transcript_id=mCT162786.1
FT                   protein_id=mCP64460.1"
FT                   /db_xref="GOA:Q7TQR6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQR6"
FT                   /protein_id="EDL41491.1"
FT                   /translation="MKNRTEVTEFILLGLTNDPGMQLPLFITFLLIYTITVVGNLGMIL
FT                   LIVLDSRLHTPMYIFLGNLSLVDFCYSSAVTPTVMTELLIGKKVISYNDCAAQMFFFGA
FT                   FATVENYLLASMAYDRYAAVCKPLHYATIMTKSVYTRIITASYGISFMSASIHIADIFT
FT                   LSFCKSNVIHHFFCDVPAIMALTCFDNQVRELVLLYIESLDVFFALIVICTSYMLIFVT
FT                   ILKMHSASGHHKAISTCASHFTAVSIFYGTVIFMYLQPSSNHSMDIDKVTSVFYTMVIP
FT                   MLNPLVYSMRNKEVKNAFIKLILH"
FT   gene            complement(<3230331..>3231251)
FT                   /locus_tag="mCG_1045160"
FT                   /note="gene_id=mCG1045160.0"
FT   mRNA            complement(<3230331..>3231251)
FT                   /locus_tag="mCG_1045160"
FT                   /product="mCG1045160"
FT                   /note="gene_id=mCG1045160.0 transcript_id=mCT162864.1
FT                   created on 08-OCT-2002"
FT   CDS             complement(3230331..3231251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045160"
FT                   /product="mCG1045160"
FT                   /note="gene_id=mCG1045160.0 transcript_id=mCT162864.1
FT                   protein_id=mCP64294.1"
FT                   /db_xref="GOA:Q7TQR5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQR5"
FT                   /protein_id="EDL41492.1"
FT                   /translation="MKNRTEVTEFILLGLTNDPGLQLPLFITFLLIYTITVVGNLGMIL
FT                   LIVLDSRLHTPMYIFLGNLSLVDFCYSTAVTPTVMNGLLIGNKVISYNDCAAQMFFFGA
FT                   FATVENYLLASMAYDRYAAVCKPLHYATIMTKSMYTWLITGSYVISFTNSSIHIADIFT
FT                   LSFCKSNVIHHFFCDVPAIMALTCFDNQVREHVLLYIESLNVFFALIVICTSYMLIFVT
FT                   ILKMHSASGHHKAISTCASHFTAVSIFYGTVIFMYLQPSSNHSMDTDKVTSVFYTMVIP
FT                   MLNPLVYSLRNKEVKNAFIKLILHY"
FT   gene            <3234817..>3236010
FT                   /locus_tag="mCG_1045043"
FT                   /note="gene_id=mCG1045043.0"
FT   mRNA            <3234817..>3236010
FT                   /locus_tag="mCG_1045043"
FT                   /product="mCG1045043"
FT                   /note="gene_id=mCG1045043.0 transcript_id=mCT162747.0
FT                   created on 08-OCT-2002"
FT   CDS             3234817..3236010
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045043"
FT                   /product="mCG1045043"
FT                   /note="gene_id=mCG1045043.0 transcript_id=mCT162747.0
FT                   protein_id=mCP64498.0"
FT                   /protein_id="EDL41493.1"
FT                   /translation="MPSRLLHTLASLHSISAKAHQCQRLTWLTLRPLRKSESTTCHNGL
FT                   TIQQHLHSFFPSITADSLNKPEILEMSRITSDTSRLFPLNAVHWLDGKEHWPSMHPFGT
FT                   HRSMIHKPNLLCSKWFIKAVKRHHSSVSNEALVPKQDLPQIKRPLRASRTRQPSRTNLP
FT                   DLSVNEDLMQCTAFATADEYHLGSLSQELVSCGYVEVTSLPRDAANILVMGVESSAKEG
FT                   DPGTIFLFREGAAVFWNVKEKTMKHVMQVLERHETQPYEVALVHWENEELNYIKTEGQS
FT                   KLHRGEIKLNSELNLDDAILEKFAFSNALCLSVKLAIWEATLDKFIESIQSIPEALKAG
FT                   KKVKLSHKEVMQKMGELFALRHRINLSSDFLITPDFYWDRANLEELYDKTCQFLSIT"
FT   gene            complement(<3248836..>3249780)
FT                   /locus_tag="mCG_55176"
FT                   /note="gene_id=mCG55176.2"
FT   mRNA            complement(<3248836..>3249780)
FT                   /locus_tag="mCG_55176"
FT                   /product="mCG55176"
FT                   /note="gene_id=mCG55176.2 transcript_id=mCT55359.2 created
FT                   on 08-OCT-2002"
FT   CDS             complement(3248836..3249780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55176"
FT                   /product="mCG55176"
FT                   /note="gene_id=mCG55176.2 transcript_id=mCT55359.2
FT                   protein_id=mCP31926.2"
FT                   /db_xref="GOA:Q8VFX1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031282"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX1"
FT                   /protein_id="EDL41494.1"
FT                   /translation="MENSTEVTEFILAGLTDDPKLQIPLFIVFLLIYLSTVLGNLGMVG
FT                   LILLDSHLHTPMYLFLSHLSLVDFGYSSAVTPKVMSGLLSIDKTISHNTCGTQFFFFVG
FT                   FITTESFLLAAMAYDRYAAVCKPLHYTTTMTTNTCACLTIGSYVCGFLNSSIHTGNIFR
FT                   LSFCKFNVIDHFFCDAPPLLALSCSDTYISETVIFFVVGFNALFSIVVITISYLLIFIT
FT                   ILRMRSSEGRHKAFSTCASHLTAVSIFYGTVIFMYLQPSSSHTMGTDKMASVFYTMVIP
FT                   MLNPLVYSLRNKEVKGAFKKAVGNAKSALTFLF"
FT   gene            <3264213..>3265157
FT                   /locus_tag="mCG_59040"
FT                   /note="gene_id=mCG59040.0"
FT   mRNA            <3264213..>3265157
FT                   /locus_tag="mCG_59040"
FT                   /product="mCG59040"
FT                   /note="gene_id=mCG59040.0 transcript_id=mCT59223.0 created
FT                   on 08-OCT-2002"
FT   CDS             3264213..3265157
FT                   /codon_start=1
FT                   /locus_tag="mCG_59040"
FT                   /product="mCG59040"
FT                   /note="gene_id=mCG59040.0 transcript_id=mCT59223.0
FT                   protein_id=mCP31900.0"
FT                   /db_xref="GOA:Q8VEV8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031283"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEV8"
FT                   /protein_id="EDL41495.1"
FT                   /translation="MSYLENSTKVTTFILLGLTDIPELQVPLFVTFSLIYLITLIGNLG
FT                   IIVLIWLDFRLHTPMYIFLSHLSLADCVYSSAVTPKVMVGFLTGDKVISYGGCVAQMFF
FT                   FVAFASVDCFLLAVMAFDRHAAVCKPLHYTTTMTTSVCARMVIACYSWGLFESAIHTGF
FT                   TFSLPYCANVVHHFFCDIPPILALSCSDIYVNEIVLFILASFNVFFALIVILTSYAFIF
FT                   IAILRMHSAEGRKKAFSTCASHLTAVTIFYGTVIFMYLQPSSSHSMDNDQMASVFYTTI
FT                   VPMLNPVVYSLRNKEVHNAFKKVVEKMNTLLNS"
FT   assembly_gap    3270790..3270809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3283090..>3284098
FT                   /locus_tag="mCG_59039"
FT                   /note="gene_id=mCG59039.1"
FT   mRNA            3283090..>3284098
FT                   /locus_tag="mCG_59039"
FT                   /product="mCG59039"
FT                   /note="gene_id=mCG59039.1 transcript_id=mCT59222.1 created
FT                   on 08-OCT-2002"
FT   CDS             3283121..3284098
FT                   /codon_start=1
FT                   /locus_tag="mCG_59039"
FT                   /product="mCG59039"
FT                   /note="gene_id=mCG59039.1 transcript_id=mCT59222.1
FT                   protein_id=mCP32004.1"
FT                   /db_xref="GOA:Q8VF19"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VF19"
FT                   /protein_id="EDL41496.1"
FT                   /translation="MYVANSSRMNAFILLGLTDNPDLEAPLFIIFNLIYLITLIGNLGM
FT                   IVLIWFDSHLHTPMYIFLSHLSLADCVYSSAVTPKVMVGLLTGDKVISYGGCVAQMFFF
FT                   VTFASVDCFLLAVMAFDRHAAVCKPLHYTTNMTTSVCACMVIACYVFSLAESSVYTGFI
FT                   FDLSFCHSNVIHHFFCDIPPILNLSCSDIYTNEIVLFIITSFNVFFSLIVILTSYAFIF
FT                   IAILRMHSAEGRKKASSTCASHLTAVTIFYGTIIFMYLQPSSSHSMDNDQMASVFYTTV
FT                   VPMLNPVVYSLRNKEVHSAFKKAIEKLKSAQHQVLIRDLYSLCN"
FT   assembly_gap    3288145..3288195
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            <3328502..>3329434
FT                   /gene="Olfr1451"
FT                   /locus_tag="mCG_55172"
FT                   /note="gene_id=mCG55172.2"
FT   mRNA            <3328502..>3329434
FT                   /gene="Olfr1451"
FT                   /locus_tag="mCG_55172"
FT                   /product="olfactory receptor 1451"
FT                   /note="gene_id=mCG55172.2 transcript_id=mCT55355.2 created
FT                   on 08-OCT-2002"
FT   CDS             3328502..3329434
FT                   /codon_start=1
FT                   /gene="Olfr1451"
FT                   /locus_tag="mCG_55172"
FT                   /product="olfactory receptor 1451"
FT                   /note="gene_id=mCG55172.2 transcript_id=mCT55355.2
FT                   protein_id=mCP31999.2"
FT                   /db_xref="GOA:Q8VFX5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031285"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX5"
FT                   /protein_id="EDL41497.1"
FT                   /translation="MENCTKVREFILLGLTDDPGLQVSLCIMFTLIYLIDVVGNTGLIM
FT                   LVLMDSHLHTPMYFFLCNLSFVDLGYSSAVTPMVISEFFIVSKVVSYNACAAQMFFFVG
FT                   FATGENYLLASMAYDRYVAVCKPLHYSTRMTTSVCICLNIVSYICGFLNAIFHVGDIFS
FT                   LSFCKSNVVHHFFCDVPAVLALSCSDIHLSEVILVFLSTFNVFFALLIISVSYLFIFIT
FT                   VLKMKSDQGHQKALSTCASHLTVVSIFYSTVIFMYLQPSSSHSMDADKVASMFYTMIIP
FT                   TLNPLVYSLRNKEVNNAFKKVVERAKIFM"
FT   assembly_gap    3355139..3355486
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   gene            complement(<3356743..>3357666)
FT                   /locus_tag="mCG_64059"
FT                   /note="gene_id=mCG64059.0"
FT   mRNA            complement(<3356743..>3357666)
FT                   /locus_tag="mCG_64059"
FT                   /product="mCG64059"
FT                   /note="gene_id=mCG64059.0 transcript_id=mCT64242.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(3356743..3357666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64059"
FT                   /product="mCG64059"
FT                   /note="gene_id=mCG64059.0 transcript_id=mCT64242.0
FT                   protein_id=mCP31954.0"
FT                   /db_xref="GOA:Q8VFX0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031287"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX0"
FT                   /protein_id="EDL41498.1"
FT                   /translation="MENRTEVRCFILVGLTNDPSLQLPLSITFLLIYIITLIGNLGLIL
FT                   MILLDSRLHTPMYIFLGNLSLVDFCYSSTVTPKVIAGFLTGDKIMSYNACASQMFFFAN
FT                   FGDVENYLLASMAYDRYVAVCKPLHYATTMTTHMCASLVIGCYICGFLSASIYTMDALS
FT                   LSFCESNVIHHFFCDVLAVMIVSCSDSHVNELILIYVVSFNMFFALIIILISYMFIFTN
FT                   ILKIHSSAGYHKAVSTCASHFTAVSIFYGTIIFMYLQPSSSHTMDTDKIASVFYTMVIC
FT                   MLNPLVYSLRSKDVKSAFTKIVLRSK"
FT   assembly_gap    3369277..3378007
FT                   /estimated_length=8731
FT                   /gap_type="unknown"
FT   gene            3379161..3932064
FT                   /locus_tag="mCG_1045165"
FT                   /note="gene_id=mCG1045165.1"
FT   mRNA            join(3379161..3379647,3932010..3932064)
FT                   /locus_tag="mCG_1045165"
FT                   /product="mCG1045165"
FT                   /note="gene_id=mCG1045165.1 transcript_id=mCT162869.1
FT                   created on 28-APR-2003"
FT   CDS             join(3379171..3379647,3932010..3932051)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045165"
FT                   /product="mCG1045165"
FT                   /note="gene_id=mCG1045165.1 transcript_id=mCT162869.1
FT                   protein_id=mCP64334.1"
FT                   /protein_id="EDL41499.1"
FT                   /translation="MLRSGTRKRERTKPFKCAGAPLTNFRLIELVKGISSGPSHCGQLC
FT                   FTQYIHSSIAISLSLKIPSSTLSHGISGISKSFPVGHLLINTSANHSNKLLTPFLTMRA
FT                   SVLNLESLLRGPMSINSACSSFMFLPPLSHTLKIHSHTYSPGFCLNELANSLSSLRPSC
FT                   EKVSPSQSH"
FT   gene            <3390804..>3391718
FT                   /locus_tag="mCG_56357"
FT                   /note="gene_id=mCG56357.2"
FT   mRNA            <3390804..>3391718
FT                   /locus_tag="mCG_56357"
FT                   /product="mCG56357"
FT                   /note="gene_id=mCG56357.2 transcript_id=mCT56540.2 created
FT                   on 08-OCT-2002"
FT   CDS             3390804..>3391718
FT                   /codon_start=1
FT                   /locus_tag="mCG_56357"
FT                   /product="mCG56357"
FT                   /note="gene_id=mCG56357.2 transcript_id=mCT56540.2
FT                   protein_id=mCP31991.2"
FT                   /protein_id="EDL41500.1"
FT                   /translation="MENRTEVRCFILVGLTNDPGLQLPLFITFLLIYIITLIGNLGLIL
FT                   LILLDSRLHTPMYIFLGNLSLVDFCYSSTVTPKVIAGFLMGDKIMSYNACASQMFFFAN
FT                   FADVENYLLVSMAYDRYVAVCKPLHYATTMTTHMCVCLLIGCYICGFLNASIYTVDALS
FT                   LSFCESNVVHHFFCDVLAVMIISCSDRHVNELIFVYVASFNIFFALILIIISYTFIFTN
FT                   ILKLQSAAGYRKAFFTCASHFTAVSIFYGTIIFMYLQPSSSHSMDTDKIASVFYTMVIP
FT                   MLNPLVYSLRNKDVKSAFTKIILR"
FT   gene            complement(<3422097..>3423041)
FT                   /gene="Olfr1457"
FT                   /locus_tag="mCG_1045085"
FT                   /note="gene_id=mCG1045085.1"
FT   mRNA            complement(<3422097..>3423041)
FT                   /gene="Olfr1457"
FT                   /locus_tag="mCG_1045085"
FT                   /product="olfactory receptor 1457"
FT                   /note="gene_id=mCG1045085.1 transcript_id=mCT162789.1
FT                   created on 08-OCT-2002"
FT   CDS             complement(3422097..3423041)
FT                   /codon_start=1
FT                   /gene="Olfr1457"
FT                   /locus_tag="mCG_1045085"
FT                   /product="olfactory receptor 1457"
FT                   /note="gene_id=mCG1045085.1 transcript_id=mCT162789.1
FT                   protein_id=mCP64483.1"
FT                   /db_xref="GOA:Q7TQR4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQR4"
FT                   /protein_id="EDL41501.1"
FT                   /translation="MENNTKVTEFLLLGLTNDPELQLPLFLIFLLIYTITLVGNLGLIL
FT                   LIVLDSCLHTPMYIFLGNLSLVDFCYSSAVTPSVMTELLIGKKVISYNDCAAQTFFFVA
FT                   FCTVENYLLASMAYDRYAAVCKPLHYASTMTTRVCIYLSIGSYVCGFLNASINTGNTFS
FT                   LFFCRYNMIHHFFCDIPAVMVLSCSDRYFSELLLVYVVSFSIFFALLVICISYIFIFIT
FT                   IAKMHSSAGYGKAAPTCASHFTAVSIFYGTVIFMYLLPSSSHSMDTDQIASVFYTMIIP
FT                   MLNPLVYSLRNKEVKSAFTKIFQVAKQSVMLYF"
FT   assembly_gap    3430692..3431054
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    3448499..3453455
FT                   /estimated_length=4957
FT                   /gap_type="unknown"
FT   gene            complement(3464660..3472109)
FT                   /locus_tag="mCG_125155"
FT                   /note="gene_id=mCG125155.1"
FT   mRNA            complement(join(3464660..3464903,3471836..3472109))
FT                   /locus_tag="mCG_125155"
FT                   /product="mCG125155"
FT                   /note="gene_id=mCG125155.1 transcript_id=mCT126413.1
FT                   created on 08-OCT-2002"
FT   CDS             complement(3471950..3472015)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125155"
FT                   /product="mCG125155"
FT                   /note="gene_id=mCG125155.1 transcript_id=mCT126413.1
FT                   protein_id=mCP64197.1"
FT                   /protein_id="EDL41502.1"
FT                   /translation="MDSENYGMFQPWVITALLTTP"
FT   assembly_gap    3480350..3480456
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    3482919..3482938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3536672..3538809
FT                   /estimated_length=2138
FT                   /gap_type="unknown"
FT   assembly_gap    3570214..3570233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3571251..3571270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3573250..3573269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3574294..3578152
FT                   /estimated_length=3859
FT                   /gap_type="unknown"
FT   assembly_gap    3592804..3592823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3593947..3593966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3597134..3597166
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    3642876..3643048
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    3648964..3649128
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            <3672907..>3673833
FT                   /gene="Olfr1466"
FT                   /locus_tag="mCG_66488"
FT                   /note="gene_id=mCG66488.2"
FT   mRNA            <3672907..>3673833
FT                   /gene="Olfr1466"
FT                   /locus_tag="mCG_66488"
FT                   /product="olfactory receptor 1466"
FT                   /note="gene_id=mCG66488.2 transcript_id=mCT66671.2 created
FT                   on 09-OCT-2002"
FT   CDS             3672907..>3673833
FT                   /codon_start=1
FT                   /gene="Olfr1466"
FT                   /locus_tag="mCG_66488"
FT                   /product="olfactory receptor 1466"
FT                   /note="gene_id=mCG66488.2 transcript_id=mCT66671.2
FT                   protein_id=mCP31895.2"
FT                   /protein_id="EDL41503.1"
FT                   /translation="MTSLNNLTEVTHFLLLGLTDDPGLQLPLFIIFLLIYIITLVGNLG
FT                   MILLILLDSRLHIPMYFFLANLSLVDVIYSSAVTPKVMAGLIIGDNLISYNECAAQMFF
FT                   FAAFATVENYLLTSMACDRYAAVCKPLYYATTMTPSVCMCFIMGCYALGFLNASVYLGN
FT                   TFSLSFCKSNVVHHFFCDMPAIMALSCSDRHVNELVLIYQASFIIFFALIIILISYIII
FT                   FITILKMHSEAGVQKALSTCASHFTAVFIFYGTTIFMYLQPSSRHAMDTDKIVSVFYTM
FT                   VIPMLNPLVYSLRNKEVKSAFMKVVLKE"
FT   assembly_gap    3683520..3683539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3695694..>3696620
FT                   /gene="Olfr1467"
FT                   /locus_tag="mCG_58962"
FT                   /note="gene_id=mCG58962.0"
FT   mRNA            <3695694..>3696620
FT                   /gene="Olfr1467"
FT                   /locus_tag="mCG_58962"
FT                   /product="olfactory receptor 1467"
FT                   /note="gene_id=mCG58962.0 transcript_id=mCT59145.0 created
FT                   on 09-OCT-2002"
FT   CDS             3695694..3696620
FT                   /codon_start=1
FT                   /gene="Olfr1467"
FT                   /locus_tag="mCG_58962"
FT                   /product="olfactory receptor 1467"
FT                   /note="gene_id=mCG58962.0 transcript_id=mCT59145.0
FT                   protein_id=mCP31960.0"
FT                   /db_xref="GOA:Q8VFW1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031301"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFW1"
FT                   /protein_id="EDL41504.1"
FT                   /translation="MMENQTEVTEFILLGLTDDPELQIPLFITFLAIYTITVVGNLGMI
FT                   LLILMDSRLHTPMYFFLGNLSLVDFCYSSAVTPKVMSGFLIGDKVISYNDCAAQMFIFA
FT                   AFITVENYLLASMAYDRYAAVCKPLHYTTTMTTSVCTWLIIGSYVIGFMNASIHIGDTF
FT                   HLYFCESNVVHHFFCDIPAVMVLSCSDRYASELVLVYIVSFHIFFAFIVIWISYVFIFV
FT                   TIVKMQSAAGHHKAISTCASHFTAVSIFYGTSIFMYVQPSSNHSMDTDKIASVFYTMVI
FT                   PMLNPLVYSLRNKEVKSALKKIILQTT"
FT   assembly_gap    3719689..3719728
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3731382..3731401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3735074..3735110
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            <3743360..>3744289
FT                   /gene="Olfr1469"
FT                   /locus_tag="mCG_66489"
FT                   /note="gene_id=mCG66489.0"
FT   mRNA            <3743360..>3744289
FT                   /gene="Olfr1469"
FT                   /locus_tag="mCG_66489"
FT                   /product="olfactory receptor 1469"
FT                   /note="gene_id=mCG66489.0 transcript_id=mCT66672.1 created
FT                   on 09-OCT-2002"
FT   CDS             3743360..3744289
FT                   /codon_start=1
FT                   /gene="Olfr1469"
FT                   /locus_tag="mCG_66489"
FT                   /product="olfactory receptor 1469"
FT                   /note="gene_id=mCG66489.0 transcript_id=mCT66672.1
FT                   protein_id=mCP31909.0"
FT                   /db_xref="GOA:Q8VFW5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFW5"
FT                   /protein_id="EDL41505.1"
FT                   /translation="MSLMENNTDVTQFLLLGLTDDPGLQFPLFITFLLIYTITLVGNLG
FT                   MILLIVLDSRLHTPMYFFLGNLSLVDFCYSSAVTPTVMTGLIGEKIISYNDCAAQMFFF
FT                   VAFATVENYLLASMAYDRYAAVCKPLHYATTMTANVCICLCIGSYTCGFLNASIHIGDT
FT                   FSLSFCRSNVVHHFFCDIPAVMVLSCSDRHVSELVLVYVVSFNIFFALSVIWISYIFIF
FT                   ITICKMHSSSGYRKAISTCASHFIAVSIFYGTIIFMYLQPSSSHSMDTDKIASVFYTMI
FT                   IPMLNPLVYSMRNKEVKSAFTKVLQVAK"
FT   assembly_gap    3759941..3760061
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            3777632..>3778540
FT                   /locus_tag="mCG_1045092"
FT                   /note="gene_id=mCG1045092.1"
FT   mRNA            3777632..>3778540
FT                   /locus_tag="mCG_1045092"
FT                   /product="mCG1045092"
FT                   /note="gene_id=mCG1045092.1 transcript_id=mCT162796.1
FT                   created on 09-OCT-2002"
FT   CDS             3777752..>3778540
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045092"
FT                   /product="mCG1045092"
FT                   /note="gene_id=mCG1045092.1 transcript_id=mCT162796.1
FT                   protein_id=mCP64534.1"
FT                   /protein_id="EDL41506.1"
FT                   /translation="MIMLILLDSRLHTPMYFFLCNLSLVDCVYASAITPKVIEGFLTGS
FT                   KTISLNGCAAQMFFFVAFIAIESLILASMAYDRHAAVCKPLHYTTIMTSTTCILIVTCC
FT                   YMCGILQSSVHVALAFCLSFCHSNVINHFFCDIPPLLDISCSDTHTNEITLLVLATLDV
FT                   VFTLLVILNTYLLIFIAILRMRSAEAQRKAFSTCASHLITVSIFFGSLIFMYLQPSFNH
FT                   SMDTDKIASVFYTMVIPMLNPVVYSLRNKEVKNAFKKVVEK"
FT   gene            complement(<3786189..>3787124)
FT                   /locus_tag="mCG_1045167"
FT                   /note="gene_id=mCG1045167.1"
FT   mRNA            complement(<3786189..>3787124)
FT                   /locus_tag="mCG_1045167"
FT                   /product="mCG1045167"
FT                   /note="gene_id=mCG1045167.1 transcript_id=mCT162871.1
FT                   created on 09-OCT-2002"
FT   CDS             complement(<3786189..3787124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045167"
FT                   /product="mCG1045167"
FT                   /note="gene_id=mCG1045167.1 transcript_id=mCT162871.1
FT                   protein_id=mCP64356.1"
FT                   /protein_id="EDL41507.1"
FT                   /translation="MENISEVTEFILVGITDAPELQIPLFIIFTLIYLIALFGNLGMIM
FT                   LILLDSRLHTPMYFFLCNLSLVDCVYASAVTPKVMEGFLTGNKIISYNACAAQMFFFVA
FT                   FIAIESLILASMAYDRHAAVCNPLHYTTIMTSTTCILIVTCCYMCGILQSSIHVALAFC
FT                   LSFCNSNVINHFFCDIPPLLEISCSDTYTNEITVLILGTCDGILTLLVILNTYLLIFIA
FT                   ILRMRSVEAQRKAFSTCASHLITVSIFFGSTLFMYLQPSSNHSMNTDKIASVFYTMVIP
FT                   MLNPVVYSLRNKEVKNAFKKVVGKLMTSLQL"
FT   gene            complement(<3795333..3796232)
FT                   /locus_tag="mCG_53135"
FT                   /note="gene_id=mCG53135.2"
FT   mRNA            complement(<3795333..3796232)
FT                   /locus_tag="mCG_53135"
FT                   /product="mCG53135"
FT                   /note="gene_id=mCG53135.2 transcript_id=mCT53318.2 created
FT                   on 09-OCT-2002"
FT   CDS             complement(3795333..3795836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53135"
FT                   /product="mCG53135"
FT                   /note="gene_id=mCG53135.2 transcript_id=mCT53318.2
FT                   protein_id=mCP31927.2"
FT                   /protein_id="EDL41508.1"
FT                   /translation="MTSSTCILIVTCCYMCGILQSSVHVALAFCLFFCHSNMINHFSCD
FT                   IPPLLEISRSDTHTNGITPLILATLDLVFTLLVILNTYLLIFIAILRMHSAEAQRKDFS
FT                   TRVSHLITASIFFGSLIFMYLQPSSSHSPEADKIASVFYTMVIPIYVQPCGLQPEEYRG
FT                   QVCI"
FT   gene            complement(<3811863..3812839)
FT                   /locus_tag="mCG_65831"
FT                   /note="gene_id=mCG65831.2"
FT   mRNA            complement(<3811863..3812839)
FT                   /locus_tag="mCG_65831"
FT                   /product="mCG65831"
FT                   /note="gene_id=mCG65831.2 transcript_id=mCT66014.2 created
FT                   on 09-OCT-2002"
FT   CDS             complement(3811863..3812807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_65831"
FT                   /product="mCG65831"
FT                   /note="gene_id=mCG65831.2 transcript_id=mCT66014.2
FT                   protein_id=mCP31919.2"
FT                   /db_xref="GOA:Q8VEV6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031309"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEV6"
FT                   /protein_id="EDL41509.1"
FT                   /translation="MENISEVTEFILMGITDAPELQIPLFIIFTLIYLIALFGNLGMIM
FT                   LILLDSRLHSPMYFFLCNLSLVDCVYASAVTPKVMEGFLTGNKIISYNACAAQMFFFVA
FT                   FGAIESLILASMAYDRHAAVCKPLHYTTIMTSTTCILIVTCCYMCGILQSSIHVALAFC
FT                   LSFCNSNVINHFFCDIPPLLDISCSDTYTNEITVLILGTCDGILTLLVILNTYLLIFIA
FT                   ILRMRSAEAQRKAFSTCASHLITVFIFFGSTLFMYLQPSSNHSMDTDKIASVFYTMVIP
FT                   MLNPVVYSLRNKEVKNAFKKVVGKLMTSLQLVN"
FT   gene            <3834963..>3835907
FT                   /locus_tag="mCG_58966"
FT                   /note="gene_id=mCG58966.2"
FT   mRNA            <3834963..>3835907
FT                   /locus_tag="mCG_58966"
FT                   /product="mCG58966"
FT                   /note="gene_id=mCG58966.2 transcript_id=mCT59149.2 created
FT                   on 09-OCT-2002"
FT   CDS             3834963..3835907
FT                   /codon_start=1
FT                   /locus_tag="mCG_58966"
FT                   /product="mCG58966"
FT                   /note="gene_id=mCG58966.2 transcript_id=mCT59149.2
FT                   protein_id=mCP31994.2"
FT                   /protein_id="EDL41510.1"
FT                   /translation="MQNISELSEFILVGLTDAPFLQTPLFIIFTLIYLTTLFGNLGMIM
FT                   LILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVMEGFLTGNKIISYNACAAQMFFFVA
FT                   FAITENFILASMAYDRHAAVCKPLHYSTTMTTTICVLLLVGSYLSGLLHSSIHVSFTFH
FT                   LSFCRSNVVNHFFCDIPPLLAVSCSSIRTNEIILFMLAGFDVAFSLLVILTSYLLISVA
FT                   IVRMRSAESRKKAISTCASHLTTVSIFYGTIIFMYLQPSSNHSMDTDKMASVFYTMVIP
FT                   MLNPLVYSLRNKEVKNAFKKVAGKAVLSLGLIN"
FT   assembly_gap    3844907..3845028
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            3862363..>3863336
FT                   /locus_tag="mCG_1045095"
FT                   /note="gene_id=mCG1045095.1"
FT   mRNA            3862363..>3863336
FT                   /locus_tag="mCG_1045095"
FT                   /product="mCG1045095"
FT                   /note="gene_id=mCG1045095.1 transcript_id=mCT162799.1
FT                   created on 09-OCT-2002"
FT   CDS             3862389..3863336
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045095"
FT                   /product="mCG1045095"
FT                   /note="gene_id=mCG1045095.1 transcript_id=mCT162799.1
FT                   protein_id=mCP64550.1"
FT                   /db_xref="GOA:Q7TQQ6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQQ6"
FT                   /protein_id="EDL41511.1"
FT                   /translation="MIQNISELSEFILVGLTDAPLLQTPLFIIFTLTYLTTLFGNLGMI
FT                   LLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVMEGFLIENKIISYNACAAQMFFFV
FT                   AFVITESFILASMAYDRYAAVCKPLHYSTTMTTMICVLLLAGSYVSGLLQSSIHVSFTF
FT                   QLSFCHSNVVNHFFCDIPPLLALSCSSIYTNEIILFMLAAFNVAFTLLVILSSYLLIFV
FT                   AILKMRSAESRKKTISTCASHLTTVSIFYGTIIFMYLQPSSNHSMDTDKLASVFYTMVI
FT                   PMLNPLVYSLRNKEVKNAFKKVAGKAVLSLGLVN"
FT   assembly_gap    3870404..3871290
FT                   /estimated_length=887
FT                   /gap_type="unknown"
FT   assembly_gap    3913529..3913548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3917859..>3918806
FT                   /locus_tag="mCG_57670"
FT                   /note="gene_id=mCG57670.0"
FT   mRNA            <3917859..>3918806
FT                   /locus_tag="mCG_57670"
FT                   /product="mCG57670"
FT                   /note="gene_id=mCG57670.0 transcript_id=mCT57853.0 created
FT                   on 09-OCT-2002"
FT   CDS             3917859..3918806
FT                   /codon_start=1
FT                   /locus_tag="mCG_57670"
FT                   /product="mCG57670"
FT                   /note="gene_id=mCG57670.0 transcript_id=mCT57853.0
FT                   protein_id=mCP31915.0"
FT                   /db_xref="GOA:Q8VEU6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEU6"
FT                   /protein_id="EDL41512.1"
FT                   /translation="MMQNISELSEFILLGLTDAPFLQTPLFIIFTLIYLTTLFGNLGMI
FT                   LLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVIEGFLTENKIISYNACAAQMFFFV
FT                   AFAITECFILASMAYDRHAAVCKPLHYSTTMTTTICVLLLAGSYLSGLLQSSIHVSFTF
FT                   HLSFCRSNVVNHFFCDIPPLLALSCSSIHINEIILFMLAGFNVVFSLLVILTSYLLISV
FT                   AIVRMRSAESRKKAISTCASHLTTVSIFYGTIIFMYLQPSSNHSMDTDKMASVFYTMVI
FT                   PMLNPLVYSLRNKEVKNAVRKVAGKALFSLGLVN"
FT   gene            <3951719..>3952666
FT                   /locus_tag="mCG_58964"
FT                   /note="gene_id=mCG58964.0"
FT   mRNA            <3951719..>3952666
FT                   /locus_tag="mCG_58964"
FT                   /product="mCG58964"
FT                   /note="gene_id=mCG58964.0 transcript_id=mCT59147.1 created
FT                   on 09-OCT-2002"
FT   CDS             3951719..3952666
FT                   /codon_start=1
FT                   /locus_tag="mCG_58964"
FT                   /product="mCG58964"
FT                   /note="gene_id=mCG58964.0 transcript_id=mCT59147.1
FT                   protein_id=mCP31977.0"
FT                   /db_xref="GOA:Q8VFQ6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031321"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFQ6"
FT                   /protein_id="EDL41513.1"
FT                   /translation="MIQNISELSEFILVGLTDAPFLQIPLFIIFTLIYLTTLFGNLGMI
FT                   LLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVMEGFLTGNKIISYNACAAQMFFFA
FT                   AFATVESFMLASMAYDRHAAVCKPLHYSTTMTTTICVLLLAGSYVSGLLQSSIHVSFTF
FT                   QLSFCHSNVVNHFFCDIPPLLALSCSSIHTNEIILFMLAAFNVAFTLLVILSSYLLIFV
FT                   AILRMRSAESRKKAISTCASHLTTVSIFYGTIIFMYLQPSSNHSMDTDKMASVFYTMVI
FT                   PMLNPLVYSLRNKEVKNAFKKVAGKAVLSLGLVN"
FT   assembly_gap    3986792..3986811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3986985..>3987950
FT                   /locus_tag="mCG_55716"
FT                   /note="gene_id=mCG55716.1"
FT   mRNA            <3986985..>3987950
FT                   /locus_tag="mCG_55716"
FT                   /product="mCG55716"
FT                   /note="gene_id=mCG55716.1 transcript_id=mCT55899.1 created
FT                   on 09-OCT-2002"
FT   CDS             3986985..3987950
FT                   /codon_start=1
FT                   /locus_tag="mCG_55716"
FT                   /product="mCG55716"
FT                   /note="gene_id=mCG55716.1 transcript_id=mCT55899.1
FT                   protein_id=mCP31955.1"
FT                   /db_xref="GOA:A0A1L1SVH0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L1SVH0"
FT                   /protein_id="EDL41514.1"
FT                   /translation="MAVDSMTWKNHSLFMEFVFLAYPKRPELRMLCFFGVSLAYGLIIS
FT                   GNILIVVSIQTETRLHTPMYYFLGSLSGIELCYTAVVVPHILANNFQSEKTISLLSCAT
FT                   QMVFLIGLGSADCFLLAIMAYDRYVAICHPLQYPLIMTITLCVRLVVASVVIGLFLSLQ
FT                   LVVFIFCLPFCQDRGIEHFFCDAPPLMRLVCATSHIHELSVLMAATLAIAVPFFFIATT
FT                   YALIVAAVLKLHSAAGRHRAFNTCSSHLTVVLLQYGCCAFMYLRPVSSYHPKQDQFVSL
FT                   VYTLGTPFLNPLIYTLRNSEMKGAIGKVLTRKYLSWKMIG"
FT   assembly_gap    4005274..4005293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017701..4020125
FT                   /estimated_length=2425
FT                   /gap_type="unknown"
FT   assembly_gap    4023706..4023725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4030479..>4038768
FT                   /locus_tag="mCG_53399"
FT                   /note="gene_id=mCG53399.1"
FT   mRNA            join(<4030479..4030566,4037804..>4038768)
FT                   /locus_tag="mCG_53399"
FT                   /product="mCG53399"
FT                   /note="gene_id=mCG53399.1 transcript_id=mCT53582.1 created
FT                   on 09-OCT-2002"
FT   CDS             join(4030479..4030566,4037804..4038768)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53399"
FT                   /product="mCG53399"
FT                   /note="gene_id=mCG53399.1 transcript_id=mCT53582.1
FT                   protein_id=mCP31983.1"
FT                   /protein_id="EDL41515.1"
FT                   /translation="MLNKNLMKGLLQSSVVATLILGSRINFLFEDMLTGKLVLNQSGTP
FT                   EFVFRVFTNAPEFQALLFTLFLLLYLMIFCGNTAIIWVVCTHTSLHTPMYFFLSSLSFL
FT                   EICYTTDVVPLMLSNIFGTQKPISLAGCGTQMFFFLTLGGTDCFLLAIMAYDRYVAICH
FT                   PLHYNLIMTKKLCVQMVMGSLSLALFLSLQLTALIFTLPFCGHYLEINHFLCDVPPVLR
FT                   LACADIHVHQAVLYVVGILVLTVPFLLIFISYVFIVSTILRMRSAEGRQRAFSTCSSHL
FT                   TVVLLQYGGCSLVYLRPRSSSSDDEDRQIALVYTFVTPLLNPLIYTLRNKDVKGALRNS
FT                   IFCKSASHCS"
FT   assembly_gap    4034499..4034518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4059200..4060188
FT                   /locus_tag="mCG_142301"
FT                   /note="gene_id=mCG142301.0"
FT   mRNA            <4059200..4060188
FT                   /locus_tag="mCG_142301"
FT                   /product="mCG142301"
FT                   /note="gene_id=mCG142301.0 transcript_id=mCT179817.0
FT                   created on 07-FEB-2003"
FT   CDS             4059200..4059898
FT                   /codon_start=1
FT                   /locus_tag="mCG_142301"
FT                   /product="mCG142301"
FT                   /note="gene_id=mCG142301.0 transcript_id=mCT179817.0
FT                   protein_id=mCP102739.0"
FT                   /protein_id="EDL41516.1"
FT                   /translation="MISFNIRRIFVVSMTWENHSVLMEFVFLAYPNRLELRMFCFLGIS
FT                   LAYALIISGNILIMVSIQTETRLHSPMYYFLGSLSGIELCYTAVVVPHILANTLKSEKN
FT                   ITLLSCATQMVFFIGLGSADCFLLASMAYDRYVAICHPLQYPLIMTVTLCVRLVLASVV
FT                   IGLVLSLQLVVFIFCLPFCQDRGIEHFFCDVPPVMRLVCATSHIHELSVLVAAALAIAV
FT                   PFFFLRLHMP"
FT   assembly_gap    4080470..4080489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4082425..>4083374
FT                   /gene="Olfr1494"
FT                   /locus_tag="mCG_58967"
FT                   /note="gene_id=mCG58967.1"
FT   mRNA            4082425..>4083374
FT                   /gene="Olfr1494"
FT                   /locus_tag="mCG_58967"
FT                   /product="olfactory receptor 1494"
FT                   /note="gene_id=mCG58967.1 transcript_id=mCT59150.2 created
FT                   on 09-OCT-2002"
FT   CDS             4082427..4083374
FT                   /codon_start=1
FT                   /gene="Olfr1494"
FT                   /locus_tag="mCG_58967"
FT                   /product="olfactory receptor 1494"
FT                   /note="gene_id=mCG58967.1 transcript_id=mCT59150.2
FT                   protein_id=mCP32010.2"
FT                   /db_xref="GOA:Q8VGP8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031328"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGP8"
FT                   /protein_id="EDL41517.1"
FT                   /translation="MLTGKSVLNQSGTTEFVFRVFTTVPEFQALLFLLFLLLYLMILCG
FT                   NAAIIWVVCTHSALHTPMYFFLSSLSVLEIFYTTDVVPLMLSNIFGAQKPISLAGCGTQ
FT                   MFFFVTLGSTDCFLLAVMAYDRYVAICHPLHYSLIMTKKLCVQMVMGSWSLALFLSLQL
FT                   TALIFTLPFCGHDQEINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLICIS
FT                   YVFIASTILRMRSAEGRQRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIAL
FT                   VYTFVTPLLNPLIYTLRNKDVKGALKNSIFHKAV"
FT   assembly_gap    4095454..4095722
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   gene            <4101369..>4102328
FT                   /gene="Olfr1495"
FT                   /locus_tag="mCG_58968"
FT                   /note="gene_id=mCG58968.0"
FT   mRNA            <4101369..>4102328
FT                   /gene="Olfr1495"
FT                   /locus_tag="mCG_58968"
FT                   /product="olfactory receptor 1495"
FT                   /note="gene_id=mCG58968.0 transcript_id=mCT59151.0 created
FT                   on 09-OCT-2002"
FT   CDS             4101369..4102328
FT                   /codon_start=1
FT                   /gene="Olfr1495"
FT                   /locus_tag="mCG_58968"
FT                   /product="olfactory receptor 1495"
FT                   /note="gene_id=mCG58968.0 transcript_id=mCT59151.0
FT                   protein_id=mCP32013.0"
FT                   /db_xref="GOA:Q8VEZ4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031329"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEZ4"
FT                   /protein_id="EDL41518.1"
FT                   /translation="MVDRNPFFNKSGPPEFVFRVLTNVPEFQAILFTLFFLLYLMILCG
FT                   NTTIIWVVCNHSSLHTPMYFFLGSLSFVEICYITDVVPLILSNIFGDQKPISLAGCGTQ
FT                   MFFFSVFGCTDCFLLTVMAYDRYVAICHPLHYNLIMTQKLCVQMVIGSLSLALLLSLEL
FT                   TAFTFTLPFCRHRLEINHFLCDVAPIMRLACADIHVNQAVLYVVSILVLTVPFLLIFIS
FT                   YVFIASTILRMHSAEGRQRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIAL
FT                   VYIFGTPLLNPLIYTLRNKDIKDALRNSFFHVPASDTS"
FT   assembly_gap    4104050..4109367
FT                   /estimated_length=5318
FT                   /gap_type="unknown"
FT   gene            4112759..>4113718
FT                   /gene="Olfr1496"
FT                   /locus_tag="mCG_1045105"
FT                   /note="gene_id=mCG1045105.0"
FT   mRNA            4112759..>4113718
FT                   /gene="Olfr1496"
FT                   /locus_tag="mCG_1045105"
FT                   /product="olfactory receptor 1496"
FT                   /note="gene_id=mCG1045105.0 transcript_id=mCT162809.1
FT                   created on 09-OCT-2002"
FT   CDS             4112765..4113718
FT                   /codon_start=1
FT                   /gene="Olfr1496"
FT                   /locus_tag="mCG_1045105"
FT                   /product="olfactory receptor 1496"
FT                   /note="gene_id=mCG1045105.0 transcript_id=mCT162809.1
FT                   protein_id=mCP64167.1"
FT                   /db_xref="GOA:B9EHG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031330"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHG2"
FT                   /protein_id="EDL41519.1"
FT                   /translation="MNMDQENQTSISEFILLGLSNQAEKQKLIFVIFLSMYLVTVIGNS
FT                   LIILAIGLDIHLHTPMYLFLANLSFADISSSSTSVPKMLMNIQTNSQSISYEGCITQMY
FT                   FSIVFVVIDNFLLGVMAYDRYVAICHPLNYTNIMHPRFCLLLSFCPWALSNIVALTHTL
FT                   LANQLIFCNHNTIQHFFCDLAPLIKLSCSDAMINELVKFVVGLSVITFPFALILFSYVC
FT                   IIRDVLRISSTEGKWKAFSTCGSHLTIVFLFYGTIVGVYFFPSSTHPEDTDKIGAVLFT
FT                   VVTPMLNPFIYSLRNKDMKGALRKLINKSHLLPLMS"
FT   gene            complement(<4126821..>4127765)
FT                   /gene="Olfr1497"
FT                   /locus_tag="mCG_53400"
FT                   /note="gene_id=mCG53400.2"
FT   mRNA            complement(<4126821..>4127765)
FT                   /gene="Olfr1497"
FT                   /locus_tag="mCG_53400"
FT                   /product="olfactory receptor 1497"
FT                   /note="gene_id=mCG53400.2 transcript_id=mCT53583.2 created
FT                   on 09-OCT-2002"
FT   CDS             complement(4126821..4127765)
FT                   /codon_start=1
FT                   /gene="Olfr1497"
FT                   /locus_tag="mCG_53400"
FT                   /product="olfactory receptor 1497"
FT                   /note="gene_id=mCG53400.2 transcript_id=mCT53583.2
FT                   protein_id=mCP31995.2"
FT                   /db_xref="GOA:Q8VG11"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031331"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VG11"
FT                   /protein_id="EDL41520.1"
FT                   /translation="MAGRNYTFVTEFFLTAFTEHPEWGLPLFLLFLSFYLATLLGNTGM
FT                   IILIQKNRRLQTPMYFFLSHLSFVDICYSSVIIPQMLAVLWEHGSTISQVRCAVQFFLF
FT                   TFFASIDCYLLAIMAYDRYVAVCQPLLYVTIMTEKARVGLVTGAYVAGFSSGFIRTVTA
FT                   FTLSFCGNNEINFIFCDLPPLLKLVCGDSYIQEVVIIVFAIFVMPACIVVISVSYLFII
FT                   VAIMQIRSAGGRAKTFSTCTSHLTAVALFFGTLIFMYLRDNTDQFSERDRVVSVFYTVV
FT                   TPLLNPLIYSLRNKEVKEAITKSLRRSKISRAP"
FT   gene            complement(<4146800..>4147744)
FT                   /gene="Olfr1499"
FT                   /locus_tag="mCG_142300"
FT                   /note="gene_id=mCG142300.0"
FT   mRNA            complement(<4146800..>4147744)
FT                   /gene="Olfr1499"
FT                   /locus_tag="mCG_142300"
FT                   /product="olfactory receptor 1499"
FT                   /note="gene_id=mCG142300.0 transcript_id=mCT179816.0
FT                   created on 07-FEB-2003"
FT   CDS             complement(4146800..4147744)
FT                   /codon_start=1
FT                   /gene="Olfr1499"
FT                   /locus_tag="mCG_142300"
FT                   /product="olfactory receptor 1499"
FT                   /note="gene_id=mCG142300.0 transcript_id=mCT179816.0
FT                   protein_id=mCP102738.0"
FT                   /db_xref="GOA:Q8VG65"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VG65"
FT                   /protein_id="EDL41521.1"
FT                   /translation="MDNNNLTTVTEFILVGFTDHPEWEVPLFLVFLCFYLVTILGNLGM
FT                   VILIQMDVQLQSPMYFFLSHLSVLDACYTSVITPQILAMLATGKTVISYNHCAAQFFFF
FT                   TFCASTECFLLAVMSYDRYVAISNPLLYTVAMSPKKCWSLVLVAYVCGLSGSIQRTTCT
FT                   FSLSFCEDNKINFFFCDLPPLLKLACSDTTNAEIIIVLFGNFVILVNALVILTSYLLII
FT                   KTVMRIKSSGGRGKTFSTCVSHLTAVALFFGTLTFMYIRSGSGKSPEEDKVVSVFYTVI
FT                   IPMLNPLIYSLRNKDVKAGFRKLTSRLQVSQSV"
FT   assembly_gap    4167120..4167139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4170411..>4185775)
FT                   /locus_tag="mCG_66490"
FT                   /note="gene_id=mCG66490.1"
FT   mRNA            complement(join(<4170411..4171372,4182365..4182385,
FT                   4185754..>4185775))
FT                   /locus_tag="mCG_66490"
FT                   /product="mCG66490"
FT                   /note="gene_id=mCG66490.1 transcript_id=mCT66673.1 created
FT                   on 09-OCT-2002"
FT   CDS             complement(join(4170411..4171372,4182365..4182385,
FT                   4185754..4185775))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66490"
FT                   /product="mCG66490"
FT                   /note="gene_id=mCG66490.1 transcript_id=mCT66673.1
FT                   protein_id=mCP31912.0"
FT                   /protein_id="EDL41522.1"
FT                   /translation="MDIEGLRRTFGFAEGEFGFMADNGTRLTEFILIGFQLQAELQLCL
FT                   FFIFLAFYLITIVGNLGMIMLIQSDPRLQTPMYFFLSHLSFLDVCYSSVIVPQLLETLG
FT                   SNKMVITYERCATQFFFFTLYASTECFLLAVMAYDRYVAVCNPLLYAMAMTPQTRLGLV
FT                   AAAYSGAMVNTVVRTGCTFSISFCKSNQVDFFFCDLPPLLKLSCSETKLREQVIFLFAF
FT                   LVITTSVSVILVSYLFIIWAILKIRTAGAKAKTFSTCASHMIAVALFFGTLIFMYLKGN
FT                   MGKSLWQDKIVSVFYTVVIPMLNPMIYSLRNKEVKEALKKAFKRIKASQESKT"
FT   gene            <4193992..>4194942
FT                   /locus_tag="mCG_55155"
FT                   /note="gene_id=mCG55155.2"
FT   mRNA            <4193992..>4194942
FT                   /locus_tag="mCG_55155"
FT                   /product="mCG55155"
FT                   /note="gene_id=mCG55155.2 transcript_id=mCT55338.2 created
FT                   on 09-OCT-2002"
FT   CDS             4193992..4194942
FT                   /codon_start=1
FT                   /locus_tag="mCG_55155"
FT                   /product="mCG55155"
FT                   /note="gene_id=mCG55155.2 transcript_id=mCT55338.2
FT                   protein_id=mCP31950.2"
FT                   /db_xref="GOA:Q8VG66"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VG66"
FT                   /protein_id="EDL41523.1"
FT                   /translation="MAKNNITTVTEFILIGFNDHPKWEIPLLLVFLSFYLVTMLGNLGM
FT                   VILIHVDVQLHIPMYFFLSHLSVLDACYTSVITPQILATLATGKTVISYRCCAAQFFFF
FT                   TICAATECFLLSVMAYDRYVAISNPLLYTVAMGPRKCWSLVVGAYICGVCGAILRTTCT
FT                   FSLSFCENNQINFFFCDLPPLLKLACSDTTNIEIIIVFFGNFVILANALVILISYLLII
FT                   KAVMRMKSSGRRAKTFSTCVSHLTAVALLFGTLIFMYIRSGSKKSLDEDKVVSVFYTVV
FT                   IPMLNPLIYSLRNKDVKAAFKKVTGKCQVSQCTQH"
FT   assembly_gap    4197903..4197934
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4208787..4209088
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    4210988..4211007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4214066..4214085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4222718..4223638)
FT                   /locus_tag="mCG_1045110"
FT                   /note="gene_id=mCG1045110.1"
FT   mRNA            complement(<4222718..4223638)
FT                   /locus_tag="mCG_1045110"
FT                   /product="mCG1045110"
FT                   /note="gene_id=mCG1045110.1 transcript_id=mCT162814.1
FT                   created on 09-OCT-2002"
FT   CDS             complement(<4222718..4223635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045110"
FT                   /product="mCG1045110"
FT                   /note="gene_id=mCG1045110.1 transcript_id=mCT162814.1
FT                   protein_id=mCP64221.1"
FT                   /protein_id="EDL41524.1"
FT                   /translation="MADNGTRLTEFILMGFQLQAELQLGLFFTFLTFYLITIAGNLGMI
FT                   MLIQSDPRLQTPMYFFLSHLSFLDICYSSVIVPQLLEILGNNKMVITYEHCATQFFFFT
FT                   FYASTECFLLAVMAYDRYVAVCNPLLYAMAMTPQTRLGLVAAAYSGAMVNTVVRTGCTF
FT                   SISFCKSNQVDFLFCDLPPLMKLACSETKLQEQVIFLFAFLVIITSVSVILVSYLFIIW
FT                   AILKIRTAGAKAKTFSTCASHMIAVALFFGTIIFMYLKGNMGKSLWEDKIVSVFYTVVI
FT                   PMLNPMIYSLRNKEVKEALKKAFKR"
FT   assembly_gap    4236269..4237595
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   gene            <4250267..>4251211
FT                   /locus_tag="mCG_1045111"
FT                   /note="gene_id=mCG1045111.1"
FT   mRNA            <4250267..>4251211
FT                   /locus_tag="mCG_1045111"
FT                   /product="mCG1045111"
FT                   /note="gene_id=mCG1045111.1 transcript_id=mCT162815.1
FT                   created on 09-OCT-2002"
FT   CDS             4250267..>4251211
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045111"
FT                   /product="mCG1045111"
FT                   /note="gene_id=mCG1045111.1 transcript_id=mCT162815.1
FT                   protein_id=mCP64529.1"
FT                   /protein_id="EDL41525.1"
FT                   /translation="MAKNNITTVTEFILIGFNDHPKWEIPLFLVFLSFYLVTMLGNLGM
FT                   VILIHVDVQLHIPMYFFLSHLSVLDACYTSVITPQILATLATGKTVVSYGRCAAQFFFF
FT                   TICAATECFLLSVMAYDRYVAISNPLLYTVAMGPRKCWSLVVGAYVCGMCGAILRTTCT
FT                   FSLSFCENNQINFFFCDLPPLLKLACSDTTNIEIIIVFFGNFVISANALVILISYLLII
FT                   KAVMRMKSSGRRAKTFSTCVSHLTAVALLFGTLIFMYIRSGSKKSLEEDKVVSVFYTVV
FT                   IPMLNPLVYSLRNKDVKAAFKKVTGKWQVSHSIQ"
FT   assembly_gap    4259299..4259652
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    4261686..4262323
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    4273007..4273026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4311874..4312229
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    4317431..4317450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4322942..4323122
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    4329587..4329629
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4330988..4331007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4335713..4335732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4363351..4363478
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    4369325..4369601
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    4419304..4419366
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    4423091..4423110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4431791..4431924
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    4436199..4436992
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    4457521..4457540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4484085..4484104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4499073..4499092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500801..4500820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4509145..4509437
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    4525421..4527753
FT                   /estimated_length=2333
FT                   /gap_type="unknown"
FT   assembly_gap    4546509..4546606
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    4555208..4555227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4557457..4557476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4568762..4569000
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    4585365..4588295
FT                   /estimated_length=2931
FT                   /gap_type="unknown"
FT   assembly_gap    4597604..4597634
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    4627854..4627873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4629142..4629161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4632814..4632833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4682520..4682722
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    4690331..4690421
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(4715428..>4753977)
FT                   /locus_tag="mCG_145651"
FT                   /note="gene_id=mCG145651.0"
FT   mRNA            complement(join(4715428..4716718,4721030..4721105,
FT                   4736814..4736902,4740444..4740594,4750550..4750632,
FT                   4753882..>4753977))
FT                   /locus_tag="mCG_145651"
FT                   /product="mCG145651"
FT                   /note="gene_id=mCG145651.0 transcript_id=mCT185075.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(4716169..>4716696)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145651"
FT                   /product="mCG145651"
FT                   /note="gene_id=mCG145651.0 transcript_id=mCT185075.0
FT                   protein_id=mCP105523.0"
FT                   /protein_id="EDL41526.1"
FT                   /translation="RRPSPVEPSLISCTRPLCAPSHDHQSKPAAVDKPRTPSHGIQLEL
FT                   PSFPPRPGLDPARGPPTQFSDLPRLPGLSALSSWVPKSLRTRLPWSLQARGPTNPESVL
FT                   AHPHPLTSDCAFPPLEQCPVADIHPQAWGKHSQYSLILPPQMARALWQRRPRTPLTPKQ
FT                   SIKDIFLSFSFY"
FT   assembly_gap    4724984..4725003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4745875..4746350
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   gene            complement(4766095..>4916316)
FT                   /locus_tag="mCG_12474"
FT                   /note="gene_id=mCG12474.1"
FT   mRNA            complement(join(4766095..4767865,4769667..4769791,
FT                   4770088..4770238,4770444..4770591,4771603..4771850,
FT                   4772765..4773014,4782512..4782588,4782947..4783140,
FT                   4783489..4783621,4784752..4784904,4785383..4785436,
FT                   4786355..4786452,4835980..4836229,4862920..4862994,
FT                   4882518..4882580,4912514..4912558,4913720..4913783,
FT                   4915190..4915288,4915819..>4916316))
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, transcript variant mCT122574"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT122574.0 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(4766096..4767568,4767719..4767865,
FT                   4769667..4769743,4770088..4770238,4770444..4770591,
FT                   4771603..4771850,4772765..4773014,4782512..4782588,
FT                   4782947..4783140,4783489..4783621,4784752..4784904,
FT                   4785383..4785436,4786355..4786479,4834567..4834583,
FT                   4835976..4836181,4862920..4862994,4882518..4882580,
FT                   4912514..4912558,4913720..4913783,4915190..4915288,
FT                   4915819..>4916272))
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, transcript variant mCT13187"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT13187.2 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(4767719..4767865,4769667..4769743,
FT                   4770088..4770238,4770444..4770591,4771603..4771850,
FT                   4772765..4773014,4782512..4782588,4782947..4783140,
FT                   4783489..4783621,4784752..4784904,4785383..4785436,
FT                   4786355..4786474,4834567..4834583,4835980..4836181,
FT                   4862920..4862994,4882518..4882580,4912514..4912558,
FT                   4913720..4913783,4915190..>4915288))
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, transcript variant mCT194028"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT194028.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4767758..4767865,4769667..4769743,
FT                   4770088..4770238,4770444..4770591,4771603..4771850,
FT                   4772765..4773014,4782512..4782588,4782947..4783140,
FT                   4783489..4783621,4784752..4784904,4785383..4785436,
FT                   4786355..4786479,4834567..4834583,4835976..4836181,
FT                   4862920..4862994,4882518..4882580,4912514..4912558,
FT                   4913720..4913783,4915190..4915288,4915819..>4915904))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, isoform CRA_c"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT13187.2
FT                   protein_id=mCP9887.2 isoform=CRA_c"
FT                   /protein_id="EDL41529.1"
FT                   /translation="KKFGVGREQAGGARRARGSAGAGRTVPAAAPHQPAQPFKFTISES
FT                   CDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKR
FT                   LNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSHGHGLPVPLT
FT                   PHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRGEQRLHQVQSS
FT                   SVSPSASFRGSEKHRNSTDYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS
FT                   SPRGSPAHSPRENGLDKTRLLKKDAPISPASVASSSSTPSSKSKELSLNEKSTTPVSKS
FT                   NTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGIVPHAGM
FT                   NGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSPVVGFDPHHHMRVPAIPPNLTG
FT                   IPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTR
FT                   HVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSI
FT                   WDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGH
FT                   TDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAV
FT                   GMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASI
FT                   FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY"
FT   CDS             complement(join(4767758..4767865,4769667..4769791,
FT                   4770088..4770238,4770444..4770591,4771603..4771850,
FT                   4772765..4773014,4782512..4782588,4782947..4783140,
FT                   4783489..4783621,4784752..4784904,4785383..4785436,
FT                   4786355..4786452,4835980..4836229,4862920..4862994,
FT                   4882518..4882580,4912514..4912558,4913720..4913783,
FT                   4915190..4915288,4915819..>4915904))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, isoform CRA_a"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT122574.0
FT                   protein_id=mCP64005.0 isoform=CRA_a"
FT                   /protein_id="EDL41527.1"
FT                   /translation="KKFGVGREQAGGARRARGSAGAGRTVPAAAPHQPAQPFKFTISES
FT                   CDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKR
FT                   LNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGAIQGTNSISVSDFSQQQQL
FT                   QAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHD
FT                   NDHQRASFRGSEKHRNSTDYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS
FT                   SPRGSPAHSPRENGLDKTRLLKKDAPISPASVASSSSTPSSKSKELSLNEKSTTPVSKS
FT                   NTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGIVPHAGM
FT                   NGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSPVVGFDPHHHMRVPAIPPNLTG
FT                   IPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTR
FT                   HVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSI
FT                   WDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGH
FT                   TDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAV
FT                   GMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCAVYESHDKVTQSLLPVGKWFVSTG
FT                   KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY"
FT   CDS             complement(join(4767758..4767865,4769667..4769743,
FT                   4770088..4770238,4770444..4770591,4771603..4771850,
FT                   4772765..4773014,4782512..4782588,4782947..4783140,
FT                   4783489..4783621,4784752..4784904,4785383..4785436,
FT                   4786355..4786474,4834567..4834583,4835980..4836181,
FT                   4862920..4862994,4882518..4882580,4912514..4912558,
FT                   4913720..4913783,4915190..>4915287))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12474"
FT                   /product="mCG12474, isoform CRA_b"
FT                   /note="gene_id=mCG12474.1 transcript_id=mCT194028.0
FT                   protein_id=mCP114982.0 isoform=CRA_b"
FT                   /protein_id="EDL41528.1"
FT                   /translation="APHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
FT                   TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQ
FT                   VTMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGG
FT                   QSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGSEKHRNSTDYSSESKKQKTEEK
FT                   EIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASV
FT                   ASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDP
FT                   LASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAA
FT                   AYGRSPVVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPG
FT                   IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNR
FT                   DNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKV
FT                   CFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE
FT                   GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKF
FT                   AHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATV
FT                   YEVIY"
FT   assembly_gap    4914814..4915114
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    4915799..4915818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4938427..4938575
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    4956859..4956878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4961998..4962068
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5085444..5085463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5122989..5123008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5134686..5134780
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    5137199..5137317
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5143876..5143895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5168519..5168538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5182839..5182918
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5213229..5213505
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    5251007..5251026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5280935..>5282152)
FT                   /locus_tag="mCG_50578"
FT                   /note="gene_id=mCG50578.0"
FT   mRNA            complement(<5280935..>5282152)
FT                   /locus_tag="mCG_50578"
FT                   /product="mCG50578"
FT                   /note="gene_id=mCG50578.0 transcript_id=mCT50761.0 created
FT                   on 10-OCT-2002"
FT   CDS             complement(5280935..5282152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50578"
FT                   /product="mCG50578"
FT                   /note="gene_id=mCG50578.0 transcript_id=mCT50761.0
FT                   protein_id=mCP31932.0"
FT                   /protein_id="EDL41530.1"
FT                   /translation="MSASQDSRSRDNGPDGMEPEGVIESNWNKIMDSFDDMNLSESLLR
FT                   GIYAYGFKKPSAIQQRAILLCIKGYDVIAQAQSGTGKTATFAISILQQIELDLRATQAL
FT                   VLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVCAEVQKLQIEAPYIIVGTPGRVF
FT                   EMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFPKLNSNTQVVLLSATMPSDVLE
FT                   VTKKFMRGPIQILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINT
FT                   RRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFCSGSSRVLIPTDLLARGIDVQQ
FT                   VSLIINYDLPTNRENYIRSGRGGRFGRKGVAVNMVTEEDKRTLRDNETFYNTSIEEMPL
FT                   NIADLI"
FT   assembly_gap    5286403..5286780
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    5386050..5386069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5439081..5441347
FT                   /estimated_length=2267
FT                   /gap_type="unknown"
FT   assembly_gap    5450701..5451083
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    5452220..5452684
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   gene            complement(5514717..5515411)
FT                   /pseudo
FT                   /locus_tag="mCG_5374"
FT                   /note="gene_id=mCG5374.1"
FT   mRNA            complement(5514717..5515411)
FT                   /pseudo
FT                   /locus_tag="mCG_5374"
FT                   /note="gene_id=mCG5374.1 transcript_id=mCT4803.1 created on
FT                   10-OCT-2002"
FT   assembly_gap    5558811..5558830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5568615..5568946
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    5570466..5570705
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    5572863..5572882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5578147..5578166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5579368..5587381
FT                   /estimated_length=8014
FT                   /gap_type="unknown"
FT   assembly_gap    5589013..5589186
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    5589985..5590229
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    5593295..5593314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5594220..5594239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5629414..5630417
FT                   /estimated_length=1004
FT                   /gap_type="unknown"
FT   gene            <5668219..>5681253
FT                   /locus_tag="mCG_50354"
FT                   /note="gene_id=mCG50354.1"
FT   mRNA            join(<5668219..5668330,5680934..>5681253)
FT                   /locus_tag="mCG_50354"
FT                   /product="mCG50354"
FT                   /note="gene_id=mCG50354.1 transcript_id=mCT50537.1 created
FT                   on 10-OCT-2002"
FT   CDS             join(5668219..5668330,5680934..5681253)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50354"
FT                   /product="mCG50354"
FT                   /note="gene_id=mCG50354.1 transcript_id=mCT50537.1
FT                   protein_id=mCP31964.1"
FT                   /protein_id="EDL41531.1"
FT                   /translation="MWYNQEQISFPHYTFCPQNNSDTDSNSIIDSPLRTGLAQRRGEEE
FT                   EVGGDGRLELSSPEGKCSYSMEHFHWGKPVGKKRLPVKVYPNVAENKSAEAFPLEFKRE
FT                   LEGKRPDGLEHVLESDAQKDNGPCRVEHFRWGNLPKNKR"
FT   assembly_gap    5747545..5747564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5754675..5756622
FT                   /estimated_length=1948
FT                   /gap_type="unknown"
FT   assembly_gap    5785464..5785483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5798688..5800950
FT                   /estimated_length=2263
FT                   /gap_type="unknown"
FT   assembly_gap    5802315..5802334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5803628..5803647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5804721..5804740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5806365..5806993
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    5823507..5823526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5848584..5848938
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    5913460..5913479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5931280..5931299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5948928..5949072
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    5949889..5949908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5985014..5985217
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    5986449..5986654
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    5987313..5987345
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    5989154..5989173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5996818..5997193
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    5998299..5998346
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    6034248..6039744
FT                   /estimated_length=5497
FT                   /gap_type="unknown"
FT   assembly_gap    6045789..6046062
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    6074983..6075002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6088783..6088802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6107653..6107761
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    6112699..6112718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6120811..6121599
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    6122601..6123367
FT                   /estimated_length=767
FT                   /gap_type="unknown"
FT   assembly_gap    6124497..6124516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6124567..6129162
FT                   /locus_tag="mCG_148488"
FT                   /note="gene_id=mCG148488.0"
FT   mRNA            join(6124567..6124629,6125543..6129162)
FT                   /locus_tag="mCG_148488"
FT                   /product="mCG148488"
FT                   /note="gene_id=mCG148488.0 transcript_id=mCT188751.0
FT                   created on 13-JAN-2004"
FT   CDS             6125917..6126255
FT                   /codon_start=1
FT                   /locus_tag="mCG_148488"
FT                   /product="mCG148488"
FT                   /note="gene_id=mCG148488.0 transcript_id=mCT188751.0
FT                   protein_id=mCP109186.0"
FT                   /protein_id="EDL41532.1"
FT                   /translation="MQDNFSAWVNQGLIISLSISLSVSLSLCLSLSVSLSVSLSLSHNS
FT                   SFHKSKEHVSTSLPFSLPDIFYKSRKKGIALGILRLHTEGPSPTILSMTDAHTERRELA
FT                   CTCSHSLL"
FT   assembly_gap    6135859..6135878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6137757..6137803
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6140693..6140813
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    6208432..6208765
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    6218959..6219082
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            complement(6219084..6239416)
FT                   /locus_tag="mCG_5377"
FT                   /note="gene_id=mCG5377.2"
FT   mRNA            complement(join(6219084..6220501,6221280..6221417,
FT                   6223651..6223779,6229214..6229383,6231435..6231607,
FT                   6232564..6232769,6233813..6233882,6235293..6235353,
FT                   6239221..6239416))
FT                   /locus_tag="mCG_5377"
FT                   /product="mCG5377"
FT                   /note="gene_id=mCG5377.2 transcript_id=mCT4802.2 created on
FT                   17-MAR-2003"
FT   CDS             complement(join(6220396..6220501,6221280..6221417,
FT                   6223651..6223779,6229214..6229383,6231435..6231607,
FT                   6232564..6232769,6233813..6233882,6235293..6235353,
FT                   6239221..6239280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5377"
FT                   /product="mCG5377"
FT                   /note="gene_id=mCG5377.2 transcript_id=mCT4802.2
FT                   protein_id=mCP9889.2"
FT                   /db_xref="GOA:Q543K5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="MGI:MGI:2183441"
FT                   /db_xref="UniProtKB/TrEMBL:Q543K5"
FT                   /protein_id="EDL41533.1"
FT                   /translation="MEATKQVVNFGPGPAKLPHSVLLEIQKQLLDYRGLGISVLEMSHR
FT                   SSDFAKIIGNTENLVRELLAVPNNYKVIFVQGGGSGQFSAVPLNLIGLKAGRSADYVVT
FT                   GAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFD
FT                   FVPDVKGAVLVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSLR
FT                   ECPSVLDYKVQAGNNSLYNTPPCFSIYVMGMVLEWIKNNGGAAAMEKLSSIKSQMIYEI
FT                   IDNSQGFYVCPVERQNRSRMNIPFRIGNAKGDEALEKRFLDKAVELNMISLKGHRSVGG
FT                   IRASLYNAVTTEDVEKLAAFMKNFLEMHQL"
FT   assembly_gap    6241246..6241412
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    6244145..6244279
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    6247617..6247877
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    6256518..6256537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6267646..6267822
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(6269795..>6299326)
FT                   /gene="Cep78"
FT                   /locus_tag="mCG_5376"
FT                   /note="gene_id=mCG5376.1"
FT   mRNA            complement(join(6269795..6270848,6273974..6274142,
FT                   6275385..6275551,6276814..6276891,6283514..6283642,
FT                   6284981..6285026,6285344..6285479,6288802..6288913,
FT                   6289336..6289400,6290697..6290810,6293241..6293415,
FT                   6296082..6296254,6299059..>6299326))
FT                   /gene="Cep78"
FT                   /locus_tag="mCG_5376"
FT                   /product="centrosomal protein 78, transcript variant
FT                   mCT4806"
FT                   /note="gene_id=mCG5376.1 transcript_id=mCT4806.2 created on
FT                   10-OCT-2002"
FT   CDS             complement(join(6270285..6270848,6273974..6274142,
FT                   6275385..6275551,6276814..6276891,6283514..6283642,
FT                   6284981..6285026,6285344..6285479,6288802..6288913,
FT                   6289336..6289400,6290697..6290810,6293241..6293415,
FT                   6296082..6296254,6299059..6299326))
FT                   /codon_start=1
FT                   /gene="Cep78"
FT                   /locus_tag="mCG_5376"
FT                   /product="centrosomal protein 78, isoform CRA_b"
FT                   /note="gene_id=mCG5376.1 transcript_id=mCT4806.2
FT                   protein_id=mCP9868.2 isoform=CRA_b"
FT                   /protein_id="EDL41535.1"
FT                   /translation="MIDSVKLRRDCAADFFSHYEYLCALQDSVPLPAVRACLRDGVLDF
FT                   NADRLRAVDWAPLLSTLRVNRDLPLVAIKSSFQPWLGETVLRSGGADTHRICRNRVPAV
FT                   RSKDISFQLCKALRGCLSVSGVLRNLELNGLILRERDLTSLTKYQTMRRHEETWAESLR
FT                   YRRPDLDCMAGLRRITLNCNTLIGDQGASAFADSLSEDLWLRALDLQQCGLTSEGAKAL
FT                   LEALETNRTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSADSEYQWVTSPSSKEPSKTA
FT                   KQRKKTIVLGSSRKGKATIRIGLATKKPSSNGRKQGLGKDCYAPNPLPPGASGFLPWRT
FT                   AERAKRSRSSSLIKTRDLSNHLKKSDFPVTVTVESPSSSETDETEDSSESVQEAPQKTS
FT                   IKEETLQEKLEECLRQLKEERVIRLKADKRVSELEHENAQLRNINFSLSEALHAQSLTN
FT                   MILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQSDFHLLGRPQMNSTVNT
FT                   PIQEQKALEDETLHPKQTATGQMQDIRFQKITSDALIPLPLNTVQDPASAQEAVGASRD
FT                   HLGVVGLEQQEGSAAGFIAKTGSPLAGGIPGGRSQREEEVLSKHSRSSSEKGSTASEPS
FT                   RRPSAERHPRKDLLSDADPPGNSESKGPGDRRSLLNEPIKSESLKKCISIKKENRIVTV
FT                   SSKTIKSKPNLLEHSESDTLGSDFELQERVHSSAHLT"
FT   mRNA            complement(join(<6270426..6270848,6273974..6274142,
FT                   6275385..6275551,6276814..6276891,6283514..6283642,
FT                   6284981..6285026,6285344..6285479,6288802..6289400,
FT                   6290697..6290810,6293241..6293415,6295546..6295649,
FT                   6295919..6295991,6296082..6296254,6299059..>6299141))
FT                   /gene="Cep78"
FT                   /locus_tag="mCG_5376"
FT                   /product="centrosomal protein 78, transcript variant
FT                   mCT194100"
FT                   /note="gene_id=mCG5376.1 transcript_id=mCT194100.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<6270426..6270848,6273974..6274142,
FT                   6275385..6275551,6276814..6276891,6283514..6283642,
FT                   6284981..6285026,6285344..6285479,6288802..>6288955))
FT                   /codon_start=1
FT                   /gene="Cep78"
FT                   /locus_tag="mCG_5376"
FT                   /product="centrosomal protein 78, isoform CRA_a"
FT                   /note="gene_id=mCG5376.1 transcript_id=mCT194100.0
FT                   protein_id=mCP115083.0 isoform=CRA_a"
FT                   /protein_id="EDL41534.1"
FT                   /translation="VLFMCSWSPVCLFQYQWVTSPSSKEPSKTAKQRKKTIVLGSSRKG
FT                   KATIRIGLATKKPSSNGRKQGLGKDCYAPNPLPPGASGFLPWRTAERAKRSRSSSLIKT
FT                   RDLSNHLKKSDFPVTVTVESPSSSETDETEDSSESVQEAPQKTSIKEETLQEKLEECLR
FT                   QLKEERVIRLKADKRVSELEHENAQLRNINFSLSEALHAQSLTNMILDDEGVLGSIENS
FT                   FQKFHAFLDLLKDAGLGQLATMAGIDQSDFHLLGRPQMNSTVNTPIQEQKALEDETLHP
FT                   KQTATGQMQDIRFQKITSDALIPLPLNTVQDPASAQEAVGASRDHLGVVGLEQQEGSAA
FT                   GFIAKTGSPLAGGIPGGRSQREEEVLSKHSRSSSEKGSTASEPSRRPSAERHPRKDLLS
FT                   DADPPGNSESKGPGDRRSLLNEPIKSESLKKCISI"
FT   gene            <6299532..6325394
FT                   /locus_tag="mCG_145652"
FT                   /note="gene_id=mCG145652.0"
FT   mRNA            join(<6299532..6299738,6300953..6301078,6324582..6325394)
FT                   /locus_tag="mCG_145652"
FT                   /product="mCG145652"
FT                   /note="gene_id=mCG145652.0 transcript_id=mCT185076.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6299666..6299738,6300953..6301062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145652"
FT                   /product="mCG145652"
FT                   /note="gene_id=mCG145652.0 transcript_id=mCT185076.0
FT                   protein_id=mCP105524.0"
FT                   /protein_id="EDL41536.1"
FT                   /translation="KRSTVYASSPREVTRRISQHVCKPVSCYVAWPLLDFVIFFQLPEC
FT                   WDYRKEPLHSASQFK"
FT   assembly_gap    6303221..6303332
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   gene            <6339947..>6340216
FT                   /locus_tag="mCG_48721"
FT                   /note="gene_id=mCG48721.0"
FT   mRNA            <6339947..>6340216
FT                   /locus_tag="mCG_48721"
FT                   /product="mCG48721"
FT                   /note="gene_id=mCG48721.0 transcript_id=mCT48904.0 created
FT                   on 10-OCT-2002"
FT   CDS             6339947..6340216
FT                   /codon_start=1
FT                   /locus_tag="mCG_48721"
FT                   /product="mCG48721"
FT                   /note="gene_id=mCG48721.0 transcript_id=mCT48904.0
FT                   protein_id=mCP32001.0"
FT                   /protein_id="EDL41537.1"
FT                   /translation="MTKGRSSFGKRRYKMHKAYHLQKLTCGKCGYPVKRKKKYNWSARA
FT                   KRRNTTGTDRMRHLKIVYRRFRHGFREGTTPKPKRAAAAASSSS"
FT   assembly_gap    6364348..6364492
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    6387013..6387032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6398017..6403883
FT                   /locus_tag="mCG_1045287"
FT                   /note="gene_id=mCG1045287.0"
FT   mRNA            join(6398017..6398174,6398795..6398893,6402827..6402914,
FT                   6403050..6403162,6403828..6403883)
FT                   /locus_tag="mCG_1045287"
FT                   /product="mCG1045287"
FT                   /note="gene_id=mCG1045287.0 transcript_id=mCT162991.0
FT                   created on 14-MAR-2003"
FT   CDS             join(6398100..6398174,6398795..6398857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045287"
FT                   /product="mCG1045287"
FT                   /note="gene_id=mCG1045287.0 transcript_id=mCT162991.0
FT                   protein_id=mCP64344.1"
FT                   /protein_id="EDL41538.1"
FT                   /translation="MTLMQPEISKESADPSAASLLTSTAIKPRTWCTLLSKPLSCPAPP
FT                   "
FT   assembly_gap    6422934..6422953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6438781..6439054
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    6441523..6441731
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    6443781..6443836
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    6445241..6447312
FT                   /estimated_length=2072
FT                   /gap_type="unknown"
FT   gene            complement(6477904..6478638)
FT                   /pseudo
FT                   /locus_tag="mCG_13983"
FT                   /note="gene_id=mCG13983.0"
FT   mRNA            complement(6477904..6478638)
FT                   /pseudo
FT                   /locus_tag="mCG_13983"
FT                   /note="gene_id=mCG13983.0 transcript_id=mCT18811.1 created
FT                   on 10-OCT-2002"
FT   assembly_gap    6485049..6485068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6489691..6489710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6535079..6699212
FT                   /gene="Gnaq"
FT                   /locus_tag="mCG_13980"
FT                   /note="gene_id=mCG13980.1"
FT   mRNA            join(6535079..6535264,6631307..6631461,6647395..6647523,
FT                   6650358..6650487,6693624..6693777,6698671..6699212)
FT                   /gene="Gnaq"
FT                   /locus_tag="mCG_13980"
FT                   /product="guanine nucleotide binding protein, alpha q
FT                   polypeptide"
FT                   /note="gene_id=mCG13980.1 transcript_id=mCT18808.1 created
FT                   on 10-OCT-2002"
FT   CDS             join(6535118..6535264,6631307..6631461,6647395..6647523,
FT                   6650358..6650487,6693624..6693777,6698671..6698861)
FT                   /codon_start=1
FT                   /gene="Gnaq"
FT                   /locus_tag="mCG_13980"
FT                   /product="guanine nucleotide binding protein, alpha q
FT                   polypeptide"
FT                   /note="gene_id=mCG13980.1 transcript_id=mCT18808.1
FT                   protein_id=mCP9870.1"
FT                   /protein_i