Dbfetch

ID   CH466533; SV 2; linear; genomic DNA; CON; MUS; 44236761 BP.
XX
AC   CH466533;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009768393 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-44236761
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-44236761
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-44236761
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 5829b51a1183bcedfad33296f65ae837.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000214.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001642; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002588; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003500; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010796; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023089; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023289; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024121; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025608; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029669; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029671; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029672; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029685; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029695; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029700; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029706; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029755; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029757; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029759; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029766; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029767; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029784; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029788; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029790; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029829; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029838; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029860; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029865; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029882; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029911; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029915; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029922; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029924; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036899; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036938; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038507; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038759; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039419; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042541; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042717; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043119; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043605; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045514; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046947; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047749; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048693; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051956; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054106; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058119; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058499; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061210; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062751; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068259; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068574; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071481; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071521; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073110; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073111; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078179; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079652; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091983; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094192; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094669; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095831; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030423; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030427; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030431; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030432; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030433; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030434; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030439; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030441; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030442; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030443; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030449; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030452; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030455; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030459; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030461; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030463; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030467; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030473; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030474; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030480; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030483; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030484; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030486; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030489; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030492; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030495; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030498; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030499; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030501; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030505; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030506; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030509; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030510; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030513; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030516; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030518; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030520; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030527; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030532; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030533; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030538; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030541; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030543; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030558; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030559; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030569; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030570; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030574; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030581; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030583; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030584; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030589; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030591; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030593; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030595; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030597; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030599; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030604; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030608; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030612; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030613; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030614; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030619; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030621; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030624; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030629; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030631; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030632; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030633; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030635; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030636; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030637; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030638; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030639; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030640; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030646; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030648; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030653; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030654; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030660; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030661; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030663; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030664; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030665; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030666; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030668; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030669; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030671; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030672; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030673; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030674; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030675; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030679; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030682; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030396; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030400; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030404; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030405; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030407; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030409; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030410; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030412; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030422; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030425; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030434; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030436; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030440; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030441; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030453; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030456; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030457; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030459; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030462; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030463; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030465; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030468; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030471; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030472; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030474; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030478; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030479; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030482; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030483; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030486; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030489; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030491; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030493; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030500; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030505; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030506; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030511; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030516; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030517; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030531; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030532; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030542; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030547; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030554; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030556; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030557; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030562; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030564; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030566; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030568; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030570; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030572; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030576; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030577; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030581; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030585; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030586; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030587; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030592; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030596; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030599; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030602; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030604; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030605; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030606; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030608; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030609; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030610; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030611; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030612; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030613; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030621; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030626; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030627; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030633; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030636; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030637; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030638; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030639; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030640; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030641; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030642; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030644; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030645; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030646; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030647; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030648; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030652; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0030654; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030323; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030327; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030332; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030333; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030334; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030336; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030339; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030341; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030342; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030349; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030352; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030355; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030359; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030363; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030367; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030368; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030373; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030374; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030380; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030383; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030384; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030386; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030389; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030390; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030392; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030395; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030398; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030399; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030401; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030405; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030406; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030409; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030410; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030413; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030416; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030418; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030420; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030432; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030433; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030438; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030441; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030443; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030444; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030449; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030458; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030470; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030474; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030481; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030483; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030484; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030489; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030493; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030495; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030497; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030499; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030503; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030504; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030508; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030514; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030519; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030523; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030524; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030526; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030527; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030529; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030530; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030531; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030533; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030534; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030535; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030536; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030537; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030538; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030544; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030546; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030552; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030558; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030559; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030560; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030561; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030562; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030563; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030564; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030565; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030566; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030567; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030569; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030570; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030571; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030572; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030573; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030577; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0030579; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030405; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030409; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030413; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030414; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030415; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030416; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030418; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030419; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030421; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030423; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030424; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030425; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030431; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030434; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030437; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030441; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030443; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030445; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030449; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030455; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030462; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030465; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030466; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030469; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030472; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030473; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030475; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030478; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030481; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030482; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030484; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030489; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030492; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030493; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030496; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030501; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030503; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030510; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030516; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030521; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030524; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030526; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030527; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030532; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030541; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030542; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030552; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030553; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030557; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030564; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030566; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030572; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030574; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030576; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030578; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030580; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030582; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030586; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030587; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030591; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030595; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030596; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030597; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030602; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030606; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030609; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030612; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030614; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030615; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030616; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030618; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030619; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030620; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030621; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030622; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030623; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030631; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030636; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030643; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030644; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030645; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030646; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030647; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030648; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030649; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030651; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030652; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030655; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030656; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030658; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030662; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030664; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030119; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030123; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030127; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030128; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030129; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030130; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030132; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030135; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030137; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030138; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030139; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030145; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030148; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030151; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030155; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030157; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030159; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030163; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030164; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030169; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030170; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030176; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030180; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030182; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030185; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030186; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030188; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030191; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030195; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030197; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030201; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030202; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030205; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030206; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030209; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030212; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030214; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030216; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030223; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030228; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030229; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030234; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030237; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030239; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030240; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030255; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030265; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030266; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030270; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030277; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030280; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030285; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030287; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030289; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030291; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030295; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030300; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030304; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030309; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030310; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030315; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030319; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030320; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030324; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030325; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030327; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030328; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030329; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030331; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030332; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030334; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030335; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030336; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030342; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030349; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030350; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030356; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030357; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030358; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030359; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030360; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030361; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030362; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030363; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030364; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030367; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030368; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030369; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030370; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030371; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030860; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030864; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030868; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030871; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030873; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030874; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030878; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030879; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030880; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030886; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030889; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030892; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030896; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030900; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030904; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030905; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030910; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030911; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030917; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030920; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030921; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030923; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030926; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030927; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030929; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030932; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030935; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030936; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030938; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030943; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030946; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030947; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030950; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030953; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030955; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030957; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030964; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030970; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030975; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030978; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030980; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030981; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030986; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030995; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030996; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031007; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031011; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031018; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031020; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031026; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031028; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031030; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031032; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031034; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031036; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031040; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031041; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031045; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031049; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031050; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031051; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031056; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031060; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031061; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031062; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031065; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031066; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031068; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031069; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031070; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031072; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031073; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031074; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031075; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031076; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031085; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031090; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031091; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031097; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031100; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031101; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031102; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031103; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031104; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031105; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031106; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031108; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031109; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031110; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031111; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031112; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031116; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031119; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029520; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029524; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029528; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029529; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029530; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029533; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029534; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029536; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029538; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029539; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029540; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029546; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029549; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029553; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029557; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029559; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029561; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029565; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029566; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029571; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029572; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029578; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029581; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029582; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029587; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029588; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029590; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029593; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029596; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029597; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029603; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029604; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029608; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029614; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029616; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029618; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029625; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029630; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029631; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029636; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029639; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029641; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029642; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029647; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029654; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029656; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029657; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029667; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029668; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029672; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029679; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029682; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029687; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029689; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029691; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029693; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029695; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029701; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029702; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029706; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029710; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029711; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029712; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029717; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029721; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029722; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029723; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029724; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029732; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029733; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029735; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029736; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029737; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029738; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029739; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029740; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029748; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029753; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029754; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029760; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029761; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029762; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029763; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029764; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029765; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029766; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029767; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029772; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029773; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029774; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029775; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029779; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029781; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030097; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030105; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030106; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030107; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030108; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030110; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030111; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030113; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030115; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030116; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030117; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030123; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030126; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030129; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030133; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030135; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030137; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030141; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030142; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030147; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030154; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030157; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030158; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030160; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030163; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030164; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030169; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030173; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030175; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030179; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030180; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030183; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030184; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030187; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030190; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030192; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030201; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030206; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030207; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030212; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030215; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030217; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030218; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030223; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030232; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030233; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030244; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030248; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030255; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030257; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030258; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030263; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030267; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030269; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030271; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030273; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030277; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030278; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030282; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030286; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030287; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030288; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030293; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030295; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030298; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030301; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030303; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030304; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030305; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030308; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030309; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030310; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030311; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030312; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030320; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030326; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030331; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030332; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030334; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030335; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030336; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030337; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030338; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030339; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030340; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030342; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030343; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030344; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030345; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030346; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030350; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0030352; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030241; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030245; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030249; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030252; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030254; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030255; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030257; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030259; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030260; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030261; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030267; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030270; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030273; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030279; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030281; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030285; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030286; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030292; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030301; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030307; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030308; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030310; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030313; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030316; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030317; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030323; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030324; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030327; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030328; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030331; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030334; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030336; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030338; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030345; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030350; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030351; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030356; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030359; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030361; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030367; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030376; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030387; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030388; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030392; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030399; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030401; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030402; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030407; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030409; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030411; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030415; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030417; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030421; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030422; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030426; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030430; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030431; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030432; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030437; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030441; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030442; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030443; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030445; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030447; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030448; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030449; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030451; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030452; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030453; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030454; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030455; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030456; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030464; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030469; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030470; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030476; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030477; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030478; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030479; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030480; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030481; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030482; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030483; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030484; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030491; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030492; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030493; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030499; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0030501; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030195; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030199; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030203; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030204; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030205; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030206; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030209; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030211; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030213; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030214; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030215; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030221; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030224; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030227; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030231; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030233; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030235; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030239; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030240; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030245; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030252; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030255; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030258; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030261; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030262; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030264; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030267; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030273; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030277; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030278; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030281; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030282; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030285; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030292; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030299; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030304; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030305; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030310; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030313; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030315; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030316; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030321; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030331; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030341; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030342; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030346; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030353; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030355; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030356; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030361; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030363; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030367; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030369; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030375; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030376; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030380; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030384; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030385; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030386; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030391; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030393; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030394; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030395; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030396; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030401; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030403; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030404; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030405; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030407; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030408; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030409; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030410; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030412; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030418; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030420; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030425; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030432; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030433; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030434; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030435; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030436; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030437; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030438; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030439; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030440; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030442; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030443; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030444; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030445; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030446; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030450; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0030453; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030328; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030332; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030336; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030337; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030338; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030339; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030342; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030344; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030346; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030347; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030354; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030357; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030360; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030364; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030366; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030368; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030372; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030373; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030378; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030379; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030389; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030391; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030394; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030397; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030403; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030406; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030410; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030414; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030415; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030418; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030421; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030423; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030425; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030432; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030438; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030443; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030446; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030449; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030454; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030464; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030479; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030486; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030488; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030489; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030494; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030496; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030498; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030500; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030502; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030504; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030508; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030509; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030513; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030517; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030518; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030519; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030524; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030528; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030533; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030535; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030536; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030537; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030539; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030540; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030541; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030542; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030543; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030544; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030552; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030557; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030558; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030564; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030565; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030566; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030567; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030568; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030569; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030570; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030571; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030572; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030575; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030576; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030577; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030578; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030579; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030583; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0030585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030235; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030239; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030240; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030241; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030242; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030244; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030245; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030247; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030249; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030250; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030251; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030257; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030260; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030263; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030267; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030269; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030271; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030275; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030276; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030281; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030282; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030288; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030294; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030297; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030300; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030303; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030306; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030307; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030309; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030313; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030318; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030321; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030324; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030326; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030335; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030340; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030341; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030346; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030349; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030351; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030352; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030357; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030366; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030367; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030377; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030378; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030389; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030392; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030399; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030401; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030403; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030405; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030407; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030411; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030412; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030416; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030420; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030421; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030422; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030427; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030431; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030435; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030438; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030439; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030441; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030442; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030443; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030444; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030445; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030446; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030452; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030454; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030459; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030466; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030467; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030468; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030469; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030470; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030471; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030472; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030473; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030474; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030475; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030477; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030478; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030479; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030480; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030481; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030485; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030487; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030889; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030890; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030894; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030898; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030900; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030901; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030904; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030906; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030908; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030909; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030910; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030916; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030919; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030922; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030926; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030928; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030930; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030934; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030935; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030940; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030941; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030947; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030951; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030953; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030956; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030957; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030959; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030962; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030966; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030968; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030972; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030973; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030976; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030977; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030980; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030983; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030985; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030987; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030994; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030999; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031000; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031010; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031011; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031016; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031025; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031026; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031036; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031037; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031041; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031048; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031050; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031051; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031056; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031058; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031060; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031062; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031064; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031066; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031070; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031071; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031075; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031079; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031080; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031081; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031086; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031089; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031090; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031091; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031096; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031098; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031099; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031100; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031102; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031103; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031104; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031105; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031106; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031107; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031115; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031120; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031121; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031127; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031128; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031129; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031130; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031131; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031132; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031133; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031134; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031135; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031136; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031138; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031139; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031140; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031142; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031146; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031148; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022267; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029235; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029239; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029243; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029244; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029246; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029249; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029251; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029253; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029254; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029255; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029261; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029264; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029267; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029273; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029275; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029279; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029280; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029285; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029286; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029292; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029295; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029296; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029298; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029301; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029304; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029307; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029310; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029311; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029313; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029318; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029321; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029322; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029325; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029328; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029330; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029332; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029339; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029344; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029353; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029355; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029356; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029361; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029370; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029371; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029381; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029386; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029393; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029395; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029396; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029401; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029403; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029405; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029409; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029415; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029416; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029420; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029424; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029425; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029426; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029431; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029435; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029436; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029441; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029444; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029445; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029447; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029449; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029450; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029451; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029452; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029458; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029460; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029466; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029467; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029472; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029473; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029474; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029475; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029476; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029477; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029478; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029483; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029484; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029485; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029487; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029493; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029596; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029597; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029601; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029605; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029606; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029607; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029608; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029611; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029613; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029616; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029617; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029626; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029629; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029633; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029635; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029637; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029641; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029642; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029647; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029648; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029654; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029657; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029660; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029663; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029664; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029666; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029669; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029672; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029673; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029675; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029679; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029680; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029683; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029684; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029687; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029690; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029692; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029694; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029701; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029706; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029707; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029712; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029715; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029717; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029718; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029723; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029733; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029743; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029744; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029755; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029757; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029758; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029763; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029765; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029767; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029771; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029773; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029777; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029778; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029782; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029786; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029787; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029788; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029793; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029797; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029799; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029800; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029805; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029807; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029808; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029809; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029811; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029812; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029813; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029814; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029815; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029816; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029822; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029824; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029829; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029830; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029836; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029837; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029838; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029839; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029840; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029841; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029842; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029843; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029847; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029848; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029849; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029850; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029851; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029855; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029857; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000004392; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026698; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031681; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031689; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031696; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031707; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031851; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031931; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035930; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038398; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043815; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050412; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050729; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051540; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074499; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078057; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090601; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092648; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115209; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115212; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115286; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115492; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115510; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117688; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170535; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177178; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201471; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205175; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076145; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076154; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076181; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076193; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076203; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076209; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076212; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076224; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076230; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076233; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076235; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076255; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076286; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076313; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076322; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076330; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076361; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076366; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076414; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076415; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076464; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076468; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076479; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076496; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076498; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076518; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076519; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076524; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076539; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076546; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076558; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076560; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076580; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076591; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076611; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076653; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076697; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076702; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076764; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076770; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076780; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076816; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076858; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076864; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076935; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076942; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076950; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076984; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076990; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076991; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077025; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077029; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077042; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077046; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077061; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077074; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077094; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077113; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077124; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077125; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077126; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077139; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077143; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077146; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077151; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077156; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077159; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077161; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077167; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077172; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077176; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077177; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077178; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077209; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077227; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077228; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077246; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077247; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077249; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077254; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077255; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077257; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077258; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077261; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077264; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077265; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077267; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077285; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077300; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076222; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076234; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076275; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076279; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076285; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076291; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076294; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076306; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076311; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076314; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076336; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076351; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076368; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076395; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076404; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076412; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076443; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076497; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076523; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076545; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076549; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076560; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076582; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076591; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076598; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076599; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076604; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076619; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076636; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076638; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076658; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076668; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076680; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076728; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076772; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076777; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076827; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076839; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076845; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076855; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0076940; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077011; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077018; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077026; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077060; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077066; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077067; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077101; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077105; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077119; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077123; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077138; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077150; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077169; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077173; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077192; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077203; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077204; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077205; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077219; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077225; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077229; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077232; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077237; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077240; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077242; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077248; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077250; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077253; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077257; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077258; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077259; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077307; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077308; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077326; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077329; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077330; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077334; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077335; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077336; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077338; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077341; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077343; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077344; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077345; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077347; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077365; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0077379; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076127; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076138; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076167; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076179; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076183; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076189; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076195; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076198; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076210; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076216; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076219; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076221; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076241; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076254; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076271; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076298; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076307; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076315; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076352; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076400; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076401; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076427; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076449; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076453; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076464; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076481; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076486; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076495; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076502; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076503; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076508; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076523; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076543; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076565; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076576; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076596; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076636; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076681; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076686; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076736; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076748; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076754; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076764; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076800; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076842; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076848; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076919; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076926; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076934; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076968; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076974; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0076975; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077008; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077012; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077025; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077029; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077044; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077056; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077074; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077078; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077096; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077107; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077108; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077109; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077124; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077130; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077131; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077132; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077133; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077134; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077139; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077142; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077144; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077150; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077152; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077159; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077160; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077192; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077210; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077229; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077230; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077231; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077232; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077237; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077238; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077239; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077240; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077241; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077244; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077246; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077247; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077248; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077250; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077268; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0077283; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076157; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076162; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076173; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076200; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076212; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076216; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076222; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076228; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076231; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076243; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076248; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076251; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076253; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076273; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076304; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076340; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076348; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076380; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076385; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076433; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076434; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076461; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076487; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076499; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076516; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076530; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076537; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076538; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076543; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076558; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076566; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076578; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076600; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076611; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076623; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076671; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076715; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076720; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076770; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076788; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076798; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076834; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076877; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076883; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076954; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076962; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076970; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077004; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077010; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077011; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077045; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077049; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077062; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077066; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077081; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077093; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077111; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077115; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077133; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077144; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077145; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077146; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077160; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077166; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077169; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077172; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077177; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077180; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077182; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077188; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077190; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077193; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077197; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077198; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077199; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077218; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077230; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077247; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077265; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077266; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077267; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077268; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077269; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077273; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077274; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077276; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077277; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077280; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077283; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077285; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077304; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075780; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075785; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075796; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075825; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075837; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075841; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075847; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075853; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075856; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075868; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075874; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075877; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075879; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075898; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075912; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075929; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075956; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075965; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076004; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076009; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076057; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076058; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076085; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076111; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076122; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076139; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076144; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076160; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076161; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076166; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076181; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076189; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076201; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076203; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076223; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076234; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076254; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076294; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076339; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076344; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076390; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076402; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076408; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076418; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076454; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076502; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076589; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076623; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076631; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076632; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076665; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076669; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076682; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076686; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076701; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076713; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076731; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076735; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076754; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076766; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076778; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076784; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076785; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076789; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076790; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076795; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076798; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076800; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076806; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076808; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076811; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076815; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076816; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076817; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076848; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076865; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076866; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076884; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076885; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076886; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076887; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076888; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076892; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076893; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076899; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076901; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076902; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076903; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076905; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076936; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076631; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076636; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076676; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076688; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076692; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076698; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076725; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076728; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076730; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076763; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076780; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076806; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076815; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076823; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076854; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076907; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076908; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076935; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076957; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076961; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076972; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076989; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076991; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076994; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077010; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077031; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077052; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077095; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077103; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077142; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077191; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077239; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077257; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077267; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077303; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077345; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077351; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077430; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077438; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077472; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077478; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077479; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077512; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077516; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077529; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077533; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077548; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077560; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077578; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077582; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077601; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077612; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077613; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077614; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077628; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077634; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077635; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077636; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077639; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077640; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077645; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077648; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077650; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077656; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077658; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077661; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077665; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077666; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077667; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077686; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077698; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077715; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077716; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077732; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077733; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077735; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077736; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077741; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077742; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077743; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077744; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077747; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077750; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077751; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077753; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077771; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077785; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076333; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076345; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076375; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076387; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076391; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076405; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076423; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076429; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076432; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076434; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076456; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076471; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076489; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076526; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076565; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076571; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076620; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076647; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076670; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076674; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076686; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076703; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076717; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076726; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076731; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076745; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076753; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076766; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076768; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076798; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076810; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076818; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076859; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076904; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076909; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076957; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076969; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076975; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076985; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077021; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077059; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077067; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077073; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077144; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077152; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077160; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077196; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077202; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077203; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077244; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077258; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077262; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077277; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077308; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077312; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077331; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077342; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077343; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077344; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077356; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077362; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077363; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077364; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077366; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077371; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077379; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077382; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077388; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077390; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077393; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077397; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077399; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077418; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077430; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077447; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077448; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077466; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077467; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077468; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077469; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077470; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077474; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077477; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077482; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077484; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077485; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077486; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077505; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077519; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0075743; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075748; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075759; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075788; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075800; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075804; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075810; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075816; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075819; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075837; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075840; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075842; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075863; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075878; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075895; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075921; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075930; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075938; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075969; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0075974; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076022; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076050; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076072; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076087; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076104; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076109; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076125; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076126; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076131; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076146; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076153; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076165; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076198; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076218; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076258; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076302; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076307; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076352; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076364; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076370; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076380; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076458; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076464; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076537; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076544; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076552; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076586; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076594; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076595; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076628; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076632; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076645; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076664; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076676; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076694; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076698; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076716; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076727; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076728; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076729; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076743; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076747; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076750; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076753; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076758; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076761; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076763; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076769; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076771; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076778; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076779; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076780; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076811; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076829; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076844; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076845; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076847; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076848; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076852; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076854; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076856; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076859; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076861; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076862; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076863; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076865; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076883; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0076897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045625; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075897; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075908; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075937; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075953; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075959; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075965; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075968; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075980; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075985; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075988; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0075990; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076010; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076041; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076068; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076077; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076116; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076121; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076169; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076170; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076197; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076219; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076223; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076234; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076251; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076256; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076265; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076272; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076273; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076278; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076293; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076300; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076312; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076314; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076334; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076345; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076365; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076405; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076449; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076454; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076503; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076515; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076521; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076531; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076609; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076687; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076694; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076702; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076736; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076744; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076777; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076781; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076794; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076798; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076813; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076825; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076843; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076847; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076866; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076877; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076878; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076879; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076893; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076899; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076900; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076901; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076904; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076909; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076912; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076914; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076920; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076925; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076929; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076930; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076931; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076950; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076962; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076979; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076980; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076998; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0076999; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077000; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077001; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077002; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077006; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077007; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077008; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077009; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077017; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077019; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077020; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077022; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077041; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0077055; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0075784; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075789; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075801; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075830; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075842; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075846; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075852; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075858; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075861; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075873; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075879; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075904; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075918; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075935; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075962; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075971; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0075979; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076010; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076015; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076063; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076064; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076113; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076117; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076128; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076146; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076148; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076151; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076160; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076167; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076168; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076173; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076188; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076196; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076208; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076230; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076241; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076253; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076261; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076299; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076398; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076410; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076416; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076426; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076505; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076511; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076582; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076589; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076597; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076631; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076637; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076638; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076671; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076676; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076690; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076694; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076709; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076721; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076744; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076759; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076770; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076771; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076772; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076786; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076790; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076791; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076792; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076794; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076799; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076804; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076807; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076809; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076815; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076817; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076820; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076824; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076825; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076826; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076857; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076874; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076891; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076892; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076893; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076894; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076898; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076899; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076900; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076901; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076902; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076905; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076907; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076908; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076909; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076911; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076929; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0076944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0075941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0075946; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0075958; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0075985; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0075997; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076001; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076007; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076013; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076016; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076028; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076034; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076037; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076039; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076060; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076074; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076091; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076118; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076127; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076135; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076166; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076171; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076219; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076220; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076247; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076269; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076284; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076301; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076303; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076306; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076316; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076323; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076324; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076329; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076351; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076363; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076365; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076385; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076395; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076407; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076415; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076457; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076501; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076506; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076551; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076563; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076569; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076579; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076615; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076657; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076663; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076734; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076741; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076749; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076788; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076789; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076822; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076839; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076843; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076858; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076870; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076888; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076892; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076910; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076921; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076922; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076923; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076938; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076949; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076954; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076957; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076959; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076965; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076967; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076970; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076974; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076975; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076976; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0076995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077007; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077025; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077026; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077043; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077044; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077046; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077047; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077052; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077053; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077054; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077057; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077059; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077060; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077061; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077081; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0077095; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075823; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075849; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075861; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075871; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075877; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075880; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075892; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075897; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075900; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075902; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075922; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075936; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075953; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075979; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075988; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075996; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076026; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076031; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076078; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076079; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076128; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076143; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076160; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076162; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076165; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076174; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076180; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076181; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076186; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076201; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076208; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076216; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076218; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076248; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076260; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076308; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076352; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076407; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076425; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076435; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076520; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076591; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076598; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076606; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076640; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076646; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076647; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076680; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076685; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076698; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076702; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076717; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076729; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076751; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076762; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076773; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076774; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076775; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076790; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076796; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076800; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076805; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076809; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076817; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076819; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076822; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076826; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076827; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076828; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076859; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076876; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076893; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076894; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076895; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076896; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076897; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076902; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076903; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076904; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076905; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076908; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076910; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076911; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076912; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076914; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076932; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076946; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076866; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076882; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076910; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076922; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076926; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076932; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076938; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076941; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076960; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076963; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076965; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076985; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076997; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077014; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077040; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077049; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077057; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077088; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077093; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077141; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077142; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077169; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077192; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077196; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077207; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077224; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077226; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077229; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077238; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077245; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077246; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077251; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077266; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077274; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077286; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077288; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077308; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077319; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077331; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077339; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077379; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077423; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077428; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077478; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077490; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077496; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077506; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077542; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077585; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077593; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077664; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077671; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077679; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077713; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077719; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077720; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077753; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077757; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077770; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077775; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077790; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077802; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077825; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077843; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077854; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077855; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077856; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077875; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077876; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077877; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077882; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077887; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077893; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077899; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077901; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077904; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077908; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077909; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077910; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077929; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077941; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077958; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077959; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077977; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077978; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077980; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077981; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077985; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077987; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077988; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077989; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077992; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077994; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077995; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077996; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0078016; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0078028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045263; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075786; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075798; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075827; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075839; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075845; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075851; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075855; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075868; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075874; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075879; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075901; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075915; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075932; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075967; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075975; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076060; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076061; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076088; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076111; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076115; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076127; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076144; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076146; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076158; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076165; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076166; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076183; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076191; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076203; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076205; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076225; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076234; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076246; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076254; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076294; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076343; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076393; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076405; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076411; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076421; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076456; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076501; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076507; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076578; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076585; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076593; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076628; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076634; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076635; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076668; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076672; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076685; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076689; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076704; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076735; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076739; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076757; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076768; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076769; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076770; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076784; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076790; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076791; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076796; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076801; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076804; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076807; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076813; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076815; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076818; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076822; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076823; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076842; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076854; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076872; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076873; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076888; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076889; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076890; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076891; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076892; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076896; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076897; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076903; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076905; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076906; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076909; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076927; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076940; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074911; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074916; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074928; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074957; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074968; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074972; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074978; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074984; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074987; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074999; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075003; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075006; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075008; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075041; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075058; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075085; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075094; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075102; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075133; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075138; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075186; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075187; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075214; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075236; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075240; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075251; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075268; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075270; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075273; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075282; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075289; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075290; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075295; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075310; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075318; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075330; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075332; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075352; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075361; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075381; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075421; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075466; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075471; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075521; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075533; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075539; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075585; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075637; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075709; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075716; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075724; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075759; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075765; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075766; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075799; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075803; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075827; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075839; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075857; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075861; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075890; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075891; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075892; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075905; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075911; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075912; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075913; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075914; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075919; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075924; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075927; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075930; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075938; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075941; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075945; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075946; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075947; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075966; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075978; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075995; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075996; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076013; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076014; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076015; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076016; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076020; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076021; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076022; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076029; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076030; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076031; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076032; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076051; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0076064; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980447.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..44236761
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    11869..11888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21889..22396
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    24649..24677
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(31244..32165)
FT                   /pseudo
FT                   /locus_tag="mCG_141949"
FT                   /note="gene_id=mCG141949.0"
FT   mRNA            complement(31244..32165)
FT                   /pseudo
FT                   /locus_tag="mCG_141949"
FT                   /note="gene_id=mCG141949.0 transcript_id=mCT178097.0
FT                   created on 02-JAN-2003"
FT   assembly_gap    33213..33928
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    39527..39873
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    43725..65042
FT                   /estimated_length=21318
FT                   /gap_type="unknown"
FT   gene            70029..75467
FT                   /locus_tag="mCG_1029561"
FT                   /note="gene_id=mCG1029561.1"
FT   mRNA            join(70029..70098,70478..70578,75065..75467)
FT                   /locus_tag="mCG_1029561"
FT                   /product="mCG1029561"
FT                   /note="gene_id=mCG1029561.1 transcript_id=mCT147265.1
FT                   created on 27-NOV-2002"
FT   CDS             join(70035..70098,70478..70545)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029561"
FT                   /product="mCG1029561"
FT                   /note="gene_id=mCG1029561.1 transcript_id=mCT147265.1
FT                   protein_id=mCP44912.1"
FT                   /protein_id="EDL14001.1"
FT                   /translation="MLPVEWNIHKHFKGIALCPTKAPGTTDFGSVGSIWIKSSIVAD"
FT   gene            80803..81639
FT                   /pseudo
FT                   /locus_tag="mCG_1029486"
FT                   /note="gene_id=mCG1029486.1"
FT   mRNA            80803..81639
FT                   /pseudo
FT                   /locus_tag="mCG_1029486"
FT                   /note="gene_id=mCG1029486.1 transcript_id=mCT147190.1
FT                   created on 27-NOV-2002"
FT   assembly_gap    96749..98283
FT                   /estimated_length=1535
FT                   /gap_type="unknown"
FT   assembly_gap    111432..111696
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    127273..127722
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    132335..132408
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    150249..150601
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    152230..153580
FT                   /estimated_length=1351
FT                   /gap_type="unknown"
FT   gene            <157015..186287
FT                   /locus_tag="mCG_125816"
FT                   /note="gene_id=mCG125816.1"
FT   mRNA            join(<157015..157196,183596..183740,185806..186287)
FT                   /locus_tag="mCG_125816"
FT                   /product="mCG125816"
FT                   /note="gene_id=mCG125816.1 transcript_id=mCT127073.1
FT                   created on 04-DEC-2002"
FT   CDS             join(<157177..157196,183596..183740,185806..185853)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125816"
FT                   /product="mCG125816"
FT                   /note="gene_id=mCG125816.1 transcript_id=mCT127073.1
FT                   protein_id=mCP44823.0"
FT                   /protein_id="EDL14000.1"
FT                   /translation="IRSDKNRTYHRQNLLYEKLKLKEKEVMSFLHNLEMENIEARENNQ
FT                   ELQEGDKCLSVSETSRELGLPTAQE"
FT   assembly_gap    157612..158126
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    164788..164953
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    166116..169796
FT                   /estimated_length=3681
FT                   /gap_type="unknown"
FT   gene            187704..189117
FT                   /pseudo
FT                   /locus_tag="mCG_1029560"
FT                   /note="gene_id=mCG1029560.1"
FT   mRNA            187704..189117
FT                   /pseudo
FT                   /locus_tag="mCG_1029560"
FT                   /note="gene_id=mCG1029560.1 transcript_id=mCT147264.1
FT                   created on 27-NOV-2002"
FT   assembly_gap    197538..197571
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(202261..>223646)
FT                   /locus_tag="mCG_125814"
FT                   /note="gene_id=mCG125814.2"
FT   mRNA            complement(join(202261..204954,223558..>223646))
FT                   /locus_tag="mCG_125814"
FT                   /product="mCG125814, transcript variant mCT190710"
FT                   /note="gene_id=mCG125814.2 transcript_id=mCT190710.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(203108..203561,204828..204954,
FT                   210226..210359,223075..223121,223558..>223646))
FT                   /locus_tag="mCG_125814"
FT                   /product="mCG125814, transcript variant mCT127069"
FT                   /note="gene_id=mCG125814.2 transcript_id=mCT127069.1
FT                   created on 27-NOV-2002"
FT   CDS             complement(203353..>203694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125814"
FT                   /product="mCG125814, isoform CRA_a"
FT                   /note="gene_id=mCG125814.2 transcript_id=mCT190710.0
FT                   protein_id=mCP111672.0 isoform=CRA_a"
FT                   /protein_id="EDL13998.1"
FT                   /translation="GIAYPAKGGFSYCLRIIQMSCVASTLQMCITPVVYTNYSFIKSTG
FT                   LSNYLKGELVAEAGKVADEATDTNPEPYWNQSGTSDPWRLHLLTYLCIFLTSKNGWGWL
FT                   CLAQPCVVD"
FT   CDS             complement(join(204859..204954,210226..210359,
FT                   223075..>223102))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125814"
FT                   /product="mCG125814, isoform CRA_b"
FT                   /note="gene_id=mCG125814.2 transcript_id=mCT127069.1
FT                   protein_id=mCP44800.1 isoform=CRA_b"
FT                   /protein_id="EDL13999.1"
FT                   /translation="DTSLSRNYCGSGYLVLETRGKNALTTCSTREETLRPTGAGSEPWW
FT                   IQLRENTDTGEENLLWVPMRLKRTVKEQYEPQDDSLTPDD"
FT   assembly_gap    211109..218898
FT                   /estimated_length=7790
FT                   /gap_type="unknown"
FT   assembly_gap    220838..220857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    223991..231023
FT                   /estimated_length=7033
FT                   /gap_type="unknown"
FT   gene            complement(253030..256645)
FT                   /locus_tag="mCG_1029410"
FT                   /note="gene_id=mCG1029410.1"
FT   mRNA            complement(253030..256645)
FT                   /locus_tag="mCG_1029410"
FT                   /product="mCG1029410"
FT                   /note="gene_id=mCG1029410.1 transcript_id=mCT147114.1
FT                   created on 15-NOV-2002"
FT   CDS             complement(253290..256337)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029410"
FT                   /product="mCG1029410"
FT                   /note="gene_id=mCG1029410.1 transcript_id=mCT147114.1
FT                   protein_id=mCP44674.1"
FT                   /protein_id="EDL13997.1"
FT                   /translation="MDNMLCICVNSAIYQQWSDLLQVRLEIKDDLAKHSISTLNIELVN
FT                   NTILKLKSVIQSSRRFLPSCGSSSVILEKMDEDIMSALEILCENECKDTDIEKDESQFL
FT                   EFKKSREEHFYRGGRVSWWNFYFSSENYSSAFVKRDSFEELTTLIQQCADSPKPVFVKV
FT                   INLYHHPGCGGTTLAMHVLWDLKQKFRCAVLKNKATDFVEIGEQVSKLMSYKATSHEDF
FT                   IPVLLLVDDFEEQENAYILQNAINAFIAEKGLRYEKTLVIILNCMRSQNPDESAKLANS
FT                   ISLKYQLSPKEQRAFEAKLQEIEKEHKNCENFYSFMILKGNFDTTYIKNVVKNTLKDLD
FT                   AKSRRAQLISYLALLNSYVTDSTISVSQCEIFLGITYTKKYGKPETVEKNMGTYSTLLI
FT                   RTEVSDYGRYTGIRIIHPLIATHCLKELEMSYRMDKCQIALNMLEENVLYDSGLGRDKF
FT                   KYDVQTLLLTRQRKEHGAETDTLFSPLIEELQNEETEKVLIAGSDRFPQNAFICQALAR
FT                   HFYIKEKNFSTALVWANLAKRKAPKNSYISDTLGQVYKSELKQWLGKNKTCGNISVDDL
FT                   AYFLEVAEKASKAFKESQNQSDSKDYGTEAWSPQNSQRRYDTFNTAGFFGEIEVGLDTI
FT                   QLLQLTPLFHKENEISKESMAEFLSGKGTILSDPKGEYCVVLSKFTSLLQNLHSDLERC
FT                   FHFFGDYMGFLKPRNTPKELTELLLSKKVSRCFKKYVELFCHLDTNLVQGKEDLLLQKE
FT                   NCRKRIQAWRADTFSGLLEYLNPNHKEANNIENIVGNYTFLLQDILNKQLSKVLTKDIQ
FT                   NFILANIILSCLKPSSKYILPFSTLKKKLREVLQIVGLTHSYPDPYFLACLLFWPENKE
FT                   LDEDSTLIEKYVSSLNRSFRRQYKHMCRSRQPSTLFYLGQKKGLNSLVHKAEIERYFSE
FT                   VQDSNSFWHSGVVWEKREVKDLLRLLDGQAEGKLISLEYGTEAKIKIPVTSVYSAPLRS
FT                   GRNIERVSFYLGFSIEGPLAYGIKVI"
FT   assembly_gap    277400..281915
FT                   /estimated_length=4516
FT                   /gap_type="unknown"
FT   assembly_gap    284376..284395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    285607..290990
FT                   /estimated_length=5384
FT                   /gap_type="unknown"
FT   assembly_gap    310305..311133
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    315748..316555
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    326650..326808
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    336956..337621
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   gene            complement(345361..387467)
FT                   /gene="AI987662"
FT                   /locus_tag="mCG_11479"
FT                   /note="gene_id=mCG11479.2"
FT   mRNA            complement(join(345361..346181,352362..352471,
FT                   355225..355298,356491..356528,356616..356640,
FT                   356727..356852,365038..365334,372428..372712,
FT                   376064..376417,387387..387467))
FT                   /gene="AI987662"
FT                   /locus_tag="mCG_11479"
FT                   /product="expressed sequence AI987662, transcript variant
FT                   mCT175770"
FT                   /note="gene_id=mCG11479.2 transcript_id=mCT175770.0 created
FT                   on 15-NOV-2002"
FT   mRNA            complement(join(345361..346181,352362..352471,
FT                   355225..355298,356491..356528,356616..356640,
FT                   356727..356852,365038..365334,372428..372712,
FT                   376064..376417,383569..383724))
FT                   /gene="AI987662"
FT                   /locus_tag="mCG_11479"
FT                   /product="expressed sequence AI987662, transcript variant
FT                   mCT11516"
FT                   /note="gene_id=mCG11479.2 transcript_id=mCT11516.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(346178..346181,352362..352471,
FT                   355225..355298,356491..356528,356616..356640,
FT                   356727..356852,365038..365334,372428..372712,
FT                   376064..376417,383569..383647))
FT                   /codon_start=1
FT                   /gene="AI987662"
FT                   /locus_tag="mCG_11479"
FT                   /product="expressed sequence AI987662, isoform CRA_b"
FT                   /note="gene_id=mCG11479.2 transcript_id=mCT11516.2
FT                   protein_id=mCP11503.2 isoform=CRA_b"
FT                   /protein_id="EDL13996.1"
FT                   /translation="MGQDAFMELLRSMVGLSLCKIHLLLIAGSCLGLKVTVPSYTVHGI
FT                   RGQALYLPVHYGFHTPASDIQIIWLFERSHTMPKYLLGSVNKSVVPDLEYQHKFTMMPP
FT                   NASLLINPLQFTDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVMKPMVQFHPASGAVEY
FT                   VGNITLTCQVEGGTRLVYQWRKSGKPISINSSHSFSPQNNTLWIVPVTKEDIGNYTCLV
FT                   SNPVSEMESDIIMPTIYYGPYGLQVNSDKGLKVGEVFTVDLGEAVLFDCSADSYPPNTY
FT                   SWIQRSDNTTHVIKHGPHLEVASEKVAQKTADYVCCAYNNITGRRDETRFTVIITSVGL
FT                   EKLAQRGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKAIRQKLEGRPESEYRKAQT
FT                   FSGHEDALSDFGIYEFVTFPDASGVSRMSSRSSPASDGVTGQDIHGTIYEVIQHIPEQQ
FT                   QENTE"
FT   CDS             complement(join(346178..346181,352362..352471,
FT                   355225..355298,356491..356528,356616..356640,
FT                   356727..356852,365038..365334,372428..372712,
FT                   376064..376268))
FT                   /codon_start=1
FT                   /gene="AI987662"
FT                   /locus_tag="mCG_11479"
FT                   /product="expressed sequence AI987662, isoform CRA_a"
FT                   /note="gene_id=mCG11479.2 transcript_id=mCT175770.0
FT                   protein_id=mCP98692.0 isoform=CRA_a"
FT                   /protein_id="EDL13995.1"
FT                   /translation="MPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFTDEGNY
FT                   IVKVNIQGNGTLSASQKIQVTVDDPVMKPMVQFHPASGAVEYVGNITLTCQVEGGTRLV
FT                   YQWRKSGKPISINSSHSFSPQNNTLWIVPVTKEDIGNYTCLVSNPVSEMESDIIMPTIY
FT                   YGPYGLQVNSDKGLKVGEVFTVDLGEAVLFDCSADSYPPNTYSWIQRSDNTTHVIKHGP
FT                   HLEVASEKVAQKTADYVCCAYNNITGRRDETRFTVIITSVGLEKLAQRGKSLSPLASIT
FT                   GISLFLIISMCLLFLWKKYQPYKAIRQKLEGRPESEYRKAQTFSGHEDALSDFGIYEFV
FT                   TFPDASGVSRMSSRSSPASDGVTGQDIHGTIYEVIQHIPEQQQENTE"
FT   assembly_gap    349319..349338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    350782..350801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <387591..409793
FT                   /locus_tag="mCG_145211"
FT                   /note="gene_id=mCG145211.0"
FT   mRNA            join(<387591..387724,394038..394106,405791..405913,
FT                   406958..407029,408386..408439,409376..409793)
FT                   /locus_tag="mCG_145211"
FT                   /product="mCG145211"
FT                   /note="gene_id=mCG145211.0 transcript_id=mCT184635.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<387674..387724,394038..394106,405791..405913,
FT                   406958..407029,408386..408439,409376..409516)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145211"
FT                   /product="mCG145211"
FT                   /note="gene_id=mCG145211.0 transcript_id=mCT184635.0
FT                   protein_id=mCP105355.0"
FT                   /protein_id="EDL13994.1"
FT                   /translation="LSLDFDMQKIKSLMTRQGLKSPPESLNDLGAFESLRVPGKEEFRE
FT                   LREQPSDPQAEQELINSIEQVYFSADPFDIVKYELEKLPPVLNLQELEEYRDKLKQQQS
FT                   AVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRYYFLWLCSLSSNYLKS
FT                   YCEIYH"
FT   assembly_gap    416052..416071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            444393..492466
FT                   /locus_tag="mCG_11478"
FT                   /note="gene_id=mCG11478.2"
FT   mRNA            join(444393..444428,451221..451311,454468..454644,
FT                   456687..456805,459954..460060,467759..467880,
FT                   476947..477027,481368..481516,482959..483055,
FT                   483684..483842,487413..487534,489069..489258,
FT                   491601..492466)
FT                   /locus_tag="mCG_11478"
FT                   /product="mCG11478"
FT                   /note="gene_id=mCG11478.2 transcript_id=mCT11514.2 created
FT                   on 07-AUG-2002"
FT   assembly_gap    445932..447105
FT                   /estimated_length=1174
FT                   /gap_type="unknown"
FT   CDS             join(451243..451311,454468..454644,456687..456805,
FT                   459954..460060,467759..467880,476947..477027,
FT                   481368..481516,482959..483055,483684..483842,
FT                   487413..487534,489069..489258,491601..491720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11478"
FT                   /product="mCG11478"
FT                   /note="gene_id=mCG11478.2 transcript_id=mCT11514.2
FT                   protein_id=mCP11526.1"
FT                   /protein_id="EDL13993.1"
FT                   /translation="MFLENETWELCPVKSNFSILQLHEFKFLEQSRSPSVSPSKQPSAT
FT                   SSKPVTLFEQYCSGGNPFEIQADHKDEETEDVLASNGYESDEQEKSAYQDYDSDSDVPE
FT                   ELKRDYVDEQTGDVPVKSVSRETLKSRKKSDYSLNKVNAPILTNTTLNVIRLVGKYMQM
FT                   MNILKPIAFDVIHFMSQLFDYYLYAIYTFFGRNDSLESTGLGLSSSRLKTTLNRIQESL
FT                   IDLEGSADPTATLTAAEERKEKVPSPHLNQLVILTSGDTLYGLAERVVATESLVFLAEQ
FT                   FEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPIYWIVAGKAIDYEQMLLLMMNV
FT                   KWDVKEIMSQHNIYVDALLKEFEQFNKRLNEVSKRVRIPLPVSNILWEHCIRLANRTIV
FT                   EGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMER
FT                   WIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDEIDRPKR"
FT   assembly_gap    468094..468113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    469825..473005
FT                   /estimated_length=3181
FT                   /gap_type="unknown"
FT   assembly_gap    529849..529868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    535019..535038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(569034..648030)
FT                   /gene="Calcr"
FT                   /locus_tag="mCG_11481"
FT                   /note="gene_id=mCG11481.1"
FT   mRNA            complement(join(569034..570943,574832..574873,
FT                   575842..576060,577003..577069,577151..577211,
FT                   583430..583583,591919..592045,594881..594972,
FT                   598082..598194,600525..600635,601998..602151,
FT                   606356..606434,636384..636491,646646..646832,
FT                   647856..648030))
FT                   /gene="Calcr"
FT                   /locus_tag="mCG_11481"
FT                   /product="calcitonin receptor, transcript variant
FT                   mCT171488"
FT                   /note="gene_id=mCG11481.1 transcript_id=mCT171488.0 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(569034..570943,574832..574873,
FT                   575842..576060,577003..577069,577151..577211,
FT                   583430..583583,590922..591032,591919..592045,
FT                   594881..594972,598082..598194,600525..600635,
FT                   601998..602151,606356..606434,636384..636491,
FT                   646646..646832,647856..648030))
FT                   /gene="Calcr"
FT                   /locus_tag="mCG_11481"
FT                   /product="calcitonin receptor, transcript variant mCT11518"
FT                   /note="gene_id=mCG11481.1 transcript_id=mCT11518.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(570695..570943,574832..574873,
FT                   575842..576060,577003..577069,577151..577211,
FT                   583430..583583,591919..592045,594881..594972,
FT                   598082..598194,600525..600635,601998..602151,
FT                   606356..606434,636384..636406))
FT                   /codon_start=1
FT                   /gene="Calcr"
FT                   /locus_tag="mCG_11481"
FT                   /product="calcitonin receptor, isoform CRA_b"
FT                   /note="gene_id=mCG11481.1 transcript_id=mCT171488.0
FT                   protein_id=mCP94407.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="EDL13992.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYL
FT                   LGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVL
FT                   VTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHF
FT                   QGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDG
FT                   LPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   CDS             complement(join(570695..570943,574832..574873,
FT                   575842..576060,577003..577069,577151..577211,
FT                   583430..583583,590922..591032,591919..592045,
FT                   594881..594972,598082..598194,600525..600635,
FT                   601998..602151,606356..606434,636384..636406))
FT                   /codon_start=1
FT                   /gene="Calcr"
FT                   /locus_tag="mCG_11481"
FT                   /product="calcitonin receptor, isoform CRA_a"
FT                   /note="gene_id=mCG11481.1 transcript_id=mCT11518.0
FT                   protein_id=mCP11513.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="EDL13991.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLSAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEE
FT                   STEMIPMNVIQQDASA"
FT   assembly_gap    698273..698292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(840116..866444)
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /note="gene_id=mCG20406.2"
FT   mRNA            complement(join(840116..840967,841326..841496,
FT                   842893..843075,845396..845578,866348..866444))
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, transcript
FT                   variant mCT171514"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT171514.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(840116..840967,841326..841496,
FT                   842893..843075,845396..845578,852058..852177,
FT                   866348..866444))
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, transcript
FT                   variant mCT171515"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT171515.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(840116..840967,841326..841496,
FT                   842893..843075,845396..845578,845765..845887))
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, transcript
FT                   variant mCT21102"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT21102.1 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(840900..840967,841326..841496,
FT                   842893..843075,845396..845578,852058..852133))
FT                   /codon_start=1
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, isoform CRA_c"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT171515.0
FT                   protein_id=mCP94433.0 isoform=CRA_c"
FT                   /protein_id="EDL13990.1"
FT                   /translation="MQIWDSRVLGLNLSSASNDSLSTWPGNNLEICLLPLDAGPCQALI
FT                   PKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKP
FT                   NIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSA
FT                   NVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFW
FT                   KHLS"
FT   CDS             complement(join(840900..840967,841326..841496,
FT                   842893..843075,845396..845578,845765..845852))
FT                   /codon_start=1
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, isoform CRA_b"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT21102.1
FT                   protein_id=mCP11523.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V1S9"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="MGI:MGI:108543"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1S9"
FT                   /protein_id="EDL13989.1"
FT                   /translation="MDPAMPLQLWNLPLLLVGSVLGLTSVSAQGNNLEICLLPLDAGPC
FT                   QALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYP
FT                   CDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEG
FT                   LCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFL
FT                   PRFWKHLS"
FT   CDS             complement(join(840900..840967,841326..841496,
FT                   842893..842992))
FT                   /codon_start=1
FT                   /gene="Tfpi2"
FT                   /locus_tag="mCG_20406"
FT                   /product="tissue factor pathway inhibitor 2, isoform CRA_a"
FT                   /note="gene_id=mCG20406.2 transcript_id=mCT171514.0
FT                   protein_id=mCP94434.0 isoform=CRA_a"
FT                   /protein_id="EDL13988.1"
FT                   /translation="MTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEG
FT                   LCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFL
FT                   PRFWKHLS"
FT   gene            871342..874959
FT                   /gene="Gngt1"
FT                   /locus_tag="mCG_20401"
FT                   /note="gene_id=mCG20401.1"
FT   mRNA            join(871342..871611,871742..871844,874175..874959)
FT                   /gene="Gngt1"
FT                   /locus_tag="mCG_20401"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 1"
FT                   /note="gene_id=mCG20401.1 transcript_id=mCT21097.1 created
FT                   on 07-NOV-2002"
FT   CDS             join(871749..871844,874175..874303)
FT                   /codon_start=1
FT                   /gene="Gngt1"
FT                   /locus_tag="mCG_20401"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 1"
FT                   /note="gene_id=mCG20401.1 transcript_id=mCT21097.1
FT                   protein_id=mCP11524.1"
FT                   /protein_id="EDL13987.1"
FT                   /translation="MPVINIEDLTEKDKLKMEVDQLKKEVTLERMMVSKCCEEVRDYIE
FT                   ERSGEDPLVKGIPEDKNPFKELKGGCVIS"
FT   gene            881427..885972
FT                   /gene="Gng11"
FT                   /locus_tag="mCG_20405"
FT                   /note="gene_id=mCG20405.1"
FT   mRNA            join(881427..881934,885562..885972)
FT                   /gene="Gng11"
FT                   /locus_tag="mCG_20405"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 11"
FT                   /note="gene_id=mCG20405.1 transcript_id=mCT21101.1 created
FT                   on 06-AUG-2002"
FT   CDS             join(881839..881934,885562..885687)
FT                   /codon_start=1
FT                   /gene="Gng11"
FT                   /locus_tag="mCG_20405"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 11"
FT                   /note="gene_id=mCG20405.1 transcript_id=mCT21101.1
FT                   protein_id=mCP11519.1"
FT                   /protein_id="EDL13986.1"
FT                   /translation="MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIE
FT                   ERSGEDPLVKGIPEDKNPFKEKGSCVIS"
FT   assembly_gap    893003..893022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(909464..>925199)
FT                   /locus_tag="mCG_145951"
FT                   /note="gene_id=mCG145951.0"
FT   mRNA            complement(join(909464..909669,922494..922654,
FT                   925073..>925199))
FT                   /locus_tag="mCG_145951"
FT                   /product="mCG145951"
FT                   /note="gene_id=mCG145951.0 transcript_id=mCT186059.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(909536..909669,922494..922654,
FT                   925073..>925074))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145951"
FT                   /product="mCG145951"
FT                   /note="gene_id=mCG145951.0 transcript_id=mCT186059.0
FT                   protein_id=mCP107368.0"
FT                   /protein_id="EDL13985.1"
FT                   /translation="LLMLVPTEIQGRQLHKAWRAGLYEGCMHATKQFKSTNSCKRNNIK
FT                   GQRNDYMDKGIHFIRRCNIICRRHPWPEVLERTKMMMMMRRRRSRKRKRKADK"
FT   gene            complement(954468..964504)
FT                   /gene="Bet1"
FT                   /locus_tag="mCG_20404"
FT                   /note="gene_id=mCG20404.2"
FT   mRNA            complement(join(954468..955600,957525..957581,
FT                   960022..960146,964335..964504))
FT                   /gene="Bet1"
FT                   /locus_tag="mCG_20404"
FT                   /product="blocked early in transport 1 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG20404.2 transcript_id=mCT21100.1 created
FT                   on 10-APR-2002"
FT   CDS             complement(join(955445..955600,957525..957581,
FT                   960022..960146,964335..964353))
FT                   /codon_start=1
FT                   /gene="Bet1"
FT                   /locus_tag="mCG_20404"
FT                   /product="blocked early in transport 1 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG20404.2 transcript_id=mCT21100.1
FT                   protein_id=mCP11515.1"
FT                   /protein_id="EDL13984.1"
FT                   /translation="MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTA
FT                   IKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFS
FT                   LFVFFVIYWIIKLR"
FT   assembly_gap    970656..973367
FT                   /estimated_length=2712
FT                   /gap_type="unknown"
FT   assembly_gap    991871..991989
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    996341..997190
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    1045263..1045732
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    1056925..1057867
FT                   /estimated_length=943
FT                   /gap_type="unknown"
FT   assembly_gap    1075833..1076179
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    1094279..1094335
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    1133114..1135928
FT                   /estimated_length=2815
FT                   /gap_type="unknown"
FT   assembly_gap    1137053..1137072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1162625..1164866
FT                   /estimated_length=2242
FT                   /gap_type="unknown"
FT   assembly_gap    1174329..1174497
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    1183247..1184059
FT                   /estimated_length=813
FT                   /gap_type="unknown"
FT   assembly_gap    1193425..1197664
FT                   /estimated_length=4240
FT                   /gap_type="unknown"
FT   assembly_gap    1206240..1206348
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    1207447..1207514
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            1235249..1236643
FT                   /pseudo
FT                   /locus_tag="mCG_125615"
FT                   /note="gene_id=mCG125615.1"
FT   mRNA            1235249..1236643
FT                   /pseudo
FT                   /locus_tag="mCG_125615"
FT                   /note="gene_id=mCG125615.1 transcript_id=mCT126878.1
FT                   created on 15-NOV-2002"
FT   assembly_gap    1258069..1258532
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   gene            1262652..1262969
FT                   /pseudo
FT                   /locus_tag="mCG_141514"
FT                   /note="gene_id=mCG141514.0"
FT   mRNA            1262652..1262969
FT                   /pseudo
FT                   /locus_tag="mCG_141514"
FT                   /note="gene_id=mCG141514.0 transcript_id=mCT175765.0
FT                   created on 15-NOV-2002"
FT   assembly_gap    1277597..1277616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1289675..1289946
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    1303806..1303833
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1322184..1322648
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    1378152..1378171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1379160..1414446
FT                   /gene="Col1a2"
FT                   /locus_tag="mCG_20403"
FT                   /note="gene_id=mCG20403.2"
FT   mRNA            join(1379160..1379352,1381778..1381788,1382383..1382397,
FT                   1383047..1383082,1384126..1384236,1385801..1385854,
FT                   1388653..1388697,1388928..1388981,1389076..1389129,
FT                   1389408..1389461,1389839..1389892,1390347..1390400,
FT                   1391923..1391967,1392240..1392293,1392397..1392441,
FT                   1392741..1392794,1393279..1393377,1393487..1393531,
FT                   1393620..1393718,1394045..1394098,1394221..1394328,
FT                   1394680..1394733,1394845..1394943,1395879..1395932,
FT                   1396393..1396491,1397028..1397081,1397551..1397604,
FT                   1397936..1397989,1398310..1398363,1399316..1399360,
FT                   1400491..1400589,1401742..1401849,1402504..1402557,
FT                   1403608..1403661,1404393..1404446,1404540..1404593,
FT                   1404674..1404781,1405332..1405385,1406181..1406234,
FT                   1407179..1407340,1408018..1408125,1408818..1408925,
FT                   1409268..1409321,1409413..1409520,1409645..1409698,
FT                   1410034..1410141,1410610..1410663,1410787..1410894,
FT                   1411215..1411473,1412063..1412247,1412900..1413142,
FT                   1413953..1414446)
FT                   /gene="Col1a2"
FT                   /locus_tag="mCG_20403"
FT                   /product="procollagen, type I, alpha 2"
FT                   /note="gene_id=mCG20403.2 transcript_id=mCT21099.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(1379283..1379352,1381778..1381788,1382383..1382397,
FT                   1383047..1383082,1384126..1384236,1385801..1385854,
FT                   1388653..1388697,1388928..1388981,1389076..1389129,
FT                   1389408..1389461,1389839..1389892,1390347..1390400,
FT                   1391923..1391967,1392240..1392293,1392397..1392441,
FT                   1392741..1392794,1393279..1393377,1393487..1393531,
FT                   1393620..1393718,1394045..1394098,1394221..1394328,
FT                   1394680..1394733,1394845..1394943,1395879..1395932,
FT                   1396393..1396491,1397028..1397081,1397551..1397604,
FT                   1397936..1397989,1398310..1398363,1399316..1399360,
FT                   1400491..1400589,1401742..1401849,1402504..1402557,
FT                   1403608..1403661,1404393..1404446,1404540..1404593,
FT                   1404674..1404781,1405332..1405385,1406181..1406234,
FT                   1407179..1407340,1408018..1408125,1408818..1408925,
FT                   1409268..1409321,1409413..1409520,1409645..1409698,
FT                   1410034..1410141,1410610..1410663,1410787..1410894,
FT                   1411215..1411473,1412063..1412247,1412900..1413142,
FT                   1413953..1414099)
FT                   /codon_start=1
FT                   /gene="Col1a2"
FT                   /locus_tag="mCG_20403"
FT                   /product="procollagen, type I, alpha 2"
FT                   /note="gene_id=mCG20403.2 transcript_id=mCT21099.2
FT                   protein_id=mCP11534.2"
FT                   /db_xref="GOA:Q3TX57"
FT                   /db_xref="InterPro:IPR000885"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="MGI:MGI:88468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TX57"
FT                   /protein_id="EDL13983.1"
FT                   /translation="MLSFVDTRTLLLLAVTSCLATCQYLQSGSVRKGPTGDRGPRGQRG
FT                   PAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGP
FT                   RGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERG
FT                   VVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGAR
FT                   GLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGP
FT                   AGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAG
FT                   AAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPA
FT                   GPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGL
FT                   PGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERG
FT                   HPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKP
FT                   GERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGA
FT                   PGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAG
FT                   ASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPK
FT                   GENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGP
FT                   PGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQG
FT                   LLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEA
FT                   GRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGP
FT                   AGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQG
FT                   APGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQGPAGPPGPPGPPGPP
FT                   GVSGGGYDFGFEGDFYRADQPRSQPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPA
FT                   RTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSR
FT                   AQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAY
FT                   LDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIEYKTNKPS
FT                   RLPFLDIAPLDIGGADQEFRVEVGPVCFK"
FT   assembly_gap    1421352..1421371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1440636..1440655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1451298..1451317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1457974..1458026
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    1473582..1473667
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    1475528..1475919
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   gene            <1482412..1517735
FT                   /gene="Casd1"
FT                   /locus_tag="mCG_128299"
FT                   /note="gene_id=mCG128299.1"
FT   mRNA            join(<1482412..1482513,1483068..1483188,1487610..1487654,
FT                   1489024..1489086,1493670..1493714,1494142..1494265,
FT                   1495453..1495667,1498432..1498854,1499860..1499949,
FT                   1504355..1504474,1505401..1505557,1505912..1505991,
FT                   1508395..1508496,1510139..1510279,1511363..1511440,
FT                   1515310..1515402,1516242..1517735)
FT                   /gene="Casd1"
FT                   /locus_tag="mCG_128299"
FT                   /product="CAS1 domain containing 1"
FT                   /note="gene_id=mCG128299.1 transcript_id=mCT129594.1
FT                   created on 15-NOV-2002"
FT   CDS             join(<1482413..1482513,1483068..1483188,1487610..1487654,
FT                   1489024..1489086,1493670..1493714,1494142..1494265,
FT                   1495453..1495667,1498432..1498854,1499860..1499949,
FT                   1504355..1504474,1505401..1505557,1505912..1505991,
FT                   1508395..1508496,1510139..1510279,1511363..1511440,
FT                   1515310..1515402,1516242..1516508)
FT                   /codon_start=1
FT                   /gene="Casd1"
FT                   /locus_tag="mCG_128299"
FT                   /product="CAS1 domain containing 1"
FT                   /note="gene_id=mCG128299.1 transcript_id=mCT129594.1
FT                   protein_id=mCP44967.1"
FT                   /protein_id="EDL13982.1"
FT                   /translation="IGNDSCEYLLSSGRFLGEKVWQPHSCMMHKYKISEAKTCLVDKHI
FT                   AFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKAASVKVDFLWHPEVNGSMKQC
FT                   IKVWTEDSVLKPHVIVAGAATWSIKIHNGSEEALAQYKMNITSIAPLLEKLAKTSDVYW
FT                   VLQDPVYEDLLSENRKMITNEKIDAYNEAAVSILNSSTRTSKSNVKMFSVSKLIAQETI
FT                   MESLDGLHLPESSRETSAMILMNVYCNKVVKPVDGSCCQPRPPLTLIQKLAACFFTLSI
FT                   IGYFIFYVIHRNAHRKNKPCTDLESGEEKKNIINTPVSSLEILLQSFCKLGLIMAYFYM
FT                   CDRANLFMKENKFYTHSSFFIPIIYILVLGVFYNENTKETKVLNREQTDEWKGWMQLVI
FT                   LIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFWIKGDFGIHRVCQVLFRLNFLV
FT                   VVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQITQKKANGNFFWYLGLLLKLGLL
FT                   LLCIWFLAYSQGAFEKIFSLWPLSKCFELEGSVYEWWFRWRLDRYVVFHGVLFAFIYLA
FT                   LQRRQILSEGKGEPLFSNKISNFLLFVSVVSFLTYSIWASSCKNKAECNELHPSVSVVQ
FT                   IVAFILIRNIPGYARSIYSSFFAWFGKISLELFICQYHIWLAADTRGILVLIPGNPTLN
FT                   IIVSTFIFVCVAHEISQITTDLAQVVIPKDNPSLFRRLACTIAFFGGVLILSSIQDKSR
FT                   L"
FT   assembly_gap    1483491..1483843
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    1521178..1521549
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    1534012..1534169
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            complement(1548369..1620978)
FT                   /gene="Sgce"
FT                   /locus_tag="mCG_20402"
FT                   /note="gene_id=mCG20402.2"
FT   mRNA            complement(join(1548369..1548648,1552083..1552126,
FT                   1563605..1563793,1564495..1564521,1565456..1565667,
FT                   1568040..1568202,1581092..1581290,1585326..1585398,
FT                   1591797..1591954,1593247..1593369,1620853..1620978))
FT                   /gene="Sgce"
FT                   /locus_tag="mCG_20402"
FT                   /product="sarcoglycan, epsilon, transcript variant
FT                   mCT21098"
FT                   /note="gene_id=mCG20402.2 transcript_id=mCT21098.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(1548369..1548648,1552083..1552126,
FT                   1563605..1563793,1564495..1564521,1565456..1565667,
FT                   1568040..1568202,1581092..1581290,1585326..1585398,
FT                   1591797..1591954,1593247..1593369,1603879..1603986,
FT                   1620853..1620978))
FT                   /gene="Sgce"
FT                   /locus_tag="mCG_20402"
FT                   /product="sarcoglycan, epsilon, transcript variant
FT                   mCT171513"
FT                   /note="gene_id=mCG20402.2 transcript_id=mCT171513.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(1548632..1548648,1552083..1552126,
FT                   1563605..1563793,1564495..1564521,1565456..1565667,
FT                   1568040..1568202,1581092..1581290,1585326..1585398,
FT                   1591797..1591954,1593247..1593369,1620853..1620961))
FT                   /codon_start=1
FT                   /gene="Sgce"
FT                   /locus_tag="mCG_20402"
FT                   /product="sarcoglycan, epsilon, isoform CRA_a"
FT                   /note="gene_id=mCG20402.2 transcript_id=mCT21098.2
FT                   protein_id=mCP11527.2 isoform=CRA_a"
FT                   /protein_id="EDL13980.1"
FT                   /translation="MLLFWWWELGDPCAWTGKGRGTLKMSPATTGTFLLTVYTLFSKVH
FT                   SDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEVSNDPITFNTNLMGYPDRPGWLRYI
FT                   QRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARHNLIINIMSAEEFPLPYQAE
FT                   FFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSALDRGGRVPLPINDMKEGV
FT                   YVMVGADVAFSSCLREVENPQNQLRCSQEMEPVITCDKKFRTHFHIDWCKISLVDKTKQ
FT                   VSTYQEVVRGEGILPDGGEYKPPSDSLKSRDYYTDFLVTLAVPSAVALVLFLILAYIMC
FT                   CRREGVEKRDMQTPDIQLVHHSSIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEVIP
FT                   PTHTDNYDSTNMPLMQAQQNLPHQTQIPQPQTTGKWYP"
FT   CDS             complement(join(1548632..1548648,1552083..1552126,
FT                   1563605..1563793,1564495..1564521,1565456..1565667,
FT                   1568040..1568202,1581092..1581290,1585326..1585398,
FT                   1591797..1591954,1593247..1593369,1603879..1603986,
FT                   1620853..1620961))
FT                   /codon_start=1
FT                   /gene="Sgce"
FT                   /locus_tag="mCG_20402"
FT                   /product="sarcoglycan, epsilon, isoform CRA_b"
FT                   /note="gene_id=mCG20402.2 transcript_id=mCT171513.0
FT                   protein_id=mCP94432.0 isoform=CRA_b"
FT                   /protein_id="EDL13981.1"
FT                   /translation="MLLFWWWELGDPCAWTGKGRGTLKMSPATTGTFLLTAFLLSCADG
FT                   INGTVNWKTKQASSFSISRKLAAGKKDVYTLFSKVHSDRNVYPSAGVLFVHVLEREYFK
FT                   GEFPPYPKPGEVSNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPT
FT                   IIEITAYNRRTFETARHNLIINIMSAEEFPLPYQAEFFIKNMNVEEMLASEVLGDFLGA
FT                   VKNVWQPERLNAINITSALDRGGRVPLPINDMKEGVYVMVGADVAFSSCLREVENPQNQ
FT                   LRCSQEMEPVITCDKKFRTHFHIDWCKISLVDKTKQVSTYQEVVRGEGILPDGGEYKPP
FT                   SDSLKSRDYYTDFLVTLAVPSAVALVLFLILAYIMCCRREGVEKRDMQTPDIQLVHHSS
FT                   IQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEVIPPTHTDNYDSTNMPLMQAQQNLPH
FT                   QTQIPQPQTTGKWYP"
FT   assembly_gap    1590343..1590922
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   gene            <1621280..1630710
FT                   /locus_tag="mCG_64208"
FT                   /note="gene_id=mCG64208.2"
FT   mRNA            join(<1621280..1621452,1627951..1628282,1628760..1628784,
FT                   1628953..1630710)
FT                   /locus_tag="mCG_64208"
FT                   /product="mCG64208"
FT                   /note="gene_id=mCG64208.2 transcript_id=mCT64391.2 created
FT                   on 11-APR-2003"
FT   CDS             join(<1621280..1621452,1627951..1628282,1628760..1628784,
FT                   1628953..1629757)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64208"
FT                   /product="mCG64208"
FT                   /note="gene_id=mCG64208.2 transcript_id=mCT64391.2
FT                   protein_id=mCP33310.2"
FT                   /protein_id="EDL13979.1"
FT                   /translation="PDQLRPGESSQPRRSTEPRLGLLRGLRSGAFSGPRSPSGPGRRGT
FT                   PHPSWHRRGILVWNRRVLRTKRRQPRGSQDPGLPPQGSEAPLTAAMAAAGGSSNCPPPP
FT                   PPPPPNNNNNNNTPKSPGVPDAEDDDERRHDELPEDINNFDEDMNRQFENMNLLDQVEL
FT                   LAQSYNKNQENIDSLDDPLQLQGAAAAPIPNFFSDDDCLEDLPEKFDGNPDMLGPFMDQ
FT                   CQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVF
FT                   EDPQRREAAKRKIRRLRQGPGPVVDYSNAFQMIAQDLDWTEPALMDQFQEGLNPDIRAE
FT                   LSRQEAPKTLAALITACIHIERRLARDAAAKPDPSPRALVMPPNSQTDPTEPVGGARMR
FT                   LSKEEKERRRKMNLCLYCGNGGHFADTCPAKASKNSPPGNSPAPL"
FT   assembly_gap    1622870..1622889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1628661..1628680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1631557..1631576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1634685..1636544
FT                   /estimated_length=1860
FT                   /gap_type="unknown"
FT   gene            complement(1680521..>1689371)
FT                   /locus_tag="mCG_145210"
FT                   /note="gene_id=mCG145210.0"
FT   mRNA            complement(join(1680521..1680691,1684786..1685083,
FT                   1686163..1686336,1689272..>1689371))
FT                   /locus_tag="mCG_145210"
FT                   /product="mCG145210"
FT                   /note="gene_id=mCG145210.0 transcript_id=mCT184634.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1680535..1680691,1684786..>1684802))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145210"
FT                   /product="mCG145210"
FT                   /note="gene_id=mCG145210.0 transcript_id=mCT184634.0
FT                   protein_id=mCP105354.0"
FT                   /protein_id="EDL13978.1"
FT                   /translation="SRRQPRVTWCPEADAGKAAAHYRVGSCLLRSMPYSNAAVRNSLKS
FT                   VLAVCSFKLSII"
FT   assembly_gap    1715746..1715765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1717473..1717492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1762560..1762579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1769795..>1770372)
FT                   /locus_tag="mCG_128295"
FT                   /note="gene_id=mCG128295.1"
FT   mRNA            complement(1769795..>1770372)
FT                   /locus_tag="mCG_128295"
FT                   /product="mCG128295"
FT                   /note="gene_id=mCG128295.1 transcript_id=mCT129590.1
FT                   created on 15-NOV-2002"
FT   CDS             complement(1769893..>1770357)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128295"
FT                   /product="mCG128295"
FT                   /note="gene_id=mCG128295.1 transcript_id=mCT129590.1
FT                   protein_id=mCP45033.1"
FT                   /protein_id="EDL13977.1"
FT                   /translation="KLSRLSSSLSHWQSDSLVVCEVDPELKETLRKFRFRKETNNAAII
FT                   MKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSS
FT                   PVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR"
FT   assembly_gap    1780248..1780267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1780597..2038205
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /note="gene_id=mCG141520.0"
FT   mRNA            join(1780597..1780725,1782503..1784121,1922770..1922902,
FT                   1934296..1934416,1940837..1940941,1954326..1954461,
FT                   1959866..1959931,1977253..1977408,1987842..1987895,
FT                   1990443..1990672,1991961..1992057,1992151..1992322,
FT                   2011173..2011330,2011845..2012088,2020418..2020505,
FT                   2020596..2020679,2031178..2031376,2033290..2033409,
FT                   2035258..2035440,2036721..2038205)
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, transcript variant mCT175783"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT175783.0
FT                   created on 15-NOV-2002"
FT   mRNA            join(1780597..1780725,1782503..1784121,1922770..1922902,
FT                   1934296..1934416,1940837..1940941,1954326..1954461,
FT                   1977253..1977408,1987842..1987895,1990443..1990672,
FT                   1991961..1992057,1992151..1992322,2011173..2011330,
FT                   2033290..2033409,2034173..2034196,2035258..2035440,
FT                   2036721..2038205)
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, transcript variant mCT175784"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT175784.0
FT                   created on 15-NOV-2002"
FT   CDS             join(1782724..1784121,1922770..1922902,1934296..1934416,
FT                   1940837..1940941,1954326..1954461,1959866..1959931,
FT                   1977253..1977408,1987842..1987895,1990443..1990672,
FT                   1991961..1992057,1992151..1992322,2011173..2011330,
FT                   2011845..2012088,2020418..2020505,2020596..2020679,
FT                   2031178..2031376,2033290..2033409,2035258..2035440,
FT                   2036721..2036921)
FT                   /codon_start=1
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, isoform CRA_a"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT175783.0
FT                   protein_id=mCP98706.0 isoform=CRA_a"
FT                   /protein_id="EDL13974.1"
FT                   /translation="MLKAESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKT
FT                   KEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPSENAAIIAKTRGKGRPSSPQRRMKPKE
FT                   FVEKTDGSVVKLESSVSERISRFDTMHDGPSYAKFTETRKMFERSVHESGQNHRYSPKK
FT                   EKGGGTEPQDEWGGSKSNRGSSDSLDSLSPRTEAVSPTVSQLSAVFENSEPPGALTSGK
FT                   AESADYSVTGHYPLNLPSVTVTNLDTFGRLKDSNSKPPSNKQDTDTEDAQKSDAVPVPE
FT                   VAQKGTSLASLPSEESQLSTEAEDVTTAQPEALDSTDKDSPEEPSAENQAMPKSHILSP
FT                   RNEPLEDAEANVVGSERAQHQKKDLTGGDLTSPDASASSCGREVPEDSNSFESSHVYMH
FT                   SDYNVYRVRSRYNSDWGETGTEQDEEEDSDENNYYQPDMEYSEIVGLPEEEEIPANRKI
FT                   KFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGI
FT                   SIIGMGVGADAGLEKLGIFVKTVTDGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAAT
FT                   VLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLERHYAQYDADDDENTVA
FT                   ELQGVSGNCNNNNNRFLKTGEYATDEEEDEGGPILPSGDVAIEVFELPENEDMFSPSDL
FT                   DTSKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKNQLQQNIEENKERML
FT                   KLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELDFIKRQEVER
FT                   KKREEVEKAHLLEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRPSPGEVSKGD
FT                   TMENVEVKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPTRTRLYDSV
FT                   SSTDGEDSLERKAWRVSSPESECGVTLLTPVTSPRAFSSHHTTESPGGSQHPEGDPFSS
FT                   ISGDTSSSSTSASDHDTEDSPCCHQATEKALQEKDDDKYPKSLRTSSSFVVQRGKIKQK
FT                   FADLGAPLRRNPNKGKKRKDKEKEASRFSAGSRIFRSKLENWKSKPSSAAQASTRSPCM
FT                   PFSWFNESRKGSYSFRNLPSAPSPLQPSPETQVSDKTGSKNFTFNDDFSPSSTSSADLS
FT                   GLGAEPKTPGLSQSLALSSDEILDDGQSPKHTQSQNRAVHEWSVQQVSHWLMSLSLDQY
FT                   VPEFSAQSISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKARKAQEKMEK
FT                   QREKLRRKEQEQMQRKSKKSEKMTSTADQP"
FT   CDS             join(1782724..1784121,1922770..1922902,1934296..1934416,
FT                   1940837..1940941,1954326..1954461,1977253..1977408,
FT                   1987842..1987895,1990443..1990672,1991961..1992057,
FT                   1992151..1992322,2011173..2011330,2033290..2033409,
FT                   2034173..2034196,2035258..2035440,2036721..2036921)
FT                   /codon_start=1
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, isoform CRA_c"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT175784.0
FT                   protein_id=mCP98705.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q7TN74"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029994"
FT                   /db_xref="MGI:MGI:2442401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TN74"
FT                   /protein_id="EDL13976.1"
FT                   /translation="MLKAESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKT
FT                   KEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPSENAAIIAKTRGKGRPSSPQRRMKPKE
FT                   FVEKTDGSVVKLESSVSERISRFDTMHDGPSYAKFTETRKMFERSVHESGQNHRYSPKK
FT                   EKGGGTEPQDEWGGSKSNRGSSDSLDSLSPRTEAVSPTVSQLSAVFENSEPPGALTSGK
FT                   AESADYSVTGHYPLNLPSVTVTNLDTFGRLKDSNSKPPSNKQDTDTEDAQKSDAVPVPE
FT                   VAQKGTSLASLPSEESQLSTEAEDVTTAQPEALDSTDKDSPEEPSAENQAMPKSHILSP
FT                   RNEPLEDAEANVVGSERAQHQKKDLTGGDLTSPDASASSCGREVPEDSNSFESSHVYMH
FT                   SDYNVYRVRSRYNSDWGETGTEQDEEEDSDENNYYQPDMEYSEIVGLPEEEEIPANRKI
FT                   KFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGI
FT                   SIIGMGVGADAGLEKLGIFVKTVTDGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAAT
FT                   VLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLERHYAQYDADDDETGEY
FT                   ATDEEEDEGGPILPSGDVAIEVFELPENEDMFSPSDLDTSKLSHKFKELQIKHAVTEAE
FT                   IQKLKTKLQAAENEKVRWELEKNQLQQNIEENKERMLKLESYWIEAQTLCHTVNEHLKE
FT                   TQSQYQALEKKYNKAKKLIKDFQQKELDFIKRQEVERKKREEVEKAHLLEVQGLQVRIR
FT                   DLEAEVFRLLKQNGTQVNNNNNIFERRPSPGEVSKGDTMENVEVKQTSCQDGLSQDLNE
FT                   AVPETERLDSKALKTRAQLSVKNRRQRPTRTRLYDSVSSTDGEDSLERKNFTFNDDFSP
FT                   SSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMIDDEILDDGQSPKHTQSQNRAVHEW
FT                   SVQQVSHWLMSLSLDQYVPEFSAQSISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKE
FT                   MKMSLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKSEKMTSTADQP"
FT   mRNA            join(<1783683..1784121,1922770..1922902,1934296..1934416,
FT                   1938964..1939038,1940837..1940941,1954326..1954461,
FT                   1977253..1977408,1987842..1987895,1990443..1990672,
FT                   1991961..1992057,1992151..1992322,2011173..2012088,
FT                   2020418..2020505,2020596..2020679,2031178..2031418)
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, transcript variant mCT190725"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT190725.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    1799658..1799694
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    1808067..1808086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1831718..1831737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1844389..1844408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1939007..1939038,1940837..1940941,1954326..1954461,
FT                   1977253..1977408,1987842..1987895,1990443..1990672,
FT                   1991961..1992057,1992151..1992322,2011173..2011480)
FT                   /codon_start=1
FT                   /gene="Ppp1r9a"
FT                   /locus_tag="mCG_141520"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 9A, isoform CRA_b"
FT                   /note="gene_id=mCG141520.0 transcript_id=mCT190725.0
FT                   protein_id=mCP111680.0 isoform=CRA_b"
FT                   /protein_id="EDL13975.1"
FT                   /translation="KQAEVVCPWKWIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNV
FT                   RFVIGREKPGQVSEVAQLISQTLEQERRQRELLERHYAQYDADDDETGEYATDEEEDEG
FT                   GPILPSGDVAIEVFELPENEDMFSPSDLDTSKLSHKFKELQIKHAVTEAEIQKLKTKLQ
FT                   AAENEKVRWELEKNQLQQNIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALE
FT                   KKYNKAKKLIKDFQQKELDFIKRQEVERKKREEVEKAHLLEVQGLQVRIRDLEAEVFRL
FT                   LKQNGTQVNNNNNIFERRPSPGEVSKGDTMENVEVKQTSCQDGLSQDLNEAVPETERLD
FT                   SKALKTRAQLSVKNRRQRPTRTRLYDSVSSTDGEDSLERKVSTLNGWQTLAECRCPPVY
FT                   LLNVIAVLLICALLGRKSPKFVFNCYMVVI"
FT   assembly_gap    1958750..1958769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1995439..1995458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2010764..2010783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2026796..2026815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2045156..2071373)
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /note="gene_id=mCG128293.1"
FT   mRNA            complement(join(2045156..2045657,2048893..2049021,
FT                   2058887..2059013,2062209..2062377,2062761..2062816,
FT                   2064397..2064467,2071129..2071373))
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, transcript variant mCT171491"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT171491.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(2045156..2045657,2048893..2049021,
FT                   2052892..2052973,2058887..2059013,2062209..2062377,
FT                   2062761..2062816,2064397..2064467,2071129..2071373))
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, transcript variant mCT171490"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT171490.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(2045156..2045657,2048893..2049021,
FT                   2052892..2052973,2054360..2054560,2058887..2059013,
FT                   2062209..2062377,2062761..2062816,2064397..2064467,
FT                   2071129..2071373))
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, transcript variant mCT129588"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT129588.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(2045499..2045657,2048893..2049021,
FT                   2052892..2052973,2058887..2059013,2062209..2062377,
FT                   2062761..2062816,2064397..2064467,2071129..2071202))
FT                   /codon_start=1
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, isoform CRA_b"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT171490.0
FT                   protein_id=mCP94410.0 isoform=CRA_b"
FT                   /protein_id="EDL13972.1"
FT                   /translation="MAKLLALTLVGLVLALYKNHRSSYQTRLNAFREVTPVELPNCNLV
FT                   KGIETGAEDLEILPNGLTFFSTGLKYPGIKSFDPSKPGKILLMDLNKKEPAVSELEIIG
FT                   NTLDISSFNPHGISTFTDEDNTVYLLVVNHPDSSSTVEVFKFQEEERSLLHLKTITHEL
FT                   LPRYVYIAELLAHKIHVYEKHANWTLTPLKVLNFDTLVDNISVDPVTGDLWVGCHPNGM
FT                   RIFFYDAENPPGSEVLRIQNILSEDPKITVVYAENGTVLQGTTVASVYKGKLLIGTVFH
FT                   KALYCDL"
FT   CDS             complement(join(2045499..2045657,2048893..2049021,
FT                   2052892..2052973,2054360..2054560,2058887..2059013,
FT                   2062209..2062377,2062761..2062816,2064397..2064467,
FT                   2071129..2071202))
FT                   /codon_start=1
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, isoform CRA_a"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT129588.1
FT                   protein_id=mCP44993.1 isoform=CRA_a"
FT                   /protein_id="EDL13971.1"
FT                   /translation="MAKLLALTLVGLVLALYKNHRSSYQTRLNAFREVTPVELPNCNLV
FT                   KGIETGAEDLEILPNGLTFFSTGLKYPGIKSFDPSKPGKILLMDLNKKEPAVSELEIIG
FT                   NTLDISSFNPHGISTFTDEDNTVYLLVVNHPDSSSTVEVFKFQEEERSLLHLKTITHEL
FT                   LPSINDIAAIGPESFYATNDHYFADPYLRSWEMYLGLSWSNVVYYSPDKVQVVAEGFDF
FT                   ANGIGISLDGKYVYIAELLAHKIHVYEKHANWTLTPLKVLNFDTLVDNISVDPVTGDLW
FT                   VGCHPNGMRIFFYDAENPPGSEVLRIQNILSEDPKITVVYAENGTVLQGTTVASVYKGK
FT                   LLIGTVFHKALYCDL"
FT   CDS             complement(join(2048973..2049021,2058887..2059013,
FT                   2062209..2062377,2062761..2062816,2064397..2064467,
FT                   2071129..2071202))
FT                   /codon_start=1
FT                   /gene="Pon1"
FT                   /locus_tag="mCG_128293"
FT                   /product="paraoxonase 1, isoform CRA_c"
FT                   /note="gene_id=mCG128293.1 transcript_id=mCT171491.0
FT                   protein_id=mCP94409.0 isoform=CRA_c"
FT                   /db_xref="GOA:H3BLB8"
FT                   /db_xref="InterPro:IPR002640"
FT                   /db_xref="InterPro:IPR008363"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="MGI:MGI:103295"
FT                   /db_xref="UniProtKB/TrEMBL:H3BLB8"
FT                   /protein_id="EDL13973.1"
FT                   /translation="MAKLLALTLVGLVLALYKNHRSSYQTRLNAFREVTPVELPNCNLV
FT                   KGIETGAEDLEILPNGLTFFSTGLKYPGIKSFDPSKPGKILLMDLNKKEPAVSELEIIG
FT                   NTLDISSFNPHGISTFTDEDNTVYLLVVNHPDSSSTVEVFKFQEEERSLLHLKTITHEL
FT                   LPRSSTLTPLWITSLWIL"
FT   assembly_gap    2057903..2057922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2061198..2061217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2098128..2134361)
FT                   /gene="Pon3"
FT                   /locus_tag="mCG_6172"
FT                   /note="gene_id=mCG6172.2"
FT   mRNA            complement(join(2098128..2099154,2108156..2108284,
FT                   2108504..2108585,2110079..2110279,2114629..2114755,
FT                   2118574..2118739,2124045..2124100,2132607..2132677,
FT                   2134244..2134361))
FT                   /gene="Pon3"
FT                   /locus_tag="mCG_6172"
FT                   /product="paraoxonase 3, transcript variant mCT5346"
FT                   /note="gene_id=mCG6172.2 transcript_id=mCT5346.1 created on
FT                   06-AUG-2002"
FT   mRNA            complement(join(2098128..2099154,2108156..2108284,
FT                   2108504..2108585,2110079..2110279,2114629..2114755,
FT                   2118574..2118739,2123815..2124100,2132607..2132677,
FT                   2134244..2134361))
FT                   /gene="Pon3"
FT                   /locus_tag="mCG_6172"
FT                   /product="paraoxonase 3, transcript variant mCT171536"
FT                   /note="gene_id=mCG6172.2 transcript_id=mCT171536.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(2098996..2099154,2108156..2108284,
FT                   2108504..2108585,2110079..2110279,2114629..2114755,
FT                   2118574..2118739,2124045..2124100,2132607..2132677,
FT                   2134244..2134317))
FT                   /codon_start=1
FT                   /gene="Pon3"
FT                   /locus_tag="mCG_6172"
FT                   /product="paraoxonase 3, isoform CRA_b"
FT                   /note="gene_id=mCG6172.2 transcript_id=mCT5346.1
FT                   protein_id=mCP11535.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q62087"
FT                   /db_xref="InterPro:IPR002640"
FT                   /db_xref="InterPro:IPR008364"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="MGI:MGI:106686"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62087"
FT                   /protein_id="EDL13970.1"
FT                   /translation="MGKLVALTLLGACLALIGERLLNFRERVSTTREIKATEPQNCHLI
FT                   EGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISG
FT                   GLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELL
FT                   KSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSA
FT                   NGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILA
FT                   GCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRM
FT                   LIGTIFHKALYCDL"
FT   CDS             complement(join(2098996..2099154,2108156..2108284,
FT                   2108504..2108585,2110079..2110279,2114629..2114755,
FT                   2118574..2118721))
FT                   /codon_start=1
FT                   /gene="Pon3"
FT                   /locus_tag="mCG_6172"
FT                   /product="paraoxonase 3, isoform CRA_a"
FT                   /note="gene_id=mCG6172.2 transcript_id=mCT171536.0
FT                   protein_id=mCP94455.0 isoform=CRA_a"
FT                   /protein_id="EDL13969.1"
FT                   /translation="MPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGIST
FT                   FIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQF
FT                   YATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYV
FT                   ADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNP
FT                   EDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL
FT                   "
FT   assembly_gap    2100727..2100746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2131850..2131869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2142833..2176786)
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /note="gene_id=mCG6171.3"
FT   mRNA            complement(join(2142833..2143667,2144298..2144426,
FT                   2145151..2145232,2150516..2150642,2151187..2151352,
FT                   2156086..2156141,2167185..2167255,2176543..2176786))
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, transcript variant mCT178437"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT178437.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(2142833..2143667,2144298..2144426,
FT                   2145151..2145232,2147166..2147366,2150516..2150642,
FT                   2151187..2151352,2156086..2156141,2167185..2167255,
FT                   2176543..2176786))
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, transcript variant mCT5350"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT5350.3 created on
FT                   12-JUN-2003"
FT   CDS             complement(join(2143509..2143667,2144298..2144426,
FT                   2145151..2145232,2150516..2150642,2151187..2151352,
FT                   2156086..2156141,2167185..2167255,2176543..2176616))
FT                   /codon_start=1
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, isoform CRA_b"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT178437.0
FT                   protein_id=mCP101359.0 isoform=CRA_b"
FT                   /protein_id="EDL13966.1"
FT                   /translation="MGRMVALSLLGIGLALLGERFLALRSRLKASREVESVDLPNCHLI
FT                   KGIETGAEDIDILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKDERPRALELRVSW
FT                   GFDLASFNPHGISTFIDDDDTVYLFVVNHPQFKSTVEIFKFQEEENSLLHLKTIKHELL
FT                   PRYVYVADILAHEIHVLEKQPNMNLTQLKVLQLGTLVDNLSIDPSSGDIWVGCHPNGQR
FT                   LFVYHPNHPPASEVLRIQNILSEKPSVTTVYINNGSVLQGSSVATIYDRKLLVGTLYQK
FT                   ALYCEL"
FT   CDS             complement(join(2143509..2143667,2144298..2144426,
FT                   2145151..2145232,2147166..2147366,2150516..2150642,
FT                   2151187..2151352,2156086..2156141,2167185..2167255,
FT                   2176543..2176616))
FT                   /codon_start=1
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, isoform CRA_c"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT5350.3
FT                   protein_id=mCP11531.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q62086"
FT                   /db_xref="InterPro:IPR002640"
FT                   /db_xref="InterPro:IPR008364"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="MGI:MGI:106687"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62086"
FT                   /protein_id="EDL13967.1"
FT                   /translation="MGRMVALSLLGIGLALLGERFLALRSRLKASREVESVDLPNCHLI
FT                   KGIETGAEDIDILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKDERPRALELRVSW
FT                   GFDLASFNPHGISTFIDDDDTVYLFVVNHPQFKSTVEIFKFQEEENSLLHLKTIKHELL
FT                   PSVNDIIAVGPTHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPEEVKLVAEGFDSA
FT                   NGINISPDKKYVYVADILAHEIHVLEKQPNMNLTQLKVLQLGTLVDNLSIDPSSGDIWV
FT                   GCHPNGQRLFVYHPNHPPASEVLRIQNILSEKPSVTTVYINNGSVLQGSSVATIYDRKL
FT                   LVGTLYQKALYCEL"
FT   mRNA            complement(join(2148379..2150642,2151187..2151352,
FT                   2156086..2156141,2167185..2167255,2176543..2176786))
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, transcript variant mCT171535"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT171535.2 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(2150407..2150642,2151187..2151352,
FT                   2156086..2156141,2167185..2167255,2176543..2176616))
FT                   /codon_start=1
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, isoform CRA_a"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT171535.2
FT                   protein_id=mCP94454.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VDG8"
FT                   /db_xref="InterPro:IPR002640"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="MGI:MGI:106687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VDG8"
FT                   /protein_id="EDL13965.1"
FT                   /translation="MGRMVALSLLGIGLALLGERFLALRSRLKASREVESVDLPNCHLI
FT                   KGIETGAEDIDILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKDERPRALELRVSW
FT                   GFDLASFNPHGISTFIDDDDTVYLFVVNHPQFKSTVEIFKFQEEENSLLHLKTIKHELL
FT                   PRYLLSSLFLFFCVLFFSKTYFIFPLLLYKYQFNLLL"
FT   mRNA            complement(join(2151308..2151352,2156086..2156141,
FT                   2156937..2157030,2167185..2167255,2176543..2176786))
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, transcript variant mCT185601"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT185601.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(2157026..2157030,2167185..2167255,
FT                   2176543..2176616))
FT                   /codon_start=1
FT                   /gene="Pon2"
FT                   /locus_tag="mCG_6171"
FT                   /product="paraoxonase 2, isoform CRA_d"
FT                   /note="gene_id=mCG6171.3 transcript_id=mCT185601.0
FT                   protein_id=mCP106859.0 isoform=CRA_d"
FT                   /protein_id="EDL13968.1"
FT                   /translation="MGRMVALSLLGIGLALLGERFLALRSRLKASREVESVDLPNCHLI
FT                   KGIA"
FT   assembly_gap    2173885..2173978
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2174993..2175012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2176076..2176095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2183883..2184212
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    2185195..2185214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2189650..2189669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2194506..2194909
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    2197747..2197766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2232875..2232894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2270562..2313451
FT                   /gene="Asb4"
FT                   /locus_tag="mCG_6177"
FT                   /note="gene_id=mCG6177.2"
FT   mRNA            join(2270562..2271200,2278605..2278904,2303874..2304304,
FT                   2310183..2310296,2311302..2313451)
FT                   /gene="Asb4"
FT                   /locus_tag="mCG_6177"
FT                   /product="ankyrin repeat and SOCS box-containing protein 4"
FT                   /note="gene_id=mCG6177.2 transcript_id=mCT5344.2 created on
FT                   06-AUG-2002"
FT   CDS             join(2271014..2271200,2278605..2278904,2303874..2304304,
FT                   2310183..2310296,2311302..2311490)
FT                   /codon_start=1
FT                   /gene="Asb4"
FT                   /locus_tag="mCG_6177"
FT                   /product="ankyrin repeat and SOCS box-containing protein 4"
FT                   /note="gene_id=mCG6177.2 transcript_id=mCT5344.2
FT                   protein_id=mCP11514.2"
FT                   /protein_id="EDL13964.1"
FT                   /translation="MDGITAPISKAGAAKLVKKDFLEALKTNDFGKLKAILIERQIDVD
FT                   TVFEVEDENMILASYKQGYWLPSYKLKSSWATGLHLSVLLGHVECLMVLLDHNATINCR
FT                   PNGKTPLHVACEIANLECVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVLRA
FT                   HFGLSELVAFYVENGAIVDSMNAHMETPLAIATYWALRFKEQEYSREHHLICRTLLDNN
FT                   AEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRPA
FT                   AQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNIKWRRAIPD
FT                   DDLEKHWDFYHSLFKVCCNTPRTLMHLSRCAIRKALHNRCHKAIPMLSLPLPLKKYLLL
FT                   EPEGIIY"
FT   assembly_gap    2291256..2291275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2298517..2298846
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    2303736..2303859
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    2307419..2307438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2317659..2318648
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   assembly_gap    2342996..2343018
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(2363836..2376755)
FT                   /gene="Pdk4"
FT                   /locus_tag="mCG_6168"
FT                   /note="gene_id=mCG6168.0"
FT   mRNA            complement(join(2363836..2366073,2367159..2367272,
FT                   2367545..2367655,2367860..2367958,2369616..2369692,
FT                   2371551..2371628,2372072..2372158,2372311..2372495,
FT                   2373187..2373258,2375371..2375512,2376510..2376755))
FT                   /gene="Pdk4"
FT                   /locus_tag="mCG_6168"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 4"
FT                   /note="gene_id=mCG6168.0 transcript_id=mCT5349.0 created on
FT                   06-AUG-2002"
FT   CDS             complement(join(2365930..2366073,2367159..2367272,
FT                   2367545..2367655,2367860..2367958,2369616..2369692,
FT                   2371551..2371628,2372072..2372158,2372311..2372495,
FT                   2373187..2373258,2375371..2375512,2376510..2376639))
FT                   /codon_start=1
FT                   /gene="Pdk4"
FT                   /locus_tag="mCG_6168"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 4"
FT                   /note="gene_id=mCG6168.0 transcript_id=mCT5349.0
FT                   protein_id=mCP11520.1"
FT                   /db_xref="GOA:Q544J2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="MGI:MGI:1351481"
FT                   /db_xref="UniProtKB/TrEMBL:Q544J2"
FT                   /protein_id="EDL13963.1"
FT                   /translation="MKAARFVMRSASSLSSASLVPREVELFSRYSPSPLSMKQLLDFGS
FT                   ENACERTSFAFLRQELPVRLANILKEIDILPDRLVNTPSVQLVKSWYIQSLMDLVEFHE
FT                   KSPEDQKALSEFVDTLVKVRNRHHNVVPTMAQGILEYKDTCTVDPVTNQNLQYFLDRFY
FT                   MNRISTRMLMNQHILIFSDSKTGNPSHIGSIDPNCDVVAVVQDAFECAKMLCDQYYLTS
FT                   PELNLTQVNGKFPGQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENRPSLTPVEATVV
FT                   LGKEDLTIKISDRGGGVPLRITDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLY
FT                   AKYFQGDLNLYSMSGYGTDAIIYLKALSSESVEKLPVFNKSAFKHYQMSSEADDWCIPS
FT                   REPKNLAKEKLAV"
FT   assembly_gap    2402918..2403005
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2404030..2404049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2430907..2431156
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    2491718..2492217
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    2497577..2497596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2520570..2520637
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    2527338..2527383
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    2542986..2543005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2544818..2544837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2588413..2588432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2605688..2909817
FT                   /gene="Dync1i1"
FT                   /locus_tag="mCG_140787"
FT                   /note="gene_id=mCG140787.0"
FT   mRNA            join(2605688..2605858,2637301..2637417,2646950..2647064,
FT                   2649621..2649711,2664359..2664418,2680959..2681074,
FT                   2784920..2785009,2793005..2793167,2795519..2795618,
FT                   2802854..2802979,2843690..2843836,2848548..2848661,
FT                   2851219..2851352,2853910..2854054,2888053..2888193,
FT                   2892238..2892363,2909147..2909817)
FT                   /gene="Dync1i1"
FT                   /locus_tag="mCG_140787"
FT                   /product="dynein cytoplasmic 1 intermediate chain 1,
FT                   transcript variant mCT171511"
FT                   /note="gene_id=mCG140787.0 transcript_id=mCT171511.0
FT                   created on 06-AUG-2002"
FT   mRNA            join(2605688..2605858,2637301..2637417,2646950..2647064,
FT                   2649621..2649711,2680959..2681074,2784920..2785009,
FT                   2793005..2793167,2795519..2795618,2802854..2802979,
FT                   2843690..2843836,2848548..2848661,2851219..2851352,
FT                   2853910..2854054,2888053..2888193,2892238..2892363,
FT                   2909147..2909817)
FT                   /gene="Dync1i1"
FT                   /locus_tag="mCG_140787"
FT                   /product="dynein cytoplasmic 1 intermediate chain 1,
FT                   transcript variant mCT171512"
FT                   /note="gene_id=mCG140787.0 transcript_id=mCT171512.0
FT                   created on 06-AUG-2002"
FT   CDS             join(2637310..2637417,2646950..2647064,2649621..2649711,
FT                   2664359..2664418,2680959..2681074,2784920..2785009,
FT                   2793005..2793167,2795519..2795618,2802854..2802979,
FT                   2843690..2843836,2848548..2848661,2851219..2851352,
FT                   2853910..2854054,2888053..2888193,2892238..2892363,
FT                   2909147..2909257)
FT                   /codon_start=1
FT                   /gene="Dync1i1"
FT                   /locus_tag="mCG_140787"
FT                   /product="dynein cytoplasmic 1 intermediate chain 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140787.0 transcript_id=mCT171511.0
FT                   protein_id=mCP94430.0 isoform=CRA_b"
FT                   /db_xref="GOA:O88485"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR025956"
FT                   /db_xref="MGI:MGI:107743"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88485"
FT                   /protein_id="EDL13960.1"
FT                   /translation="MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEP
FT                   VQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSDAGSQDSGDLGPLT
FT                   RTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
FT                   EDEEDEEMVEPKIGHDSELENQEKKQETKEAPPRELTEEEKQQILHSEEFLIFFDRTIR
FT                   VIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQ
FT                   YPELMVASYSNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVV
FT                   GGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMC
FT                   SWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAG
FT                   IGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADY
FT                   VYDVMWSPVHPALFACVDGMGRLDLWNLNSDTEVPTASVAIEGASALNRVRWAQGGKEV
FT                   AVGDSEGRIWIYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGAVELAA"
FT   CDS             join(2637310..2637417,2646950..2647064,2649621..2649711,
FT                   2680959..2681074,2784920..2785009,2793005..2793167,
FT                   2795519..2795618,2802854..2802979,2843690..2843836,
FT                   2848548..2848661,2851219..2851352,2853910..2854054,
FT                   2888053..2888193,2892238..2892363,2909147..2909257)
FT                   /codon_start=1
FT                   /gene="Dync1i1"
FT                   /locus_tag="mCG_140787"
FT                   /product="dynein cytoplasmic 1 intermediate chain 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140787.0 transcript_id=mCT171512.0
FT                   protein_id=mCP94431.0 isoform=CRA_a"
FT                   /protein_id="EDL13959.1"
FT                   /translation="MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEP
FT                   VQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSDAGSQDSGDLGPLT
FT                   RRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKIGHDSELE
FT                   NQEKKQETKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRE
FT                   LEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYSNNEDAPHEPD
FT                   GVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTP
FT                   VQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNK
FT                   SKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMA
FT                   VGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGM
FT                   GRLDLWNLNSDTEVPTASVAIEGASALNRVRWAQGGKEVAVGDSEGRIWIYDVGELAVP
FT                   HNDEWTRFARTLVEIRANRADSEEEGAVELAA"
FT   assembly_gap    2667295..2667314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2746948..2746967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2777572..2777591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2788147..2788305
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(2834650..2837736)
FT                   /locus_tag="mCG_147478"
FT                   /note="gene_id=mCG147478.0"
FT   mRNA            complement(join(2834650..2834719,2834743..2837736))
FT                   /locus_tag="mCG_147478"
FT                   /product="mCG147478"
FT                   /note="gene_id=mCG147478.0 transcript_id=mCT187741.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2836426..2836710)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147478"
FT                   /product="mCG147478"
FT                   /note="gene_id=mCG147478.0 transcript_id=mCT187741.0
FT                   protein_id=mCP108232.0"
FT                   /protein_id="EDL13962.1"
FT                   /translation="MWSRTPKLMLPPEKVTHPHPLFQKNCLFCPFHGWMEGGGRRTPRG
FT                   GVSSLSISLHSQPTTAFSSVSPSSSSSGCGDCFTFCRANLGQLRDQTPP"
FT   assembly_gap    2838111..2838130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2839134..2839153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2840333..2840352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2845749..>2859206)
FT                   /locus_tag="mCG_126398"
FT                   /note="gene_id=mCG126398.0"
FT   mRNA            complement(join(2845749..2846020,2850975..2851112,
FT                   2859137..>2859206))
FT                   /locus_tag="mCG_126398"
FT                   /product="mCG126398"
FT                   /note="gene_id=mCG126398.0 transcript_id=mCT127666.1
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(2845999..2846020,2850975..2851112,
FT                   2859137..>2859204))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126398"
FT                   /product="mCG126398"
FT                   /note="gene_id=mCG126398.0 transcript_id=mCT127666.1
FT                   protein_id=mCP44836.1"
FT                   /protein_id="EDL13961.1"
FT                   /translation="VSAKRLTLLGQQLFVIVCAFSKHATKDPHCARSQTQLPLTSRPLC
FT                   ISGFRPTGFHQHGPLLPQAVRDDRKDSSGM"
FT   assembly_gap    2859980..2860787
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   gene            complement(2922856..>3099550)
FT                   /gene="Slc25a13"
FT                   /locus_tag="mCG_126393"
FT                   /note="gene_id=mCG126393.0"
FT   mRNA            complement(join(2922856..2923969,2924196..2924286,
FT                   2924378..2924536,2934394..2934532,2955029..2955169,
FT                   2976774..2976854,2978297..2978349,2990805..2990963,
FT                   2991561..2991648,2995562..2995646,2995849..2995942,
FT                   2996594..2996732,2998723..2998869,3013171..3013311,
FT                   3063388..3063532,3073675..3073728,3099428..>3099550))
FT                   /gene="Slc25a13"
FT                   /locus_tag="mCG_126393"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   adenine nucleotide translocator), member 13"
FT                   /note="gene_id=mCG126393.0 transcript_id=mCT127661.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(2923783..2923969,2924196..2924286,
FT                   2924378..2924536,2934394..2934532,2955029..2955169,
FT                   2976774..2976854,2978297..2978349,2990805..2990963,
FT                   2991561..2991648,2995562..2995646,2995849..2995942,
FT                   2996594..2996732,2998723..2998869,3013171..>3013311))
FT                   /codon_start=1
FT                   /gene="Slc25a13"
FT                   /locus_tag="mCG_126393"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   adenine nucleotide translocator), member 13"
FT                   /note="gene_id=mCG126393.0 transcript_id=mCT127661.0
FT                   protein_id=mCP44794.1"
FT                   /protein_id="EDL13958.1"
FT                   /translation="EDVKQIFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQF
FT                   LLEIQLEHAKQAFVQRDNAKTGKVSAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTRSH
FT                   QVSFSYFNGFNSLLNNMELIRKIYSTLAGNRKDVEVTKEEFALAAQKFGQVTPMEVDIL
FT                   FQLADLYEPRGRMTLADIERIAPLEEGMLPFNLAEAQRQQKASGDAARPFLLQLAESAY
FT                   RFGLGSIAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFG
FT                   LYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNP
FT                   LEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHV
FT                   KASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYNGVTDCF
FT                   RKILREEGPKALWKGVAARVFRSSPQFGVTLLTYELLQRWFYVDFGGVKPVGSEPVPKS
FT                   RITLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSASTSKVTAGDS"
FT   assembly_gap    3008090..3008109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3033588..3034303
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    3059785..3059804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3083922..3084000
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    3087864..3087904
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3106271..3106290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3132546..3132733
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3140885..3140904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3157730..3158294
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    3165738..3165757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3212916..3213438)
FT                   /pseudo
FT                   /locus_tag="mCG_19084"
FT                   /note="gene_id=mCG19084.2"
FT   mRNA            complement(3212916..3213438)
FT                   /pseudo
FT                   /locus_tag="mCG_19084"
FT                   /note="gene_id=mCG19084.2 transcript_id=mCT17196.2 created
FT                   on 15-NOV-2002"
FT   gene            complement(3233795..3235460)
FT                   /pseudo
FT                   /locus_tag="mCG_19083"
FT                   /note="gene_id=mCG19083.2"
FT   mRNA            complement(3233795..3235460)
FT                   /pseudo
FT                   /locus_tag="mCG_19083"
FT                   /note="gene_id=mCG19083.2 transcript_id=mCT17195.2 created
FT                   on 15-NOV-2002"
FT   assembly_gap    3271119..3271138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3284321..3284806
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    3322604..3322623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3364554..3364596
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3367750..3367795
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3372307..3372908
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    3373691..3378343
FT                   /estimated_length=4653
FT                   /gap_type="unknown"
FT   assembly_gap    3380815..3380834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3383299..3386134
FT                   /estimated_length=2836
FT                   /gap_type="unknown"
FT   assembly_gap    3395222..3395246
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3428046..3428065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3434125..3434217
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(3441470..3462139)
FT                   /gene="Shfm1"
FT                   /locus_tag="mCG_19082"
FT                   /note="gene_id=mCG19082.2"
FT   mRNA            complement(join(3441470..3441927,3443848..3443941,
FT                   3461974..3462139))
FT                   /gene="Shfm1"
FT                   /locus_tag="mCG_19082"
FT                   /product="split hand/foot malformation (ectrodactyly) type
FT                   1"
FT                   /note="gene_id=mCG19082.2 transcript_id=mCT17194.2 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(3441885..3441927,3443848..3443941,
FT                   3461974..3462049))
FT                   /codon_start=1
FT                   /gene="Shfm1"
FT                   /locus_tag="mCG_19082"
FT                   /product="split hand/foot malformation (ectrodactyly) type
FT                   1"
FT                   /note="gene_id=mCG19082.2 transcript_id=mCT17194.2
FT                   protein_id=mCP11506.1"
FT                   /db_xref="GOA:Q3TV35"
FT                   /db_xref="InterPro:IPR007834"
FT                   /db_xref="MGI:MGI:109238"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TV35"
FT                   /protein_id="EDL13957.1"
FT                   /translation="MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDD
FT                   DNVEDDFSNQLRAELEKHGYKMETS"
FT   assembly_gap    3507382..3508666
FT                   /estimated_length=1285
FT                   /gap_type="unknown"
FT   assembly_gap    3509846..3509865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3527887..3529321
FT                   /estimated_length=1435
FT                   /gap_type="unknown"
FT   assembly_gap    3544716..3544735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3568352..3568371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3571284..3571303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3583328..3583347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3605778..3606008
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   gene            complement(3613496..3614562)
FT                   /pseudo
FT                   /locus_tag="mCG_19081"
FT                   /note="gene_id=mCG19081.1"
FT   mRNA            complement(3613496..3614562)
FT                   /pseudo
FT                   /locus_tag="mCG_19081"
FT                   /note="gene_id=mCG19081.1 transcript_id=mCT17193.1 created
FT                   on 14-NOV-2002"
FT   assembly_gap    3625997..3626496
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    3648736..3648755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3665859..3665948
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    3667025..3667044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3696039..3696405
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   gene            complement(3701399..>3746545)
FT                   /locus_tag="mCG_19080"
FT                   /note="gene_id=mCG19080.2"
FT   mRNA            complement(join(3701399..3701995,3746323..>3746545))
FT                   /locus_tag="mCG_19080"
FT                   /product="mCG19080, transcript variant mCT175772"
FT                   /note="gene_id=mCG19080.2 transcript_id=mCT175772.0 created
FT                   on 14-NOV-2002"
FT   mRNA            complement(join(3701399..3701995,3738727..>3738806))
FT                   /locus_tag="mCG_19080"
FT                   /product="mCG19080, transcript variant mCT17192"
FT                   /note="gene_id=mCG19080.2 transcript_id=mCT17192.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(3701761..3701995,3738727..>3738806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19080"
FT                   /product="mCG19080, isoform CRA_b"
FT                   /note="gene_id=mCG19080.2 transcript_id=mCT17192.2
FT                   protein_id=mCP11498.2 isoform=CRA_b"
FT                   /protein_id="EDL13954.1"
FT                   /translation="GSPDSLGPSCGAGTAELRRPRSGPATRTREKPTPRRTCPWIAFPL
FT                   LWSVLNTGPWTPTSRRLHGWLSSLMSHSFPSTFSSLQRGSYQGQIRDEPAGRQIGALTS
FT                   "
FT   CDS             complement(join(3701798..3701995,3746323..>3746373))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19080"
FT                   /product="mCG19080, isoform CRA_a"
FT                   /note="gene_id=mCG19080.2 transcript_id=mCT175772.0
FT                   protein_id=mCP98694.0 isoform=CRA_a"
FT                   /protein_id="EDL13953.1"
FT                   /translation="RLTERGSCSTKKGTGILNQRETYAQKNMSLDCFPTAVECLEHWSL
FT                   DTNFKKTSWMAVQSYEPQFPLYIFFTPARLLSGSDQR"
FT   assembly_gap    3709102..3709162
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    3717489..3717508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3723419..3733490
FT                   /locus_tag="mCG_145208"
FT                   /note="gene_id=mCG145208.0"
FT   mRNA            join(<3723419..3723428,3723473..3723489,3731481..3733490)
FT                   /locus_tag="mCG_145208"
FT                   /product="mCG145208"
FT                   /note="gene_id=mCG145208.0 transcript_id=mCT184632.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    3724214..3724233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3731078..3731107
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   CDS             <3731964..3732302
FT                   /codon_start=1
FT                   /locus_tag="mCG_145208"
FT                   /product="mCG145208"
FT                   /note="gene_id=mCG145208.0 transcript_id=mCT184632.0
FT                   protein_id=mCP105352.0"
FT                   /protein_id="EDL13956.1"
FT                   /translation="ALHHYILGACTLPPHSMQRKRALLPSLGGRADVSSPSQDASFYSR
FT                   TELRSGSPQNSSFPNNSLWNQPILTGSAGFESKTWCARSGCDESTGEGRKAPFFQVIGT
FT                   QEPKAGRG"
FT   assembly_gap    3736243..3736288
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3740301..3740634
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   gene            <3740734..3744320
FT                   /locus_tag="mCG_49129"
FT                   /note="gene_id=mCG49129.2"
FT   mRNA            join(<3740734..3740815,3742066..3742259,3744029..3744320)
FT                   /locus_tag="mCG_49129"
FT                   /product="mCG49129"
FT                   /note="gene_id=mCG49129.2 transcript_id=mCT49312.2 created
FT                   on 07-NOV-2002"
FT   CDS             join(3740734..3740815,3742066..3742259,3744029..3744280)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49129"
FT                   /product="mCG49129"
FT                   /note="gene_id=mCG49129.2 transcript_id=mCT49312.2
FT                   protein_id=mCP33292.1"
FT                   /protein_id="EDL13955.1"
FT                   /translation="MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGK
FT                   GKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKF
FT                   KKLLKQGSNPHESDPLPGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSS
FT                   PHQDTMQRPQMM"
FT   assembly_gap    3744744..3745084
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    3747781..3747800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3754782..3759046)
FT                   /gene="Dlx5"
FT                   /locus_tag="mCG_6149"
FT                   /note="gene_id=mCG6149.2"
FT   mRNA            complement(join(3754782..3755466,3756504..3756606,
FT                   3758510..3759046))
FT                   /gene="Dlx5"
FT                   /locus_tag="mCG_6149"
FT                   /product="distal-less homeobox 5, transcript variant
FT                   mCT5432"
FT                   /note="gene_id=mCG6149.2 transcript_id=mCT5432.2 created on
FT                   06-AUG-2002"
FT   mRNA            complement(join(3754782..3755466,3756504..3756688,
FT                   3758510..3759046))
FT                   /gene="Dlx5"
FT                   /locus_tag="mCG_6149"
FT                   /product="distal-less homeobox 5, transcript variant
FT                   mCT171534"
FT                   /note="gene_id=mCG6149.2 transcript_id=mCT171534.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(3755137..3755466,3756504..3756688,
FT                   3758510..3758864))
FT                   /codon_start=1
FT                   /gene="Dlx5"
FT                   /locus_tag="mCG_6149"
FT                   /product="distal-less homeobox 5, isoform CRA_a"
FT                   /note="gene_id=mCG6149.2 transcript_id=mCT171534.0
FT                   protein_id=mCP94453.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TYA7"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="InterPro:IPR022135"
FT                   /db_xref="MGI:MGI:101926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYA7"
FT                   /protein_id="EDL13951.1"
FT                   /translation="MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDS
FT                   DYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQY
FT                   GGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLA
FT                   LPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPA
FT                   VWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPL
FT                   ALASGTLY"
FT   CDS             complement(join(3756521..3756606,3758510..3758864))
FT                   /codon_start=1
FT                   /gene="Dlx5"
FT                   /locus_tag="mCG_6149"
FT                   /product="distal-less homeobox 5, isoform CRA_b"
FT                   /note="gene_id=mCG6149.2 transcript_id=mCT5432.2
FT                   protein_id=mCP11536.2 isoform=CRA_b"
FT                   /protein_id="EDL13952.1"
FT                   /translation="MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDS
FT                   DYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQY
FT                   GGAYNRVPSATSQPAFSWPLYREGFRRLSTSPCQNARSWPPL"
FT   assembly_gap    3759146..3759274
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    3772651..3772740
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    3778578..3778597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3779651..3780301
FT                   /pseudo
FT                   /locus_tag="mCG_1029480"
FT                   /note="gene_id=mCG1029480.1"
FT   mRNA            3779651..3780301
FT                   /pseudo
FT                   /locus_tag="mCG_1029480"
FT                   /note="gene_id=mCG1029480.1 transcript_id=mCT147184.1
FT                   created on 07-NOV-2002"
FT   assembly_gap    3785068..3785087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3787821..3787874
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3790212..3790306
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    3790714..3791424
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    3792998..3793017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3794349..3796626
FT                   /estimated_length=2278
FT                   /gap_type="unknown"
FT   assembly_gap    3798212..3798231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3820300..3820319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3822882..3822950
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            3841115..3913076
FT                   /locus_tag="mCG_6150"
FT                   /note="gene_id=mCG6150.2"
FT   mRNA            join(3841115..3841309,3912512..3913076)
FT                   /locus_tag="mCG_6150"
FT                   /product="mCG6150, transcript variant mCT5433"
FT                   /note="gene_id=mCG6150.2 transcript_id=mCT5433.2 created on
FT                   07-NOV-2002"
FT   mRNA            join(3841115..3841309,3842106..3842239,3852636..3853273)
FT                   /locus_tag="mCG_6150"
FT                   /product="mCG6150, transcript variant mCT175589"
FT                   /note="gene_id=mCG6150.2 transcript_id=mCT175589.0 created
FT                   on 07-NOV-2002"
FT   CDS             join(3841136..3841309,3912512..3912715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6150"
FT                   /product="mCG6150, isoform CRA_a"
FT                   /note="gene_id=mCG6150.2 transcript_id=mCT5433.2
FT                   protein_id=mCP11500.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VF92"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="MGI:MGI:1913288"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VF92"
FT                   /protein_id="EDL13949.1"
FT                   /translation="MPGKHVSRVRALYRRILLLHRALPPDLKALGDQYVKDEFRRHKTV
FT                   GPGEAQRFLKEWETYAAVLWQQAEDSRQSSTGKACFGTSLPEEKLNDFRDEQIGQLQEL
FT                   MQEATKPNRQFSITESTKPQL"
FT   CDS             join(3841136..3841309,3842106..3842186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6150"
FT                   /product="mCG6150, isoform CRA_b"
FT                   /note="gene_id=mCG6150.2 transcript_id=mCT175589.0
FT                   protein_id=mCP98511.0 isoform=CRA_b"
FT                   /protein_id="EDL13950.1"
FT                   /translation="MPGKHVSRVRALYRRILLLHRALPPDLKALGDQYVKDEFRRHKTV
FT                   GPGEAQRFLKEWENEGGERVLHDVEESCRISSHLENIRR"
FT   assembly_gap    3868980..3870083
FT                   /estimated_length=1104
FT                   /gap_type="unknown"
FT   assembly_gap    3871006..3871490
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    3872778..3872797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3873894..3873913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3879991..3880010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3884366..3889038
FT                   /estimated_length=4673
FT                   /gap_type="unknown"
FT   assembly_gap    3890294..3890313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3891863..3891882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3901339..3901386
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3902875..3904174
FT                   /estimated_length=1300
FT                   /gap_type="unknown"
FT   assembly_gap    3921472..3921491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3956402..3956499
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    3974325..3974687
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    3990775..3990993
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    4005633..4005652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4006704..4006768
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    4011159..4011457
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    4026132..4027099
FT                   /estimated_length=968
FT                   /gap_type="unknown"
FT   assembly_gap    4034870..4034889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4065264..4066217)
FT                   /pseudo
FT                   /locus_tag="mCG_1029551"
FT                   /note="gene_id=mCG1029551.1"
FT   mRNA            complement(join(4065264..4065831,4065932..4066217))
FT                   /pseudo
FT                   /locus_tag="mCG_1029551"
FT                   /note="gene_id=mCG1029551.1 transcript_id=mCT147255.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    4079903..4080088
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    4085837..4085976
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4097474..4098530
FT                   /estimated_length=1057
FT                   /gap_type="unknown"
FT   assembly_gap    4124511..4124651
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            4173543..4180243
FT                   /locus_tag="mCG_62440"
FT                   /note="gene_id=mCG62440.2"
FT   mRNA            join(4173543..4173577,4174949..4175076,4179793..4180243)
FT                   /locus_tag="mCG_62440"
FT                   /product="mCG62440, transcript variant mCT62623"
FT                   /note="gene_id=mCG62440.2 transcript_id=mCT62623.2 created
FT                   on 14-NOV-2002"
FT   mRNA            join(4173543..4173577,4174949..4175076,4176335..4176766)
FT                   /locus_tag="mCG_62440"
FT                   /product="mCG62440, transcript variant mCT175785"
FT                   /note="gene_id=mCG62440.2 transcript_id=mCT175785.0 created
FT                   on 14-NOV-2002"
FT   CDS             4176551..4176706
FT                   /codon_start=1
FT                   /locus_tag="mCG_62440"
FT                   /product="mCG62440, isoform CRA_a"
FT                   /note="gene_id=mCG62440.2 transcript_id=mCT175785.0
FT                   protein_id=mCP98707.0 isoform=CRA_a"
FT                   /protein_id="EDL13947.1"
FT                   /translation="MLSISVNIGTRFSFFPPLKFASWCVSWWESLVYDILLPGCHFLKY
FT                   RIVEGL"
FT   CDS             4179975..4180145
FT                   /codon_start=1
FT                   /locus_tag="mCG_62440"
FT                   /product="mCG62440, isoform CRA_b"
FT                   /note="gene_id=mCG62440.2 transcript_id=mCT62623.2
FT                   protein_id=mCP33288.2 isoform=CRA_b"
FT                   /protein_id="EDL13948.1"
FT                   /translation="MYILHMQTVLPIIPIWDTMKSPERVIDQLRLSHSSPKSIFCMSEK
FT                   KIVLSNNGFDN"
FT   assembly_gap    4206610..4210672
FT                   /estimated_length=4063
FT                   /gap_type="unknown"
FT   assembly_gap    4256697..4257210
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    4271994..4272013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4303119..4303138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4323950..4324125
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    4350680..4356225
FT                   /estimated_length=5546
FT                   /gap_type="unknown"
FT   assembly_gap    4367634..4367840
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    4413141..4413216
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4414872..4414927
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            4424143..4432044
FT                   /gene="Tac1"
FT                   /locus_tag="mCG_6148"
FT                   /note="gene_id=mCG6148.2"
FT   mRNA            join(4424143..4424235,4424679..4424810,4425758..4425854,
FT                   4426290..4426334,4426791..4426814,4428170..4428223,
FT                   4431454..4432044)
FT                   /gene="Tac1"
FT                   /locus_tag="mCG_6148"
FT                   /product="tachykinin 1, transcript variant mCT5431"
FT                   /note="gene_id=mCG6148.2 transcript_id=mCT5431.1 created on
FT                   06-AUG-2002"
FT   mRNA            join(4424143..4424235,4424679..4424810,4425758..4425854,
FT                   4426791..4426814,4428170..4428223,4431454..4432044)
FT                   /gene="Tac1"
FT                   /locus_tag="mCG_6148"
FT                   /product="tachykinin 1, transcript variant mCT171533"
FT                   /note="gene_id=mCG6148.2 transcript_id=mCT171533.0 created
FT                   on 06-AUG-2002"
FT   CDS             join(4424688..4424810,4425758..4425854,4426290..4426334,
FT                   4426791..4426814,4428170..4428223,4431454..4431503)
FT                   /codon_start=1
FT                   /gene="Tac1"
FT                   /locus_tag="mCG_6148"
FT                   /product="tachykinin 1, isoform CRA_b"
FT                   /note="gene_id=mCG6148.2 transcript_id=mCT5431.1
FT                   protein_id=mCP11529.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q149W7"
FT                   /db_xref="InterPro:IPR008215"
FT                   /db_xref="InterPro:IPR008216"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="MGI:MGI:98474"
FT                   /db_xref="UniProtKB/TrEMBL:Q149W7"
FT                   /protein_id="EDL13946.1"
FT                   /translation="MKILVAVAVFFLVSTQLFAEEIDANDDLNYWSDWSDSDQIKEAMP
FT                   EPFEHLLQRIARRPKPQQFFGLMGKRDADSSVEKQVALLKALYGHGQISHKRHKTDSFV
FT                   GLMGKRALNSVAYERSAMQNYERRRK"
FT   CDS             join(4424688..4424810,4425758..4425854,4426791..4426814,
FT                   4428170..4428223,4431454..4431503)
FT                   /codon_start=1
FT                   /gene="Tac1"
FT                   /locus_tag="mCG_6148"
FT                   /product="tachykinin 1, isoform CRA_a"
FT                   /note="gene_id=mCG6148.2 transcript_id=mCT171533.0
FT                   protein_id=mCP94452.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZMQ2"
FT                   /db_xref="InterPro:IPR008215"
FT                   /db_xref="InterPro:IPR008216"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="MGI:MGI:98474"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZMQ2"
FT                   /protein_id="EDL13945.1"
FT                   /translation="MKILVAVAVFFLVSTQLFAEEIDANDDLNYWSDWSDSDQIKEAMP
FT                   EPFEHLLQRIARRPKPQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYER
FT                   SAMQNYERRRK"
FT   assembly_gap    4454042..4454061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4455794..4456864
FT                   /estimated_length=1071
FT                   /gap_type="unknown"
FT   assembly_gap    4498383..4498402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500093..4500732
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    4514179..4514198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4515401..4515420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4534619..4534990
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    4535651..4535670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4546237..4567632)
FT                   /gene="Asns"
FT                   /locus_tag="mCG_6152"
FT                   /note="gene_id=mCG6152.2"
FT   mRNA            complement(join(4546237..4546596,4547065..4547220,
FT                   4547307..4547388,4548303..4548403,4549012..4549118,
FT                   4551157..4551283,4552322..4552449,4553008..4553109,
FT                   4553345..4553530,4556243..4556480,4563599..4563870,
FT                   4567456..4567632))
FT                   /gene="Asns"
FT                   /locus_tag="mCG_6152"
FT                   /product="asparagine synthetase, transcript variant
FT                   mCT175782"
FT                   /note="gene_id=mCG6152.2 transcript_id=mCT175782.0 created
FT                   on 14-NOV-2002"
FT   mRNA            complement(join(4546237..4546596,4547065..4547220,
FT                   4547307..4547388,4548303..4548403,4549012..4549118,
FT                   4551157..4551283,4552322..4552449,4553008..4553109,
FT                   4553345..4553530,4556243..4556480,4563599..4563870,
FT                   4567244..4567452))
FT                   /gene="Asns"
FT                   /locus_tag="mCG_6152"
FT                   /product="asparagine synthetase, transcript variant
FT                   mCT5430"
FT                   /note="gene_id=mCG6152.2 transcript_id=mCT5430.2 created on
FT                   14-NOV-2002"
FT   CDS             complement(join(4546387..4546596,4547065..4547220,
FT                   4547307..4547388,4548303..4548403,4549012..4549118,
FT                   4551157..4551283,4552322..4552449,4553008..4553109,
FT                   4553345..4553530,4556243..4556480,4563599..4563847))
FT                   /codon_start=1
FT                   /gene="Asns"
FT                   /locus_tag="mCG_6152"
FT                   /product="asparagine synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG6152.2 transcript_id=mCT175782.0
FT                   protein_id=mCP98704.0 isoform=CRA_a"
FT                   /protein_id="EDL13943.1"
FT                   /translation="MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCF
FT                   GFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHL
FT                   YDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG
FT                   LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKL
FT                   FPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQY
FT                   PLQTFAIGMEDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVR
FT                   ASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYL
FT                   FDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLL
FT                   PKEILWRPKEAFSDGITSVKNSWFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYF
FT                   YRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSAAKA"
FT   CDS             complement(join(4546387..4546596,4547065..4547220,
FT                   4547307..4547388,4548303..4548403,4549012..4549118,
FT                   4551157..4551283,4552322..4552449,4553008..4553109,
FT                   4553345..4553530,4556243..4556480,4563599..4563847))
FT                   /codon_start=1
FT                   /gene="Asns"
FT                   /locus_tag="mCG_6152"
FT                   /product="asparagine synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG6152.2 transcript_id=mCT5430.2
FT                   protein_id=mCP11507.2 isoform=CRA_a"
FT                   /protein_id="EDL13944.1"
FT                   /translation="MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCF
FT                   GFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHL
FT                   YDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKG
FT                   LVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKL
FT                   FPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQY
FT                   PLQTFAIGMEDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVR
FT                   ASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYL
FT                   FDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLL
FT                   PKEILWRPKEAFSDGITSVKNSWFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYF
FT                   YRQIFERHYPGRADWLTHYWMPKWINATDPSARTLTHYKSAAKA"
FT   assembly_gap    4559303..4559322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4562350..4562369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4575968..4575987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4640110..4653054
FT                   /locus_tag="mCG_147469"
FT                   /note="gene_id=mCG147469.0"
FT   mRNA            join(4640110..4640160,4652635..4653054)
FT                   /locus_tag="mCG_147469"
FT                   /product="mCG147469"
FT                   /note="gene_id=mCG147469.0 transcript_id=mCT187732.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4649613..4649991
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   CDS             4652861..4652962
FT                   /codon_start=1
FT                   /locus_tag="mCG_147469"
FT                   /product="mCG147469"
FT                   /note="gene_id=mCG147469.0 transcript_id=mCT187732.0
FT                   protein_id=mCP108215.0"
FT                   /protein_id="EDL13942.1"
FT                   /translation="MEAATDEWTSLRRWQGRRECCLQEEGALPAPLC"
FT   assembly_gap    4663981..4664000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4666927..4666946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4668088..4668107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4669337..4671728
FT                   /estimated_length=2392
FT                   /gap_type="unknown"
FT   assembly_gap    4685706..4685725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4700628..4701208
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    4712241..4712314
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   gene            4718562..4749020
FT                   /gene="C1galt1"
FT                   /locus_tag="mCG_6151"
FT                   /note="gene_id=mCG6151.2"
FT   mRNA            join(4718562..4718731,4737243..4737479,4739714..4740381,
FT                   4744392..4749020)
FT                   /gene="C1galt1"
FT                   /locus_tag="mCG_6151"
FT                   /product="core 1
FT                   UDP-galactose:N-acetylgalactosamine-alpha-R beta
FT                   1,3-galactosyltransferase"
FT                   /note="gene_id=mCG6151.2 transcript_id=mCT5434.2 created on
FT                   06-AUG-2002"
FT   CDS             join(4737260..4737479,4739714..4740381,4744392..4744595)
FT                   /codon_start=1
FT                   /gene="C1galt1"
FT                   /locus_tag="mCG_6151"
FT                   /product="core 1
FT                   UDP-galactose:N-acetylgalactosamine-alpha-R beta
FT                   1,3-galactosyltransferase"
FT                   /note="gene_id=mCG6151.2 transcript_id=mCT5434.2
FT                   protein_id=mCP11505.1"
FT                   /protein_id="EDL13941.1"
FT                   /translation="MASKSWLNFLVFLCGSAIGFFLCSQLLSILLREEAAIQPNMLHND
FT                   PHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKA
FT                   KHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDAD
FT                   WFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRR
FT                   FVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLP
FT                   KTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALP
FT                   ENILKEINQVNRKEDTKIKLGNP"
FT   assembly_gap    4785594..4785613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4791309..4791328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4793031..4793050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4794193..4794212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4799762..4806526
FT                   /estimated_length=6765
FT                   /gap_type="unknown"
FT   assembly_gap    4811174..4811242
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    4813707..4815880
FT                   /estimated_length=2174
FT                   /gap_type="unknown"
FT   assembly_gap    4833165..4833184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4834116..4836619
FT                   /estimated_length=2504
FT                   /gap_type="unknown"
FT   gene            complement(4855539..4857228)
FT                   /pseudo
FT                   /locus_tag="mCG_125775"
FT                   /note="gene_id=mCG125775.1"
FT   mRNA            complement(4855539..4857228)
FT                   /pseudo
FT                   /locus_tag="mCG_125775"
FT                   /note="gene_id=mCG125775.1 transcript_id=mCT127038.1
FT                   created on 14-NOV-2002"
FT   assembly_gap    4860516..4860535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4873212..>4888826)
FT                   /locus_tag="mCG_48880"
FT                   /note="gene_id=mCG48880.1"
FT   mRNA            complement(join(<4873212..4873254,4886747..4886904,
FT                   4888278..>4888826))
FT                   /locus_tag="mCG_48880"
FT                   /product="mCG48880"
FT                   /note="gene_id=mCG48880.1 transcript_id=mCT49063.1 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(<4873212..4873254,4886747..4886904,
FT                   4888278..>4888824))
FT                   /codon_start=1
FT                   /locus_tag="mCG_48880"
FT                   /product="mCG48880"
FT                   /note="gene_id=mCG48880.1 transcript_id=mCT49063.1
FT                   protein_id=mCP35810.1"
FT                   /protein_id="EDL13940.1"
FT                   /translation="CGPKCKETPLELVFVIDSSESVGPENFQIIQSFVKTLADRVALDL
FT                   GTARIGIINYSHKVEKVASLKQFSSKDDFKLVVDNMQYLGEGTYTATALQAANDMFKEA
FT                   RPGVKKVALVITDGQTDSRDKKKLADVVKDANDSNVEIFVIGVVKKDDPNFEIFHKEMN
FT                   LIATDAEHVYQFDDFFTLQDTLKQKLSKKICEDFDSYLIQVFGSPSFQPEFGVSEREVS
FT                   VSTPKPAKEMSKSFNVSRGQNEETESY"
FT   assembly_gap    4936389..4936408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4937588..4937607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4939978..4939997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4951797..4951816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4958507..4959358
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   assembly_gap    4964747..4964766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4966408..4966427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4984284..4984303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4996401..4996422
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    4998473..4998748
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    5001550..5001607
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    5003509..5003969
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    5005306..5005549
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    5011173..5011261
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    5037256..5038610
FT                   /estimated_length=1355
FT                   /gap_type="unknown"
FT   assembly_gap    5065008..5065027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5082064..5109336
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /note="gene_id=mCG2775.2"
FT   mRNA            join(5082064..5082246,5084415..5084473,5087601..5088948,
FT                   5089215..5089305,5095296..5095550,5097384..5097553,
FT                   5099674..5099739,5100799..5100957,5103991..5104143,
FT                   5105881..5106085,5107063..5107192,5108216..5109336)
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, transcript variant
FT                   mCT2134"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT2134.2 created on
FT                   14-NOV-2002"
FT   mRNA            join(5082064..5082246,5084415..5084473,5087601..5088948,
FT                   5089215..5089305,5097384..5097553,5099674..5099739,
FT                   5100799..5100957,5103991..5104143,5105881..5106085,
FT                   5107063..5107192,5108216..5109336)
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, transcript variant
FT                   mCT175774"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT175774.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(<5082064..5082246,5084415..5084473,5087601..5088934,
FT                   5089207..5089305,5095296..5095550,5097384..5097553,
FT                   5099674..5099739,5100799..5100957,5103991..5104143,
FT                   5105881..5106085,5107063..5107192,5108216..5109102)
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, transcript variant
FT                   mCT190722"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT190722.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5087614..5088934,5089207..5089305,5095296..5095550,
FT                   5097384..5097553,5099674..5099739,5100799..5100957,
FT                   5103991..5104143,5105881..5106085,5107063..5107192,
FT                   5108216..5108312)
FT                   /codon_start=1
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, isoform CRA_b"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT190722.0
FT                   protein_id=mCP111691.0 isoform=CRA_b"
FT                   /protein_id="EDL13938.1"
FT                   /translation="LDFLSPSINMSGTKPDILWAPHQVDRFVVCDSELSLYHVESAVNS
FT                   ELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQD
FT                   HNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPD
FT                   IVPMEKVRLSAGEAETTLLVTKPLYELGQNDASLSLCWLPRDQKLLLAGMHRNLAIFDL
FT                   RNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTK
FT                   VAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWH
FT                   PTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECAEEESDNSLEKDI
FT                   ATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDNDQKSPGNKG
FT                   SLVYAGIKSIVKSSLGMVESSRHNWSGLDKQTDIQNLNEERILALQLCGWIKKGTDVDV
FT                   GPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDE
FT                   KNSLWREMCSTLRLQLNNPYLCVMFAFLTSEAGAYDGVLYENKVAVRDRVAFACKFLGD
FT                   AQLNKYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPL
FT                   DVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSI
FT                   SYSCSSVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGS
FT                   KSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD
FT                   TTGNLVPAETVQP"
FT   CDS             join(5087641..5088948,5089215..5089305,5095296..5095550,
FT                   5097384..5097553,5099674..5099739,5100799..5100957,
FT                   5103991..5104143,5105881..5106085,5107063..5107192,
FT                   5108216..5108312)
FT                   /codon_start=1
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, isoform CRA_c"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT2134.2
FT                   protein_id=mCP16421.2 isoform=CRA_c"
FT                   /protein_id="EDL13939.1"
FT                   /translation="MSGTKPDILWAPHQVDRFVVCDSELSLYHVESAVNSELKAGSLRL
FT                   SEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLI
FT                   GKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVRL
FT                   SAGEAETTLLVTKPLYELGQNDASLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFV
FT                   NTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTG
FT                   LLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIV
FT                   VTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECAEEESDNSLEKDIATKMRLRAL
FT                   SRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHYILCWQYTEDNDQKSPGNKGSLVYAGI
FT                   KSIVKSSLGMVESSRHNWSGLDKQTDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSL
FT                   VQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWRE
FT                   MCSTLRLQLNNPYLCVMFAFLTSEAGAYDGVLYENKVAVRDRVAFACKFLGDAQLNKYI
FT                   EKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDER
FT                   VQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSSV
FT                   PHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGSKSDEKVD
FT                   LSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVP
FT                   AETVQP"
FT   CDS             join(5087641..5088948,5089215..5089305,5097384..5097553,
FT                   5099674..5099739,5100799..5100957,5103991..5104143,
FT                   5105881..5106085,5107063..5107192,5108216..5108312)
FT                   /codon_start=1
FT                   /gene="BC020002"
FT                   /locus_tag="mCG_2775"
FT                   /product="cDNA sequence BC020002, isoform CRA_a"
FT                   /note="gene_id=mCG2775.2 transcript_id=mCT175774.0
FT                   protein_id=mCP98696.0 isoform=CRA_a"
FT                   /protein_id="EDL13937.1"
FT                   /translation="MSGTKPDILWAPHQVDRFVVCDSELSLYHVESAVNSELKAGSLRL
FT                   SEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLI
FT                   GKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVRL
FT                   SAGEAETTLLVTKPLYELGQNDASLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFV
FT                   NTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTG
FT                   LLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIV
FT                   VTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECAEEESDNSLEKDIATKMRLRAL
FT                   SRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHYILCWQYTEDNDQKSPGNKGSLVYAGI
FT                   KSIVKSSLGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSEAG
FT                   AYDGVLYENKVAVRDRVAFACKFLGDAQLNKYIEKLTNEMKEAGNLEGILLTGLTKDGV
FT                   DLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDI
FT                   HRSKLDPSSKPLAQVFVSCNFCGKSISYSCSSVPHQGRGFSQYGVSGSPTKSKVTSCPG
FT                   CRKPLPRCALCLINMGTPVSSCPGGSKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHA
FT                   GHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP"
FT   gene            complement(5128553..5131734)
FT                   /gene="Rpa3"
FT                   /locus_tag="mCG_2770"
FT                   /note="gene_id=mCG2770.2"
FT   mRNA            complement(join(5128553..5128862,5129310..5129418,
FT                   5130295..5130369,5131606..5131734))
FT                   /gene="Rpa3"
FT                   /locus_tag="mCG_2770"
FT                   /product="replication protein A3"
FT                   /note="gene_id=mCG2770.2 transcript_id=mCT2136.1 created on
FT                   06-AUG-2002"
FT   CDS             complement(join(5128780..5128862,5129310..5129418,
FT                   5130295..5130369,5131606..5131704))
FT                   /codon_start=1
FT                   /gene="Rpa3"
FT                   /locus_tag="mCG_2770"
FT                   /product="replication protein A3"
FT                   /note="gene_id=mCG2770.2 transcript_id=mCT2136.1
FT                   protein_id=mCP16424.1"
FT                   /protein_id="EDL13936.1"
FT                   /translation="MEDIMQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSD
FT                   GEGKNGTIELMEPLDEEISGIVEVVGKVTAKATVLCASYTLFKEDTNRFDLELYNEAVK
FT                   IINELPQFFPVGLPQHE"
FT   gene            5132022..5470867
FT                   /locus_tag="mCG_2776"
FT                   /note="gene_id=mCG2776.2"
FT   mRNA            join(5132022..5132099,5143527..5143635,5247366..5247427,
FT                   5300515..5300729,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5470867)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT175775"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175775.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(5132022..5132099,5143527..5143635,5247366..5247427,
FT                   5274634..5274711,5300515..5302303)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT2139"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT2139.2 created on
FT                   14-NOV-2002"
FT   mRNA            join(5132022..5132099,5143527..5143635,5247366..5247427,
FT                   5300515..5302303)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT175776"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175776.0 created
FT                   on 14-NOV-2002"
FT   assembly_gap    5134975..5134994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5142284..5142365
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   CDS             join(5143554..5143635,5247366..5247427,5274634..5274711,
FT                   5300515..5300772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_c"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT2139.2
FT                   protein_id=mCP16419.2 isoform=CRA_c"
FT                   /db_xref="GOA:E0CX23"
FT                   /db_xref="InterPro:IPR023340"
FT                   /db_xref="MGI:MGI:3840148"
FT                   /db_xref="UniProtKB/TrEMBL:E0CX23"
FT                   /protein_id="EDL13930.1"
FT                   /translation="MFHFFRKPAESKKPSGPEPEADGFVLLGATANEVRCKTSEAEGSQ
FT                   ALEISALSSHHQRGSLWQQMGTDADTHSQTGKEDTSSVTVSGPETENQTGQTLQNNSLT
FT                   AELLSDVPFTLAPHVLAAQGTISDLPDHVLSYDVGDNLSRFWYDFTLENSVLCDL"
FT   CDS             join(5143554..5143635,5247366..5247427,5300515..5300772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_a"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175776.0
FT                   protein_id=mCP98700.0 isoform=CRA_a"
FT                   /db_xref="GOA:E0CXP6"
FT                   /db_xref="InterPro:IPR023340"
FT                   /db_xref="MGI:MGI:3840148"
FT                   /db_xref="UniProtKB/TrEMBL:E0CXP6"
FT                   /protein_id="EDL13928.1"
FT                   /translation="MFHFFRKPAESKKPSGPEPEADGFVLLGATANEVRCKTSEAEGSQ
FT                   ALETGKEDTSSVTVSGPETENQTGQTLQNNSLTAELLSDVPFTLAPHVLAAQGTISDLP
FT                   DHVLSYDVGDNLSRFWYDFTLENSVLCDL"
FT   assembly_gap    5174750..5174829
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5199657..5199676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5251094..5252809)
FT                   /pseudo
FT                   /locus_tag="mCG_2774"
FT                   /note="gene_id=mCG2774.2"
FT   mRNA            complement(5251094..5252809)
FT                   /pseudo
FT                   /locus_tag="mCG_2774"
FT                   /note="gene_id=mCG2774.2 transcript_id=mCT2140.2 created on
FT                   14-NOV-2002"
FT   assembly_gap    5265573..5265772
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    5271059..5271078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5300621..5300729,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5466641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_e"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175775.0
FT                   protein_id=mCP98698.0 isoform=CRA_e"
FT                   /protein_id="EDL13932.1"
FT                   /translation="MCPSPWPHMCWRHRAPSATFLTTYSHTMSATTCPDSVDRPKSQHI
FT                   RTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMRDKATQTPSCWAEEGAEKRSHQR
FT                   SASWGSADQLKEIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQAIGSRSVPM
FT                   PLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLPAHYR
FT                   SSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTEDLLYDRDKDSGSSS
FT                   PLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMASRQPISAPLFSCPDKNKVNFIPTG
FT                   SAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLTVEQLSSRVSFTSLSDDTSTADSL
FT                   EPSAQQPSQQQQLLQDLQVEEHVSTQNYVMI"
FT   assembly_gap    5328233..5328252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5364208..>5372265)
FT                   /locus_tag="mCG_145213"
FT                   /note="gene_id=mCG145213.0"
FT   mRNA            complement(join(5364208..5364748,5365261..5365374,
FT                   5365497..5365544,5367005..5367079,5371694..>5372265))
FT                   /locus_tag="mCG_145213"
FT                   /product="mCG145213"
FT                   /note="gene_id=mCG145213.0 transcript_id=mCT184637.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(5364700..5364748,5365261..5365374,
FT                   5365497..5365544,5367005..5367079,5371694..>5371737))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145213"
FT                   /product="mCG145213"
FT                   /note="gene_id=mCG145213.0 transcript_id=mCT184637.0
FT                   protein_id=mCP105357.0"
FT                   /protein_id="EDL13935.1"
FT                   /translation="AFLLLHKGMSTGSIRGCHVTSSPCSCLRSFWAIVDCILKLKDAST
FT                   SRTDVNECFWSRQAIEGGRRRLEIEIPQHPGTTQDEVGETVANRSLYFLRPARDRLLRK
FT                   QKEHI"
FT   assembly_gap    5376625..5377363
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   gene            complement(5381396..5383471)
FT                   /locus_tag="mCG_147468"
FT                   /note="gene_id=mCG147468.0"
FT   mRNA            complement(join(5381396..5383143,5383311..5383471))
FT                   /locus_tag="mCG_147468"
FT                   /product="mCG147468"
FT                   /note="gene_id=mCG147468.0 transcript_id=mCT187731.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5381762..5381926)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147468"
FT                   /product="mCG147468"
FT                   /note="gene_id=mCG147468.0 transcript_id=mCT187731.0
FT                   protein_id=mCP108223.0"
FT                   /protein_id="EDL13934.1"
FT                   /translation="MSNVGNLITAQLHYRNVILGHLWTNLNTLDDHDSKVIVSHRWQWS
FT                   VAVRLDQKQ"
FT   assembly_gap    5383926..5384512
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   mRNA            join(<5384513..5384666,5411450..5411601,5431912..5431998,
FT                   5446571..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5470867)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT2142"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT2142.2 created on
FT                   14-NOV-2002"
FT   CDS             join(<5384513..5384666,5411450..5411601,5431912..5431998,
FT                   5446571..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5466641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_d"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT2142.2
FT                   protein_id=mCP16423.2 isoform=CRA_d"
FT                   /protein_id="EDL13931.1"
FT                   /translation="RGPSPSSPTPPPAAAPAEQAPRAKGRPRRSPESRRRSSSPERRSP
FT                   GSPVCRVDRPKSQHIRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMRDKATQTP
FT                   SCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNH
FT                   ITISHTQAIGSRSVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKP
FT                   LDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPESQDGSPCS
FT                   TEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMASRQPISAP
FT                   LFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLTVEQLSSR
FT                   VSFTSLSDDTSTADSLEPSAQQPSQQQQLLQDLQVEEHVSTQNYVMI"
FT   mRNA            join(<5385574..5385696,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5470867)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT175777"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175777.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(<5385576..5385696,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5466641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_b"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175777.0
FT                   protein_id=mCP98697.0 isoform=CRA_b"
FT                   /protein_id="EDL13929.1"
FT                   /translation="CCCCCYYCSIVEGIIRSRERKQQKSLLRREILPSFIQCLCVDRPK
FT                   SQHIRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMRDKATQTPSCWAEEGAEKR
FT                   SHQRSASWGSADQLKEIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQAIGSR
FT                   SVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLP
FT                   AHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTEDLLYDRDKDS
FT                   GSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMASRQPISAPLFSCPDKNKVNF
FT                   IPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLTVEQLSSRVSFTSLSDDTST
FT                   ADSLEPSAQQPSQQQQLLQDLQVEEHVSTQNYVMI"
FT   mRNA            join(<5393861..5393906,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5470867)
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, transcript variant mCT175778"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175778.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(<5393900..5393906,5411450..5411601,5431912..5431998,
FT                   5446574..5446687,5452978..5453130,5455969..5456179,
FT                   5464934..5465054,5466296..5466641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2776"
FT                   /product="mCG2776, isoform CRA_f"
FT                   /note="gene_id=mCG2776.2 transcript_id=mCT175778.0
FT                   protein_id=mCP98699.0 isoform=CRA_f"
FT                   /protein_id="EDL13933.1"
FT                   /translation="NPVDRPKSQHIRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPS
FT                   CMRDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEIAKLRQQLQRSKQSSRHSKEKD
FT                   RQSPLHGNHITISHTQAIGSRSVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKEN
FT                   NGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPP
FT                   ESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEM
FT                   ASRQPISAPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALAT
FT                   LTVEQLSSRVSFTSLSDDTSTADSLEPSAQQPSQQQQLLQDLQVEEHVSTQNYVMI"
FT   assembly_gap    5399346..5399481
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    5403117..5403136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5411926..5412016
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    5414733..5416716
FT                   /estimated_length=1984
FT                   /gap_type="unknown"
FT   assembly_gap    5417588..5417953
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   gene            complement(5469140..5470933)
FT                   /pseudo
FT                   /locus_tag="mCG_54329"
FT                   /note="gene_id=mCG54329.2"
FT   mRNA            complement(5469140..5470933)
FT                   /pseudo
FT                   /locus_tag="mCG_54329"
FT                   /note="gene_id=mCG54329.2 transcript_id=mCT54512.2 created
FT                   on 14-JUN-2003"
FT   assembly_gap    5480489..5480508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5494182..5642501)
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /note="gene_id=mCG2771.3"
FT   mRNA            complement(join(5494182..5494452,5506081..5506350,
FT                   5515136..5515174,5517998..5518044,5519851..5519945,
FT                   5532337..5532435,5533941..5534066,5600038..5600236,
FT                   5605281..5605404,5613670..5613742,5618632..5618794,
FT                   5622410..5622502,5642082..5642494))
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, transcript variant
FT                   mCT171521"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT171521.1 created
FT                   on 14-NOV-2002"
FT   mRNA            complement(join(5494182..5494452,5506081..5506350,
FT                   5515136..5515174,5515269..5515331,5517998..5518044,
FT                   5519851..5519945,5532337..5532435,5533941..5534066,
FT                   5600038..5600236,5605281..5605404,5613670..5613742,
FT                   5618632..5618794,5622410..5622502,5642082..5642494))
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, transcript variant
FT                   mCT2137"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT2137.3 created on
FT                   14-NOV-2002"
FT   CDS             complement(join(5494331..5494452,5506081..5506350,
FT                   5515136..5515174,5517998..5518044,5519851..5519945,
FT                   5532337..5532435,5533941..5534066,5600038..5600236,
FT                   5605281..5605404,5613670..5613742,5618632..5618794,
FT                   5622410..5622426))
FT                   /codon_start=1
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, isoform CRA_a"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT171521.1
FT                   protein_id=mCP94440.0 isoform=CRA_a"
FT                   /protein_id="EDL13925.1"
FT                   /translation="MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKED
FT                   EHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQD
FT                   KTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQYRT
FT                   EYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASR
FT                   CNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEG
FT                   KKTSWRENREAVAPEPRQLISLEDEHKDSSTYKRPIDELLDGKPEEACLGPTAGTPEPE
FT                   SGDKDDLLLLNEIFSTSCLDEGEFSREWAAVFGDDRLKEPAPMGAQGEPDPKPQIGSGF
FT                   LPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA"
FT   CDS             complement(join(5494331..5494452,5506081..5506350,
FT                   5515136..5515174,5515269..5515331,5517998..5518044,
FT                   5519851..5519945,5532337..5532435,5533941..5534066,
FT                   5600038..5600236,5605281..5605404,5613670..5613742,
FT                   5618632..5618794,5622410..5622426))
FT                   /codon_start=1
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, isoform CRA_c"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT2137.3
FT                   protein_id=mCP16425.2 isoform=CRA_c"
FT                   /db_xref="GOA:A5A8K4"
FT                   /db_xref="InterPro:IPR006723"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR024114"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR030796"
FT                   /db_xref="MGI:MGI:96391"
FT                   /db_xref="UniProtKB/TrEMBL:A5A8K4"
FT                   /protein_id="EDL13927.1"
FT                   /translation="MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKED
FT                   EHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQD
FT                   KTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQYRT
FT                   EYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASR
FT                   CNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEG
FT                   KKTSWRENREAVAPEPRQLISLEDEHKDSSTYKTEEGTSVLSSVDKGSVHDTCSGPIDE
FT                   LLDGKPEEACLGPTAGTPEPESGDKDDLLLLNEIFSTSCLDEGEFSREWAAVFGDDRLK
FT                   EPAPMGAQGEPDPKPQIGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLD
FT                   PLSNPDAVGKTDKEHELLNA"
FT   assembly_gap    5507889..5509136
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5520642..5520748,5528837..5529003,
FT                   5532337..5532435,5533941..5534066,5600038..5600236,
FT                   5605281..5605404,5613670..5613742,5618632..5618794,
FT                   5622410..5622502,5642383..5642501))
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, transcript variant
FT                   mCT175773"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT175773.0 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(5528872..5529003,5532337..5532435,
FT                   5533941..5534066,5600038..5600236,5605281..5605404,
FT                   5613670..5613742,5618632..5618794,5622410..5622426))
FT                   /codon_start=1
FT                   /gene="Ica1"
FT                   /locus_tag="mCG_2771"
FT                   /product="islet cell autoantigen 1, isoform CRA_b"
FT                   /note="gene_id=mCG2771.3 transcript_id=mCT175773.0
FT                   protein_id=mCP98695.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z119"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR024114"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR030796"
FT                   /db_xref="MGI:MGI:96391"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z119"
FT                   /protein_id="EDL13926.1"
FT                   /translation="MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKED
FT                   EHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQD
FT                   KTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQYRT
FT                   EYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASR
FT                   CNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKDITYTLLHGSRAGD
FT                   SHRGVKWLFPGSATVPFASTAIPSLSGSW"
FT   assembly_gap    5540710..5540729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5553580..5554056
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    5558791..5562632
FT                   /estimated_length=3842
FT                   /gap_type="unknown"
FT   assembly_gap    5568487..5568506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5585614..5585797
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    5610011..5610030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5617553..5617590
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    5654989..5655008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5656224..5656243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5665779..5667073
FT                   /estimated_length=1295
FT                   /gap_type="unknown"
FT   assembly_gap    5681310..5681339
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    5702473..5702492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5723229..5723408
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    5733753..5733775
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    5736696..5736918
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    5749857..5750011
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5752573..5752592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5786566..5786701
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    5792242..5793567
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   assembly_gap    5800546..5800600
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5801371..5801793
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   gene            5818599..6111907
FT                   /gene="Nxph1"
FT                   /locus_tag="mCG_14959"
FT                   /note="gene_id=mCG14959.2"
FT   mRNA            join(5818599..5818947,5819775..5819938,6109725..6111907)
FT                   /gene="Nxph1"
FT                   /locus_tag="mCG_14959"
FT                   /product="neurexophilin 1, transcript variant mCT21024"
FT                   /note="gene_id=mCG14959.2 transcript_id=mCT21024.2 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<5819445..5819938,6109725..6111907)
FT                   /gene="Nxph1"
FT                   /locus_tag="mCG_14959"
FT                   /product="neurexophilin 1, transcript variant mCT190719"
FT                   /note="gene_id=mCG14959.2 transcript_id=mCT190719.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5819783..5819938,6109725..6110486)
FT                   /codon_start=1
FT                   /gene="Nxph1"
FT                   /locus_tag="mCG_14959"
FT                   /product="neurexophilin 1, isoform CRA_a"
FT                   /note="gene_id=mCG14959.2 transcript_id=mCT190719.0
FT                   protein_id=mCP111682.0 isoform=CRA_a"
FT                   /protein_id="EDL13922.1"
FT                   /translation="ERSLLCKVDVRWIYVFEGTKTQPRHRQGSLRGGRMQAACWYVLLL
FT                   LQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDT
FT                   DLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIK
FT                   TVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKD
FT                   SKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYST
FT                   DYKLVQKVCPDYNYHSDTPYFPSG"
FT   CDS             join(5819885..5819938,6109725..6110486)
FT                   /codon_start=1
FT                   /gene="Nxph1"
FT                   /locus_tag="mCG_14959"
FT                   /product="neurexophilin 1, isoform CRA_b"
FT                   /note="gene_id=mCG14959.2 transcript_id=mCT21024.2
FT                   protein_id=mCP16422.2 isoform=CRA_b"
FT                   /protein_id="EDL13923.1"
FT                   /translation="MQAACWYVLLLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHI
FT                   WTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRA
FT                   KRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNV
FT                   SVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQ
FT                   TQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG"
FT   assembly_gap    5825243..5825262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5854672..5854786
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    5885091..5885789
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    5965908..5965927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6009404..6009639
FT                   /locus_tag="mCG_141515"
FT                   /note="gene_id=mCG141515.0"
FT   mRNA            <6009404..6009639
FT                   /locus_tag="mCG_141515"
FT                   /product="mCG141515"
FT                   /note="gene_id=mCG141515.0 transcript_id=mCT175766.0
FT                   created on 13-NOV-2002"
FT   CDS             <6009404..6009547
FT                   /codon_start=1
FT                   /locus_tag="mCG_141515"
FT                   /product="mCG141515"
FT                   /note="gene_id=mCG141515.0 transcript_id=mCT175766.0
FT                   protein_id=mCP98688.0"
FT                   /protein_id="EDL13924.1"
FT                   /translation="KYVLGSKQTLKMIKQGRASWLSLPTIAQLRKSEMDKYDRLVKSCI
FT                   HG"
FT   assembly_gap    6047824..6047843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6154276..6155696
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   assembly_gap    6161618..6161637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6204869..6204888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6225650..6225914
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    6256690..6256709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6297165..6298567
FT                   /estimated_length=1403
FT                   /gap_type="unknown"
FT   assembly_gap    6299341..6300191
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    6310107..6311901
FT                   /estimated_length=1795
FT                   /gap_type="unknown"
FT   assembly_gap    6347094..6347690
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    6349520..6349539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6351543..6351562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6353250..6354468
FT                   /estimated_length=1219
FT                   /gap_type="unknown"
FT   assembly_gap    6434345..6434364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6435539..6435708
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    6437716..6437735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6440611..6440731
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    6445548..6445657
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6450173..6450277
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    6463972..6470193
FT                   /estimated_length=6222
FT                   /gap_type="unknown"
FT   assembly_gap    6506741..6510434
FT                   /estimated_length=3694
FT                   /gap_type="unknown"
FT   assembly_gap    6511531..6511702
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    6520735..6521833
FT                   /estimated_length=1099
FT                   /gap_type="unknown"
FT   assembly_gap    6553725..6553892
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    6561282..6561301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6580387..6581225
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    6624238..6624257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6678549..6678568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6689379..6689398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6699241..6699379
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    6717412..6717431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6836545..6836564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6865745..6865764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6899745..6899764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6901088..6901107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6902653..6902672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6903766..6903785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6905131..6905150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6927830..6928852
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    6929684..6929896
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    6932613..6932868
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    6978717..6978739
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6996138..6996547
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    7016892..7016911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7018227..7019324)
FT                   /pseudo
FT                   /locus_tag="mCG_13740"
FT                   /note="gene_id=mCG13740.1"
FT   mRNA            complement(7018227..7019324)
FT                   /pseudo
FT                   /locus_tag="mCG_13740"
FT                   /note="gene_id=mCG13740.1 transcript_id=mCT17095.2 created
FT                   on 13-NOV-2002"
FT   assembly_gap    7047143..7047162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7048408..7048427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7072037..7074011
FT                   /estimated_length=1975
FT                   /gap_type="unknown"
FT   assembly_gap    7086751..7087187
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    7092613..7092632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7100206..7100225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7166269..7166288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7186204..7186223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7260305..7260428
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    7317565..7317882
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    7322896..7322915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7368991..7369040
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    7394364..7394383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7396087..7397597
FT                   /estimated_length=1511
FT                   /gap_type="unknown"
FT   assembly_gap    7400422..7400770
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    7418100..7418923
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    7455026..7460068
FT                   /estimated_length=5043
FT                   /gap_type="unknown"
FT   assembly_gap    7505295..7505899
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   assembly_gap    7508486..7510206
FT                   /estimated_length=1721
FT                   /gap_type="unknown"
FT   assembly_gap    7525211..7525287
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    7547947..7548581
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    7550265..7552436
FT                   /estimated_length=2172
FT                   /gap_type="unknown"
FT   assembly_gap    7557501..7557931
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    7571826..7577944
FT                   /estimated_length=6119
FT                   /gap_type="unknown"
FT   assembly_gap    7594574..7594593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7617907..7618729
FT                   /estimated_length=823
FT                   /gap_type="unknown"
FT   assembly_gap    7620151..7620170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7622068..7622087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7623558..7623577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7629878..7629897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7632079..7632098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7635884..7635903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7646939..7647080
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    7657671..7660766
FT                   /estimated_length=3096
FT                   /gap_type="unknown"
FT   assembly_gap    7687967..7688059
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            7703027..7709195
FT                   /pseudo
FT                   /locus_tag="mCG_1029475"
FT                   /note="gene_id=mCG1029475.1"
FT   mRNA            join(7703027..7705641,7708267..7709195)
FT                   /pseudo
FT                   /locus_tag="mCG_1029475"
FT                   /note="gene_id=mCG1029475.1 transcript_id=mCT147179.1
FT                   created on 13-NOV-2002"
FT   assembly_gap    7735527..7736381
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    7739313..7746114
FT                   /estimated_length=6802
FT                   /gap_type="unknown"
FT   assembly_gap    7776166..7776185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7784368..7784387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7788229..7796283)
FT                   /locus_tag="mCG_1029724"
FT                   /note="gene_id=mCG1029724.1"
FT   mRNA            complement(join(7788229..7788904,7790153..7790289,
FT                   7796114..7796283))
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, transcript variant mCT147428"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT147428.1
FT                   created on 31-MAR-2003"
FT   mRNA            complement(join(7788229..7788904,7790153..7790289,
FT                   7794516..7794562,7796114..7796283))
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, transcript variant mCT181766"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT181766.0
FT                   created on 31-MAR-2003"
FT   mRNA            complement(join(7788229..7788904,7790153..7790289,
FT                   7790918..7791058,7794516..7794562,7796114..7796283))
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, transcript variant mCT181765"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT181765.0
FT                   created on 31-MAR-2003"
FT   CDS             complement(join(7788864..7788904,7790153..7790282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, isoform CRA_a"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT181765.0
FT                   protein_id=mCP104688.0 isoform=CRA_a"
FT                   /protein_id="EDL13919.1"
FT                   /translation="MISKARKGASKQKISSPLPEIRDPGGGALVSLALCAKAVKTFKGE
FT                   SLKTIRTHDQA"
FT   CDS             complement(join(7788864..7788904,7790153..7790282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, isoform CRA_a"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT181766.0
FT                   protein_id=mCP104687.0 isoform=CRA_a"
FT                   /protein_id="EDL13920.1"
FT                   /translation="MISKARKGASKQKISSPLPEIRDPGGGALVSLALCAKAVKTFKGE
FT                   SLKTIRTHDQA"
FT   CDS             complement(join(7788864..7788904,7790153..7790282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1029724"
FT                   /product="mCG1029724, isoform CRA_a"
FT                   /note="gene_id=mCG1029724.1 transcript_id=mCT147428.1
FT                   protein_id=mCP45209.1 isoform=CRA_a"
FT                   /protein_id="EDL13921.1"
FT                   /translation="MISKARKGASKQKISSPLPEIRDPGGGALVSLALCAKAVKTFKGE
FT                   SLKTIRTHDQA"
FT   assembly_gap    7852003..7852274
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    7884651..7887970
FT                   /estimated_length=3320
FT                   /gap_type="unknown"
FT   assembly_gap    7893896..7894050
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    7906001..7906020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7906859..7910173
FT                   /estimated_length=3315
FT                   /gap_type="unknown"
FT   assembly_gap    7951073..7951092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7989678..7989788
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    8033301..8033320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8051575..8051594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8116945..8116964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8126298..8127251
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   assembly_gap    8164776..8164795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8167142..8167161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8174403..8174422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8176728..8176747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8244367..8244386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8245405..8246018
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    8256334..8258493
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   assembly_gap    8277145..8280508
FT                   /estimated_length=3364
FT                   /gap_type="unknown"
FT   assembly_gap    8352964..8352983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8362650..8364026
FT                   /estimated_length=1377
FT                   /gap_type="unknown"
FT   assembly_gap    8399549..8399711
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    8410280..8410299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8446860..8446950
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    8501546..8502059
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    8508039..8512149
FT                   /estimated_length=4111
FT                   /gap_type="unknown"
FT   assembly_gap    8519960..8520054
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    8521005..8521054
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    8526441..8526460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8527688..8528497
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    8529320..8530642
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    8533485..8535006
FT                   /estimated_length=1522
FT                   /gap_type="unknown"
FT   assembly_gap    8544927..8545037
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    8552787..8553421
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    8569486..8575349
FT                   /estimated_length=5864
FT                   /gap_type="unknown"
FT   assembly_gap    8576640..8578096
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   assembly_gap    8589044..8589098
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    8619855..8620096
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    8646640..8647001
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    8649777..8652836
FT                   /estimated_length=3060
FT                   /gap_type="unknown"
FT   assembly_gap    8654239..8718968
FT                   /estimated_length=64730
FT                   /gap_type="unknown"
FT   gene            complement(8723478..8730947)
FT                   /locus_tag="mCG_11254"
FT                   /note="gene_id=mCG11254.2"
FT   mRNA            complement(join(8723478..8724044,8728655..8728715,
FT                   8729473..8729561,8730777..8730947))
FT                   /locus_tag="mCG_11254"
FT                   /product="mCG11254"
FT                   /note="gene_id=mCG11254.2 transcript_id=mCT11305.2 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(8723988..8724044,8728655..8728715,
FT                   8729473..8729561,8730777..8730818))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11254"
FT                   /product="mCG11254"
FT                   /note="gene_id=mCG11254.2 transcript_id=mCT11305.2
FT                   protein_id=mCP15816.1"
FT                   /protein_id="EDL13918.1"
FT                   /translation="MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSW
FT                   DRKNNPEPWNKLGPNEQYKFYSVNVDYSKLKKEGPDF"
FT   gene            8731262..8910777
FT                   /gene="Phf14"
FT                   /locus_tag="mCG_11252"
FT                   /note="gene_id=mCG11252.2"
FT   mRNA            join(8731262..8731470,8750297..8750407,8765000..8765144,
FT                   8776855..8777014,8785117..8785228,8786223..8786360,
FT                   8809670..8809816,8810332..8810602,8810904..8811010,
FT                   8812050..8812145,8813357..8813460,8815314..8815445,
FT                   8820355..8820523,8830012..8830062,8830186..8830307,
FT                   8871275..8871392,8910577..8910777)
FT                   /gene="Phf14"
FT                   /locus_tag="mCG_11252"
FT                   /product="PHD finger protein 14, transcript variant
FT                   mCT11306"
FT                   /note="gene_id=mCG11252.2 transcript_id=mCT11306.2 created
FT                   on 07-NOV-2002"
FT   assembly_gap    8739624..8739643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8749329..8749348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(8749449..8749862,8750297..8750407,8756823..8757589,
FT                   8765000..8765144,8776855..8777014,8785117..8785228,
FT                   8786223..8786360,8809670..8809816,8810332..8810602,
FT                   8810904..8811010,8812050..8812145,8813357..8813460,
FT                   8815314..8815445,8820355..8820523,8830012..8830062,
FT                   8830186..8830307,8830906..8832086)
FT                   /gene="Phf14"
FT                   /locus_tag="mCG_11252"
FT                   /product="PHD finger protein 14, transcript variant
FT                   mCT175567"
FT                   /note="gene_id=mCG11252.2 transcript_id=mCT175567.0 created
FT                   on 07-NOV-2002"
FT   CDS             join(8749862,8750297..8750407,8756823..8757589,
FT                   8765000..8765144,8776855..8777014,8785117..8785228,
FT                   8786223..8786360,8809670..8809816,8810332..8810602,
FT                   8810904..8811010,8812050..8812145,8813357..8813460,
FT                   8815314..8815445,8820355..8820523,8830012..8830062,
FT                   8830186..8830307,8830906..8830918)
FT                   /codon_start=1
FT                   /gene="Phf14"
FT                   /locus_tag="mCG_11252"
FT                   /product="PHD finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG11252.2 transcript_id=mCT175567.0
FT                   protein_id=mCP98489.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8S0"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:1923539"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8S0"
FT                   /protein_id="EDL13916.1"
FT                   /translation="MDRSSKRRQVKPLAASLLEALDYDSSDDSDFKVGDASDSEGSGNG
FT                   SEDPSKDSGEGSCSDSEENILEEELNEDIQVKEEQLKNSTEEIMPSDKQLIKMEKKEEE
FT                   ENGERPRKKKEKEKEKEKEREKDKEKATVSDSAAASAAGTTPATSPPAVTSPSVPTTTT
FT                   TTTEEQVSEPKKWNLRRNRPLLDFVSMEELNAMDDYDSEDDNDWRPTVVKRKGRSASQK
FT                   EGSDGDNEDDDDEGSGSEEDENDEGNDEDHSSPASEAGGKKKRSKVLSRNSADDEELTN
FT                   DSLTLSQSKSNEDSLILEKSQNWSSQKMDHILICCVCLGDNSEDADEIIQCDNCGITVH
FT                   EGCYGVDGESDSIMSSASENSTEPWFCDACKCGVSPSCELCPNQDGIFKETDAGRWVHI
FT                   VCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRA
FT                   YFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQE
FT                   REKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKA
FT                   ELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKN
FT                   IKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGIWALLGRITGQKLNVPAILR
FT                   APKERKPSKKEGGTQKTSALPTVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLT
FT                   RMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRSRRQIKEPVKFVPQDVPPEP
FT                   KKIPIRNTRTRGRKRSFVPEEEKHEERVPRERRQRQSVLQKKPKAEDLRTECSTCKGTG
FT                   DNENLVRNLS"
FT   CDS             join(8750363..8750407,8765000..8765144,8776855..8777014,
FT                   8785117..8785228,8786223..8786360,8809670..8809816,
FT                   8810332..8810602,8810904..8811010,8812050..8812145,
FT                   8813357..8813460,8815314..8815445,8820355..8820523,
FT                   8830012..8830062,8830186..8830307,8871275..8871392,
FT                   8910577..8910651)
FT                   /codon_start=1
FT                   /gene="Phf14"
FT                   /locus_tag="mCG_11252"
FT                   /product="PHD finger protein 14, isoform CRA_b"
FT                   /note="gene_id=mCG11252.2 transcript_id=mCT11306.2
FT                   protein_id=mCP15808.2 isoform=CRA_b"
FT                   /protein_id="EDL13917.1"
FT                   /translation="MIVQMTVILKLEMLQDSLILEKSQNWSSQKMDHILICCVCLGDNS
FT                   EDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVSPSCELCP
FT                   NQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPR
FT                   FARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWK
FT                   RKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLP
FT                   RPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFE
FT                   RNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGIWA
FT                   LLGRITGQKLNVPAILRAPKERKPSKKEGGTQKTSALPTVLYSCGICKKNHDQHLLLLC
FT                   DTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRSRR
FT                   QIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEEEKHEERVPRERRQRQSVLQKK
FT                   PKAEDLRTECSTCKGTGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDS
FT                   SSSKEDENEAEKKNASQELSMEQKTPKK"
FT   assembly_gap    8787024..8788945
FT                   /estimated_length=1922
FT                   /gap_type="unknown"
FT   assembly_gap    8789955..8790850
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    8825132..8825157
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    8855707..8855787
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    8873585..8873663
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    8899536..8903466
FT                   /estimated_length=3931
FT                   /gap_type="unknown"
FT   assembly_gap    8927536..8927640
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(8929185..8929941)
FT                   /pseudo
FT                   /locus_tag="mCG_49682"
FT                   /note="gene_id=mCG49682.1"
FT   mRNA            complement(8929185..8929941)
FT                   /pseudo
FT                   /locus_tag="mCG_49682"
FT                   /note="gene_id=mCG49682.1 transcript_id=mCT49865.1 created
FT                   on 13-NOV-2002"
FT   assembly_gap    8937579..8937720
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    8939445..8939759
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    8940928..8940947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8968922..8969170
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    8976152..8976171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8987515..8988052
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    8988727..8989782
FT                   /estimated_length=1056
FT                   /gap_type="unknown"
FT   assembly_gap    8996207..8997390
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   assembly_gap    8998587..8999846
FT                   /estimated_length=1260
FT                   /gap_type="unknown"
FT   assembly_gap    9005000..9005119
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9008027..9009457
FT                   /estimated_length=1431
FT                   /gap_type="unknown"
FT   assembly_gap    9021239..9021261
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9025195..9026073
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    9058056..9058088
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    9075139..9075158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9108638..9109462
FT                   /estimated_length=825
FT                   /gap_type="unknown"
FT   assembly_gap    9110307..9111812
FT                   /estimated_length=1506
FT                   /gap_type="unknown"
FT   assembly_gap    9115314..9115333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9116389..9116408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9117464..9117483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9119480..9119763
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    9129789..9129988
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   gene            complement(9147075..9577892)
FT                   /locus_tag="mCG_141518"
FT                   /note="gene_id=mCG141518.0"
FT   mRNA            complement(join(9147075..9147671,9148334..9148421,
FT                   9151572..9151825,9152574..9152610,9155235..9155330,
FT                   9158126..9158299,9161539..9161713,9162146..9162291,
FT                   9162530..9162647,9167857..9167972,9169186..9169330,
FT                   9173724..9173877,9178808..9178941,9182617..9182795,
FT                   9210526..9210789,9212355..9212549,9227665..9227768,
FT                   9228948..9229080,9236223..9236338,9239919..9240153,
FT                   9249362..9249556,9299532..9299744,9301779..9301934,
FT                   9334323..9334504,9337259..9337507,9382636..9383467,
FT                   9577436..9577892))
FT                   /locus_tag="mCG_141518"
FT                   /product="mCG141518"
FT                   /note="gene_id=mCG141518.0 transcript_id=mCT175769.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(join(9147587..9147671,9148334..9148421,
FT                   9151572..9151825,9152574..9152610,9155235..9155330,
FT                   9158126..9158299,9161539..9161713,9162146..9162291,
FT                   9162530..9162647,9167857..9167972,9169186..9169330,
FT                   9173724..9173877,9178808..9178941,9182617..9182795,
FT                   9210526..9210789,9212355..9212549,9227665..9227768,
FT                   9228948..9229080,9236223..9236338,9239919..9240153,
FT                   9249362..9249556,9299532..9299744,9301779..9301934,
FT                   9334323..9334504,9337259..9337507,9382636..9383467,
FT                   9577436..9577592))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141518"
FT                   /product="mCG141518"
FT                   /note="gene_id=mCG141518.0 transcript_id=mCT175769.0
FT                   protein_id=mCP98691.0"
FT                   /protein_id="EDL13915.1"
FT                   /translation="MGLRAGRLASPSRGVLQLLRLPLLLLLLLSSGARGAAAQGDTEVP
FT                   TLYLWKTGPWGRCMGDDCGPGGIQTRAVWCAHVEGWTTLHTNCKQAVRPSNQQNCFKVC
FT                   DWHKELYDWRLGTWDRCQPVISKSLEKSRECVKGEEGIQVREIMCIQKDKDIPAEDIIC
FT                   EYFEPKPLLEQACLIPCQKDCIVSEFSPWSECSRTCGSGLQHRTRHVVAPPQYGGSGCP
FT                   NLTEFQVCQSNPCEEDESLYSLQVGPWSACSVPHTRQARQARRRGKNKEREKERGKAVK
FT                   DPEARELIKKKRNRNRQNRQENRYWDIQIGYQTRDVTCLNRTGKSADLSFCQQERLPMT
FT                   FQSCVITKECQVSEWLEWSPCSKTCHDVTSPTGTRVRTRTITQFPIGSEKECPALEEKE
FT                   PCVSQGDGAVLCATYGWRTTEWTECHVDPLLSQQDKRRANQTALCGGGVQTREIYCIQT
FT                   NDNMLSHGNTQKDKEASKPVDSKLCTGPVPNTTQLCHVPCPIECEVSPWSAWGPCTYEN
FT                   CNDQQGKKGFKLRKRRITNEPTGGSGATGNCPHLLEAIPCEEPSCYDWKSVRLGDCEPD
FT                   NGKSCGPGTQVQEVVCINSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSAWSSWSSC
FT                   SHTCSGKTTEGKQTRARSILAYAGEEGGIRCPNISALQEVRSCNEHPCTVYHWQTGPWG
FT                   QCIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPC
FT                   LLPCRKDCVVTPYSDWTPCPSSCREGDSGARKQSRQRVIIQLPANGGKECSDPLYEEKA
FT                   CEAPPTCHSYRWKTHKWRRCQLVPWSIQQDVPGAQEGCGPGRQARAITCRKQDGGQASI
FT                   QECLQYAGPVPALTQACQIPCQDDCQFTSWSKFSSCNGDCGAVRTRKRAIVGKSKKKEK
FT                   CKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGKAEVLLGMKVQGDSKECGQGYRY
FT                   QAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRS
FT                   KWLREKPYNGGRPCPKLDHVNQVYEVVPCHSDCNQYIWVTEPWSVCKVTFVDMRDNCGE
FT                   GVQTRKVRCMQNTADGPSEHVEDYLCDPEDMPLGSRECKLPCPEDCVISEWGPWTQCAL
FT                   PCNPSGSRQRSADPIRQPADEGRACPDAVEKEPCSLNKNCYHYDYNVTDWSTCQLSEKA
FT                   VCGNGIKTRMLDCVRSDGKSVDLKYCEELGLEKNWPMNTSCTVECPVNCQLSDWSSWSQ
FT                   CSQTCGLTGKMIRKRTVTQPFQGDGRPCPSLMEQSKPCPVKPCYRWQYGQWSPCQVQEA
FT                   QCGEGTRTRNISCVVSDGSAEDFSKVVDEEFCANTELIIDGNKQIVLEETCTQPCPGDC
FT                   YLNDWSSWSLCQLTCVNGEDLGFGGIQVRSRAVIIQELENQHLCPEQMLETKSCDDGQC
FT                   YEYKWVASAWKGSSRTVWCQRSDGINVTGGCLVVSQPDTDRLPCTCSISLPVLLQMKTC
FT                   RCEEGYTEVMSSNSTLEQCTLIPVVVIPTVEDKRGDVKTSRAVHPTQPSINPAGRGRTW
FT                   FLQPFGPDGRLKTWVYGVAAGAFVLLVFIVSMIYLACKKPKKPQRRQNNRLKPLTLAYD
FT                   GDADM"
FT   assembly_gap    9149603..9150044
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    9152540..9152559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9160157..9160208
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    9191581..9194344
FT                   /estimated_length=2764
FT                   /gap_type="unknown"
FT   assembly_gap    9196967..9196986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9200589..9200865
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    9208586..9208614
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    9213122..9213141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9263893..9263912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9271337..9271365
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    9299968..9300102
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    9308282..9308301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9311145..9311164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9312584..9312603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9380231..9380250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9385273..9385292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9394627..9395992
FT                   /pseudo
FT                   /locus_tag="mCG_50075"
FT                   /note="gene_id=mCG50075.2"
FT   mRNA            9394627..9395992
FT                   /pseudo
FT                   /locus_tag="mCG_50075"
FT                   /note="gene_id=mCG50075.2 transcript_id=mCT50258.2 created
FT                   on 13-NOV-2002"
FT   assembly_gap    9406754..9406789
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    9412860..9412879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9440666..9440685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9450726..9455614
FT                   /estimated_length=4889
FT                   /gap_type="unknown"
FT   assembly_gap    9462980..9462999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9479394..9479436
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    9482095..9482470
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    9499840..9508591
FT                   /estimated_length=8752
FT                   /gap_type="unknown"
FT   assembly_gap    9540738..9540757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9544122..9544356
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    9552807..9553368
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    9554670..9555138
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    9569217..9569397
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    9575423..9575442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9617993..9618012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9674751..9674770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9687111..9688599
FT                   /pseudo
FT                   /locus_tag="mCG_50593"
FT                   /note="gene_id=mCG50593.1"
FT   mRNA            9687111..9688599
FT                   /pseudo
FT                   /locus_tag="mCG_50593"
FT                   /note="gene_id=mCG50593.1 transcript_id=mCT50776.1 created
FT                   on 13-NOV-2002"
FT   assembly_gap    9708211..9708283
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    9709400..9709419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9710521..9710540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9712640..9712659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9722605..9722624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9758211..9760038
FT                   /estimated_length=1828
FT                   /gap_type="unknown"
FT   assembly_gap    9760808..9763972
FT                   /estimated_length=3165
FT                   /gap_type="unknown"
FT   assembly_gap    9796907..9796926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9875131..9875378
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            complement(9887952..9888945)
FT                   /pseudo
FT                   /locus_tag="mCG_12228"
FT                   /note="gene_id=mCG12228.2"
FT   mRNA            complement(9887952..9888945)
FT                   /pseudo
FT                   /locus_tag="mCG_12228"
FT                   /note="gene_id=mCG12228.2 transcript_id=mCT16496.2 created
FT                   on 13-NOV-2002"
FT   assembly_gap    9893487..9893638
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    9899323..9899820
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   gene            9901890..9917362
FT                   /gene="Tmem106b"
FT                   /locus_tag="mCG_12230"
FT                   /note="gene_id=mCG12230.2"
FT   mRNA            join(9901890..9902107,9902455..9902561,9903889..9904110,
FT                   9907183..9907246,9910390..9910549,9913838..9913978,
FT                   9914711..9914760,9915667..9915720,9916486..9917362)
FT                   /gene="Tmem106b"
FT                   /locus_tag="mCG_12230"
FT                   /product="transmembrane protein 106B, transcript variant
FT                   mCT16799"
FT                   /note="gene_id=mCG12230.2 transcript_id=mCT16799.2 created
FT                   on 07-NOV-2002"
FT   mRNA            join(9901890..9902107,9902455..9902561,9903889..9904110,
FT                   9907183..9907246,9908185..9908667)
FT                   /gene="Tmem106b"
FT                   /locus_tag="mCG_12230"
FT                   /product="transmembrane protein 106B, transcript variant
FT                   mCT175573"
FT                   /note="gene_id=mCG12230.2 transcript_id=mCT175573.0 created
FT                   on 07-NOV-2002"
FT   CDS             join(9903891..9904110,9907183..9907246,9910390..9910549,
FT                   9913838..9913978,9914711..9914760,9915667..9915720,
FT                   9916486..9916624)
FT                   /codon_start=1
FT                   /gene="Tmem106b"
FT                   /locus_tag="mCG_12230"
FT                   /product="transmembrane protein 106B, isoform CRA_a"
FT                   /note="gene_id=mCG12230.2 transcript_id=mCT16799.2
FT                   protein_id=mCP15802.2 isoform=CRA_a"
FT                   /protein_id="EDL13913.1"
FT                   /translation="MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVHNEDGRNGD
FT                   VSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVF
FT                   VCLLLSGLAVFFLFPRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEV
FT                   ENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKV
FT                   HNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ"
FT   CDS             join(9903891..9904110,9907183..9907246,9908185..9908266)
FT                   /codon_start=1
FT                   /gene="Tmem106b"
FT                   /locus_tag="mCG_12230"
FT                   /product="transmembrane protein 106B, isoform CRA_b"
FT                   /note="gene_id=mCG12230.2 transcript_id=mCT175573.0
FT                   protein_id=mCP98495.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D3D8"
FT                   /db_xref="InterPro:IPR009790"
FT                   /db_xref="MGI:MGI:1919150"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3D8"
FT                   /protein_id="EDL13914.1"
FT                   /translation="MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVHNEDGRNGD
FT                   VSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTFIFRGVVPY
FT                   QHGGNITAWRQALWWSS"
FT   assembly_gap    9907696..9907835
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(<9990348..>10020207)
FT                   /locus_tag="mCG_51455"
FT                   /note="gene_id=mCG51455.2"
FT   mRNA            complement(join(<9990348..9990451,9993170..9993265,
FT                   9994860..9994955,9995076..9995171,9999254..9999349,
FT                   10000899..10000994,10001581..10001676,10002875..10002970,
FT                   10003054..10003149,10007161..10007277,10009391..10009610,
FT                   10010600..10010850,10012838..10012952,10014340..10014444,
FT                   10014550..10014705,10018008..10018144,10019670..>10020207))
FT                   /locus_tag="mCG_51455"
FT                   /product="mCG51455"
FT                   /note="gene_id=mCG51455.2 transcript_id=mCT51638.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(9990348..9990451,9993170..9993265,
FT                   9994860..9994955,9995076..9995171,9999254..9999349,
FT                   10000899..10000994,10001581..10001676,10002875..10002970,
FT                   10003054..10003149,10007161..10007277,10009391..10009610,
FT                   10010600..10010850,10012838..10012952,10014340..10014444,
FT                   10014550..10014705,10018008..10018144,10019670..10020207))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51455"
FT                   /product="mCG51455"
FT                   /note="gene_id=mCG51455.2 transcript_id=mCT51638.2
FT                   protein_id=mCP36653.2"
FT                   /protein_id="EDL13912.1"
FT                   /translation="MRKSLQNRWKRQNVKDFHPVYIFQSLGQGNLEEFSYFFPEDHTED
FT                   SQPEFAPSWPTASGLTEFSVLAICQQTLANSSIGRLCLPFLGRTLNHVVDMCVKDVLLK
FT                   DDVNWAEGGVALLENECERRVLEDGKRNVEENRKTVEGILEVLKCPNLCSGHGECMGWG
FT                   CVCSPGYSSYDCSHSYEIAPEIAEVENAGFCDIQKKNCATVRVFGQGFKESLSITCEVT
FT                   KLEYNGSKWVLETSVYTQAVFQSSRVVDCQLFPNGQHFDTIDLTAEKPLAKLQLKVSND
FT                   GYTFSNSKIMIIYDGTCQVCGPYENDSCTIKNNICIIDDFCYTDGDKNPTSSCLICRPQ
FT                   TSNSTWSVLDDNQPPMIQTLQDKLEAFYGEDFEYHFMAWDPEGSEIRFTLDSGPDGAAV
FT                   SSEGLLTWKTESQTPQTFTLRLKDDCEAKSTVTVEVTVKSCDCLNGGSCVPDRKFPPGS
FT                   GAYLCDCLPGFYGDLCESEARECQSNPCGLGKCIRGSHSYSCDCPPELTGKNCEKDVDE
FT                   CESWPCFPGLECINVFGSYHCGPCPEGFQAFCRHSCGRNRECVAPNTCKCKPGYTGSNC
FT                   QTAICHPVCKKHGKCIKPNICACPPGHGGATCDEEHCSPPCEHGGTCLSGNLCTCPYGF
FT                   VGPRCETLVCNRHCENGGECVAPDICQCKSGWYGPTCSTALCDPICLNGGSCYKPNTCL
FT                   CPGGFFGTQCQNAVCHPPCKNGGLCMRNNVCSCPGGYTGKRCQTSICEPMCMNGGKCVG
FT                   PNICSCASGWSGKQCNTPICLQKCKNGGECIAPSMCHCPSTWEGVQCQKPICTQKCLYG
FT                   GRCAFPGVCSCRTGYSGAKCEKKI"
FT   assembly_gap    9998001..9998020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10046355..10046374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10100779..10103255
FT                   /estimated_length=2477
FT                   /gap_type="unknown"
FT   assembly_gap    10107017..10107036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10110417..10111166
FT                   /estimated_length=750
FT                   /gap_type="unknown"
FT   assembly_gap    10136988..10137165
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    10144141..10144160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10165432..10165451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10166516..10169842
FT                   /estimated_length=3327
FT                   /gap_type="unknown"
FT   assembly_gap    10187158..10187177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10191610..10191629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10220040..10220956
FT                   /pseudo
FT                   /locus_tag="mCG_1029543"
FT                   /note="gene_id=mCG1029543.1"
FT   mRNA            join(10220040..10220143,10220368..10220429,
FT                   10220639..10220956)
FT                   /pseudo
FT                   /locus_tag="mCG_1029543"
FT                   /note="gene_id=mCG1029543.1 transcript_id=mCT147247.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    10224298..10224317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10237836..10240496
FT                   /locus_tag="mCG_65056"
FT                   /note="gene_id=mCG65056.2"
FT   mRNA            join(<10237836..10238051,10240283..10240496)
FT                   /locus_tag="mCG_65056"
FT                   /product="mCG65056"
FT                   /note="gene_id=mCG65056.2 transcript_id=mCT65239.2 created
FT                   on 17-JAN-2003"
FT   CDS             join(<10237973..10238051,10240283..10240434)
FT                   /codon_start=1
FT                   /locus_tag="mCG_65056"
FT                   /product="mCG65056"
FT                   /note="gene_id=mCG65056.2 transcript_id=mCT65239.2
FT                   protein_id=mCP36676.2"
FT                   /protein_id="EDL13911.1"
FT                   /translation="LFPHCFAMKIHYCILMFLFLGLLLNSGSEDIPEVNSTLDCKNQTL
FT                   CSSENTNGDCSDVQKVGLCVLRLSQTPQQQT"
FT   assembly_gap    10241846..10242234
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    10245278..10245639
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    10252642..10252716
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    10279759..10279997
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    10280871..10281262
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    10321484..10326413
FT                   /estimated_length=4930
FT                   /gap_type="unknown"
FT   assembly_gap    10344900..10345002
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    10345974..10346076
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    10373699..10375118
FT                   /estimated_length=1420
FT                   /gap_type="unknown"
FT   assembly_gap    10384832..10385153
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    10390219..10391735
FT                   /estimated_length=1517
FT                   /gap_type="unknown"
FT   assembly_gap    10392742..10392761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10394138..10394157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10403621..10430975)
FT                   /gene="8430437G11Rik"
FT                   /locus_tag="mCG_12227"
FT                   /note="gene_id=mCG12227.2"
FT   mRNA            complement(join(10403621..10406267,10414203..10414477,
FT                   10417877..10418019,10430762..10430975))
FT                   /gene="8430437G11Rik"
FT                   /locus_tag="mCG_12227"
FT                   /product="RIKEN cDNA 8430437G11, transcript variant
FT                   mCT175572"
FT                   /note="gene_id=mCG12227.2 transcript_id=mCT175572.0 created
FT                   on 07-NOV-2002"
FT   mRNA            complement(join(10403621..10406267,10414203..10414477,
FT                   10417877..10418019,10425170..10426419,10430762..10430975))
FT                   /gene="8430437G11Rik"
FT                   /locus_tag="mCG_12227"
FT                   /product="RIKEN cDNA 8430437G11, transcript variant
FT                   mCT16498"
FT                   /note="gene_id=mCG12227.2 transcript_id=mCT16498.2 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(10405720..10406267,10414203..10414477,
FT                   10417877..10418019,10425170..10426297))
FT                   /codon_start=1
FT                   /gene="8430437G11Rik"
FT                   /locus_tag="mCG_12227"
FT                   /product="RIKEN cDNA 8430437G11, isoform CRA_a"
FT                   /note="gene_id=mCG12227.2 transcript_id=mCT16498.2
FT                   protein_id=mCP15819.2 isoform=CRA_a"
FT                   /protein_id="EDL13909.1"
FT                   /translation="MCRSLRYCVSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARINLL
FT                   VAICLGLYVRWEKTANSLILVIFILGLFVLGIASILYYYFSMEAASLSLSNLWFGFLLG
FT                   LLCFLDNSSFKSDVKEETTKYLLLTSIVLRILCALVERISGYVRHRPTLLTTVEFLELV
FT                   GFAIASTTMLVEKSLSVILLVMALAMLIIDLRMKSFLAIPNLIIFSVLLFFSSLETPQN
FT                   PIAFACFFICLVTDPFLDIYFSGLSVTERWKPFLHRGRICRRLSVLFTAMIELTFFILS
FT                   AFKLRDTHLWYFVIPGFSIFGFFWMICHIIFLLTLWGFHTKLNDCHKVYINHRADNNSL
FT                   DRIMASKGMRHFCLISEQLVFFSLLATAILGAVSWQPTNGIFLSMFLIVLPLESMAHGL
FT                   FHELGNCLGGTSVGYAIVIPTNFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYH
FT                   MIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYVLYYSGHTHGSGEWALAGG
FT                   DILRLDTLLEWWREKNGSFCSRLIIILDSENSTPWVKEVRKINDQYVAVQGAELAKTVD
FT                   IEEADPPQLGDFTRDWVEYNCNSTNNICWTEKGRTVRAVYGVSKRWSDYTLHLPTGSDV
FT                   AKHWMLHFPRVTYPLVHLANWLCGLNLFWVCKACFRCLKRLKMSWFLPTVLDTGQGFKL
FT                   VKS"
FT   CDS             complement(join(10405720..10406267,10414203..10414477,
FT                   10417877..10417995))
FT                   /codon_start=1
FT                   /gene="8430437G11Rik"
FT                   /locus_tag="mCG_12227"
FT                   /product="RIKEN cDNA 8430437G11, isoform CRA_b"
FT                   /note="gene_id=mCG12227.2 transcript_id=mCT175572.0
FT                   protein_id=mCP98494.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR029713"
FT                   /db_xref="MGI:MGI:1921794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N4SW50"
FT                   /protein_id="EDL13910.1"
FT                   /translation="MFLIVLPLESMAHGLFHELGNCLGGTSVGYAIVIPTNFCSPDGQP
FT                   TLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSKLKAFLELR
FT                   TVDGPRHDTYVLYYSGHTHGSGEWALAGGDILRLDTLLEWWREKNGSFCSRLIIILDSE
FT                   NSTPWVKEVRKINDQYVAVQGAELAKTVDIEEADPPQLGDFTRDWVEYNCNSTNNICWT
FT                   EKGRTVRAVYGVSKRWSDYTLHLPTGSDVAKHWMLHFPRVTYPLVHLANWLCGLNLFWV
FT                   CKACFRCLKRLKMSWFLPTVLDTGQGFKLVKS"
FT   assembly_gap    10444839..10444935
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            complement(10448409..10500954)
FT                   /gene="B630005N14Rik"
FT                   /locus_tag="mCG_12231"
FT                   /note="gene_id=mCG12231.2"
FT   mRNA            complement(join(10448409..10452090,10453580..10453694,
FT                   10464677..10464847,10486212..10486353,10500667..10500954))
FT                   /gene="B630005N14Rik"
FT                   /locus_tag="mCG_12231"
FT                   /product="RIKEN cDNA B630005N14"
FT                   /note="gene_id=mCG12231.2 transcript_id=mCT16800.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(10451461..10452090,10453580..10453694,
FT                   10464677..10464847,10486212..10486353,10500667..10500820))
FT                   /codon_start=1
FT                   /gene="B630005N14Rik"
FT                   /locus_tag="mCG_12231"
FT                   /product="RIKEN cDNA B630005N14"
FT                   /note="gene_id=mCG12231.2 transcript_id=mCT16800.2
FT                   protein_id=mCP15804.1"
FT                   /protein_id="EDL13908.1"
FT                   /translation="MEPGPGGRGAARGQRPPNAAQPREQERKLEQEKLSGVVKSVHRRL
FT                   RKKYREVGDFDKIWREHCEDAETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREY
FT                   FQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPLTNLSFTSPDFITELLQASGK
FT                   IRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLK
FT                   QLRNPIDALPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQ
FT                   NRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKTSLKTTSDLVSRNYPGMLYIPQ
FT                   DFNSVEEEEYSNTSCYVRSDLEDEQLAYGFTELPEAPYDSDSGESQASSIPFYELEDPI
FT                   LLLS"
FT   assembly_gap    10479718..10479818
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    10488434..10488453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10518463..10518482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10533227..10533246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10564567..10564717
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    10572278..10574021
FT                   /estimated_length=1744
FT                   /gap_type="unknown"
FT   assembly_gap    10590783..10595306
FT                   /estimated_length=4524
FT                   /gap_type="unknown"
FT   assembly_gap    10605459..10605689
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    10626475..10628412
FT                   /estimated_length=1938
FT                   /gap_type="unknown"
FT   assembly_gap    10644875..10644962
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    10651908..10652041
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(10657089..10662597)
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /note="gene_id=mCG53921.1"
FT   mRNA            complement(join(10657089..10659755,10661284..10661903,
FT                   10662366..10662597))
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, transcript variant
FT                   mCT175780"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT175780.0 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(10657089..10659755,10660681..10660804,
FT                   10661284..10661903,10662366..10662597))
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, transcript variant
FT                   mCT54104"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT54104.1 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(10657089..10659755,10661003..10661163))
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, transcript variant
FT                   mCT175781"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT175781.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(10658473..10659585)
FT                   /codon_start=1
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, isoform CRA_a"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT175781.0
FT                   protein_id=mCP98703.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6ZWR2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1927851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWR2"
FT                   /protein_id="EDL13905.1"
FT                   /translation="MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILL
FT                   VKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLS
FT                   CFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTY
FT                   SFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVA
FT                   AVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEK
FT                   RISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCI
FT                   FSNRELRRCFSTTLLYCRKSRLPREPYCVI"
FT   CDS             complement(10658473..10659585)
FT                   /codon_start=1
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, isoform CRA_a"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT175780.0
FT                   protein_id=mCP98702.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6ZWR2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1927851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWR2"
FT                   /protein_id="EDL13906.1"
FT                   /translation="MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILL
FT                   VKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLS
FT                   CFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTY
FT                   SFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVA
FT                   AVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEK
FT                   RISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCI
FT                   FSNRELRRCFSTTLLYCRKSRLPREPYCVI"
FT   CDS             complement(10658473..10659585)
FT                   /codon_start=1
FT                   /gene="Gpr85"
FT                   /locus_tag="mCG_53921"
FT                   /product="G protein-coupled receptor 85, isoform CRA_a"
FT                   /note="gene_id=mCG53921.1 transcript_id=mCT54104.1
FT                   protein_id=mCP36664.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6ZWR2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1927851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWR2"
FT                   /protein_id="EDL13907.1"
FT                   /translation="MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILL
FT                   VKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLS
FT                   CFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTY
FT                   SFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVA
FT                   AVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEK
FT                   RISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCI
FT                   FSNRELRRCFSTTLLYCRKSRLPREPYCVI"
FT   assembly_gap    10660950..10660969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10672764..10672835
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10686253..10686421
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(10691814..>10694206)
FT                   /gene="2610001J05Rik"
FT                   /locus_tag="mCG_145207"
FT                   /note="gene_id=mCG145207.0"
FT   mRNA            complement(join(10691814..10693480,10693796..10693886,
FT                   10694179..>10694206))
FT                   /gene="2610001J05Rik"
FT                   /locus_tag="mCG_145207"
FT                   /product="RIKEN cDNA 2610001J05"
FT                   /note="gene_id=mCG145207.0 transcript_id=mCT184631.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10692245..>10692484)
FT                   /codon_start=1
FT                   /gene="2610001J05Rik"
FT                   /locus_tag="mCG_145207"
FT                   /product="RIKEN cDNA 2610001J05"
FT                   /note="gene_id=mCG145207.0 transcript_id=mCT184631.0
FT                   protein_id=mCP105351.0"
FT                   /protein_id="EDL13904.1"
FT                   /translation="KGTGYVTLKDHHGQEMGIFEIDEDSDRKSTNRKGSVLICTPAKKV
FT                   YPLCPSNSKSPQTNRLQRFLIHIFGPRTNILARI"
FT   gene            <10694309..10719154
FT                   /locus_tag="mCG_146156"
FT                   /note="gene_id=mCG146156.0"
FT   mRNA            join(<10694309..10694367,10704004..10704112,
FT                   10717824..10719154)
FT                   /locus_tag="mCG_146156"
FT                   /product="mCG146156"
FT                   /note="gene_id=mCG146156.0 transcript_id=mCT186259.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    10698936..10698955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<10704064..10704112,10717824..10717996)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146156"
FT                   /product="mCG146156"
FT                   /note="gene_id=mCG146156.0 transcript_id=mCT186259.0
FT                   protein_id=mCP107370.0"
FT                   /protein_id="EDL13903.1"
FT                   /translation="DNPVFGSQVFNICLSTGCNSHLLLQNQVYMKPCACCHASHLDDNG
FT                   LTSGNKPPNYMLSFIRIALAMVFFTAIK"
FT   assembly_gap    10761307..10761326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10774687..10774706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10823392..10824135
FT                   /estimated_length=744
FT                   /gap_type="unknown"
FT   assembly_gap    10826518..10826537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10828530..10828823
FT                   /pseudo
FT                   /locus_tag="mCG_63574"
FT                   /note="gene_id=mCG63574.1"
FT   mRNA            10828530..10828823
FT                   /pseudo
FT                   /locus_tag="mCG_63574"
FT                   /note="gene_id=mCG63574.1 transcript_id=mCT63757.1 created
FT                   on 13-NOV-2002"
FT   assembly_gap    10828957..10828976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10846344..10846363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10878557..10878576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10904032..10904339)
FT                   /pseudo
FT                   /locus_tag="mCG_1029472"
FT                   /note="gene_id=mCG1029472.1"
FT   mRNA            complement(10904032..10904339)
FT                   /pseudo
FT                   /locus_tag="mCG_1029472"
FT                   /note="gene_id=mCG1029472.1 transcript_id=mCT147176.1
FT                   created on 13-NOV-2002"
FT   assembly_gap    10911787..10912291
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    10965886..10966003
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    10972513..10972590
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    11019149..11019168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11046081..11046100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11105581..11105643
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    11130837..11132561
FT                   /estimated_length=1725
FT                   /gap_type="unknown"
FT   assembly_gap    11136288..11136307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11138908..11138927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11292387..11292533
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    11309070..11309089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11347338..11347357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11348571..11348590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11362697..11362716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11372062..11372139
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    11378205..11378545
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    11440350..11440391
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    11444975..11444998
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    11451165..11451751
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    11458444..11458732
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    11459125..11459144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11471874..11473314
FT                   /estimated_length=1441
FT                   /gap_type="unknown"
FT   assembly_gap    11505508..11508258
FT                   /estimated_length=2751
FT                   /gap_type="unknown"
FT   assembly_gap    11513677..11513717
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11519123..11519433
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    11526598..11527385
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    11535771..11535790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11535873..11577603)
FT                   /gene="Ppp1r3a"
FT                   /locus_tag="mCG_1805"
FT                   /note="gene_id=mCG1805.2"
FT   mRNA            complement(join(11535873..11542232,11544145..11544269,
FT                   11544366..11544427,11576754..11577603))
FT                   /gene="Ppp1r3a"
FT                   /locus_tag="mCG_1805"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3A"
FT                   /note="gene_id=mCG1805.2 transcript_id=mCT7791.1 created on
FT                   06-AUG-2002"
FT   CDS             complement(join(11539935..11542232,11544145..11544269,
FT                   11544366..11544427,11576754..11577538))
FT                   /codon_start=1
FT                   /gene="Ppp1r3a"
FT                   /locus_tag="mCG_1805"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3A"
FT                   /note="gene_id=mCG1805.2 transcript_id=mCT7791.1
FT                   protein_id=mCP15811.1"
FT                   /db_xref="GOA:Q99MR9"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="MGI:MGI:2153588"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99MR9"
FT                   /protein_id="EDL13902.1"
FT                   /translation="MEPAEEPGQISKDNFLEVPNLSDSVCEDEEVKATFKPGFSPQPSR
FT                   RGSGSSEDMYLDTPTSASRRVSFADSLGFSLVSVKEFDCWELPSVSTDFDLSGDVFHTD
FT                   EYVLSPLFDLPSSKEKLMEQLQVQKAVLESAEHLPGSSMKGIIRVLNISFEKLVYVRMS
FT                   LDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKEGGKVEFCIRYETSAGTFWSN
FT                   NNGTNYILVCQKKRKEPEPVKPLEEAPSRQIKGCLKVKSRSKEEPLLAPEENKFETLKF
FT                   TESYIPTIICSHEDKDDLGANHPNVDDINKKHDEHNGKELDLMINQRLITSQDEKNTFA
FT                   TDTVNFTNKAEGSEKKQAYHEINTDLFMGPLSPSLSAESSLKRDFYHSRSSSPGNEYGH
FT                   PHSEEIISDMGEKGPSLGDTSSDELMQLELCSKEDLDDNANPANGSGRVCSSFDQRMAC
FT                   GLKNNEAGIKKTGIQDYKYSHGDSTKLEESNASSRDDYAKVDNKKEKQTCLGVNENPSK
FT                   NFQSVFQTQEGHMGYPKISTEGDKANNQDLTSLLSKDITANTWAVTVDPCPSTNAKRSW
FT                   REVGSGSNLEPGTSDLSSPRNFSPLTDDHLFQADRENSDSSNPENQNMNTRHRKKWNVL
FT                   ETQSETSETESDIAKHTKEQAEYKDMWEKTDNSRNLKATPTEHLFTCRETECYGLSSLA
FT                   DHGITEKAQAVTAYIIKTTLESTPESASARGKAIIAKLPQETAGNDRPIEVKETAFDPH
FT                   EGRKDDSHYSLCHGDTAGVIHDNDFERESHLDICNLRVDEMKKEKTTSTCFPQKTYDKE
FT                   KHGIGSVTSIDEPSQVITGNQKATSKLDLHLGVLPTDRAIFQANADLELLQELSRRTDF
FT                   NAVPSAFNSDTASASRDSSQVYRHCSKKSVPSYGEEKAVTNTTLQSIPTKSEYNWHPES
FT                   EVLGHAMSKPEDVFKSSEIMKSGSGGERGGGPILQQKEGSLENSQGPMFFTNEPLENLD
FT                   EASSENEGLMHSGQSQCYLGDKGLVSSASATVSTQELEAQGRESLLSISTNSKIPYFLL
FT                   FLIFLATVYYYDLMIGLAFYLFSLYWLYWEGGRQRESVKKK"
FT   assembly_gap    11579304..11579323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11588787..11589156
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    11614874..11625262
FT                   /estimated_length=10389
FT                   /gap_type="unknown"
FT   assembly_gap    11629366..11629385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11658428..11658466
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    11677649..11678633
FT                   /estimated_length=985
FT                   /gap_type="unknown"
FT   assembly_gap    11680520..11680539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11699291..11700458
FT                   /estimated_length=1168
FT                   /gap_type="unknown"
FT   assembly_gap    11707769..11707788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11722476..12261470
FT                   /gene="Foxp2"
FT                   /locus_tag="mCG_140788"
FT                   /note="gene_id=mCG140788.1"
FT   mRNA            join(11722476..11722885,11808971..11809112,
FT                   11905413..11905506,12018323..12018500,12108074..12108163,
FT                   12198011..12198148,12199210..12199410,12200975..12201149,
FT                   12215977..12216190,12218076..12218180,12225165..12225252,
FT                   12226895..12226978,12231077..12231278,12232362..12232438,
FT                   12232578..12232679,12235137..12235258,12236371..12236440,
FT                   12237206..12237369,12259168..12261470)
FT                   /gene="Foxp2"
FT                   /locus_tag="mCG_140788"
FT                   /product="forkhead box P2, transcript variant mCT171517"
FT                   /note="gene_id=mCG140788.1 transcript_id=mCT171517.1
FT                   created on 12-NOV-2002"
FT   mRNA            join(<11722511..11722885,11808971..11809112,
FT                   11905413..11905506,12018323..12018500,12108074..12108163,
FT                   12198011..12198148,12199192..12199340,12200975..12201149,
FT                   12215977..12216190,12218076..12218180,12225165..12225252,
FT                   12226895..12226978,12231077..12231278,12232362..12232438,
FT                   12232578..12233274)
FT                   /gene="Foxp2"
FT                   /locus_tag="mCG_140788"
FT                   /product="forkhead box P2, transcript variant mCT190715"
FT                   /note="gene_id=mCG140788.1 transcript_id=mCT190715.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    11752136..11752241
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    11764149..11764168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11769439..11770041
FT                   /pseudo
FT                   /locus_tag="mCG_55975"
FT                   /note="gene_id=mCG55975.2"
FT   mRNA            11769439..11770041
FT                   /pseudo
FT                   /locus_tag="mCG_55975"
FT                   /note="gene_id=mCG55975.2 transcript_id=mCT56158.2 created
FT                   on 12-NOV-2002"
FT   assembly_gap    11782158..11785010
FT                   /estimated_length=2853
FT                   /gap_type="unknown"
FT   assembly_gap    11801820..11802071
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    11815741..11815760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11826814..11826833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11844134..11844153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11876891..11877291
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    11910223..11910242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11928649..11928668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11966236..11966255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11967358..11967587
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    11970574..11970593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11984820..11984839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11991344..11991363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11994011..11995085
FT                   /estimated_length=1075
FT                   /gap_type="unknown"
FT   assembly_gap    11996021..11996605
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   CDS             join(12018333..12018500,12108074..12108163,
FT                   12198011..12198148,12199210..12199410,12200975..12201149,
FT                   12215977..12216190,12218076..12218180,12225165..12225252,
FT                   12226895..12226978,12231077..12231278,12232362..12232438,
FT                   12232578..12232679,12235137..12235258,12236371..12236440,
FT                   12237206..12237369,12259168..12259312)
FT                   /codon_start=1
FT                   /gene="Foxp2"
FT                   /locus_tag="mCG_140788"
FT                   /product="forkhead box P2, isoform CRA_b"
FT                   /note="gene_id=mCG140788.1 transcript_id=mCT171517.1
FT                   protein_id=mCP94436.1 isoform=CRA_b"
FT                   /protein_id="EDL13900.1"
FT                   /translation="MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVS
FT                   TVELLHLQQQQALQAARQLLLQQQTSGLKSPKSSEKQRPLQVPVSVAMMTPQVITPQQM
FT                   QQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQLAAQQLVFQQQLLQ
FT                   MQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDN
FT                   GIKHGGLDLTTNNSSSTTSSTTSKASPPITHHSIVNGQSSVLNARRDSSSHEETGASHT
FT                   LYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERE
FT                   RLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQ
FT                   GPSVITPASVPNVGAIRRRHSDKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIM
FT                   ESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDE
FT                   VEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSG
FT                   LLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANH
FT                   SPELEDDREIEEEPLSEDLE"
FT   assembly_gap    12051571..12051590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<12108145..12108163,12198011..12198148,
FT                   12199192..12199340,12200975..12201149,12215977..12216190,
FT                   12218076..12218180,12225165..12225252,12226895..12226978,
FT                   12231077..12231278,12232362..12232438,12232578..12232775)
FT                   /codon_start=1
FT                   /gene="Foxp2"
FT                   /locus_tag="mCG_140788"
FT                   /product="forkhead box P2, isoform CRA_a"
FT                   /note="gene_id=mCG140788.1 transcript_id=mCT190715.0
FT                   protein_id=mCP111674.0 isoform=CRA_a"
FT                   /protein_id="EDL13899.1"
FT                   /translation="EAEATAGARVGGHDDSPSDHPSADAADSSAAGPVSSAAPGPPPAA
FT                   ASCDVAAVKMVYSATTTRVLQETARTVTSSAFATAATAAAATAATAAAAAATTAAAAQQ
FT                   QQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGL
FT                   SPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSTTSKASPPITHHSIVNGQ
FT                   SSVLNARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTA
FT                   QCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLET
FT                   SPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSEIAPNYEF
FT                   YKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKVTPKSSC
FT                   SPSETQHSSFQIAPGAFIYMTQAD"
FT   assembly_gap    12117357..12117376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12155559..12155578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12195237..12196007
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   gene            12205761..12206686
FT                   /locus_tag="mCG_147465"
FT                   /note="gene_id=mCG147465.0"
FT   mRNA            12205761..12206686
FT                   /locus_tag="mCG_147465"
FT                   /product="mCG147465"
FT                   /note="gene_id=mCG147465.0 transcript_id=mCT187728.0
FT                   created on 13-JAN-2004"
FT   CDS             12206169..12206363
FT                   /codon_start=1
FT                   /locus_tag="mCG_147465"
FT                   /product="mCG147465"
FT                   /note="gene_id=mCG147465.0 transcript_id=mCT187728.0
FT                   protein_id=mCP108220.0"
FT                   /protein_id="EDL13901.1"
FT                   /translation="MPTPLPSSLLLWGIKPSQDQGLPFQLMPDKAIFCYLCSKSQGALP
FT                   VFSLVGGVVPGSSGREGEV"
FT   assembly_gap    12240661..12240680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12267956..12268371
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    12269769..12269788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12273880..12274070
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    12276200..12276219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12293318..12293407
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    12329985..12330532
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    12331326..12331358
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    12340549..12344165
FT                   /estimated_length=3617
FT                   /gap_type="unknown"
FT   assembly_gap    12345489..12345539
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    12352361..12352380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12374040..12374449
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    12376228..12376661
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    12377998..12378017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12379546..12379565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12395701..12397052
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   assembly_gap    12398416..12399148
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   assembly_gap    12400709..12400728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12424524..12424543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12425006..12425523
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    12437607..12438048
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    12441215..12441653
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    12473495..12473514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12489707..12489726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12503287..12503375
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    12506886..12508635
FT                   /estimated_length=1750
FT                   /gap_type="unknown"
FT   assembly_gap    12510548..12510726
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            12540562..12622137
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /note="gene_id=mCG123722.2"
FT   mRNA            join(12540562..12540858,12541082..12541259,
FT                   12560892..12561014,12590169..12590447,12619576..12620887,
FT                   12620908..12622137)
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing,
FT                   transcript variant mCT124957"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT124957.2
FT                   created on 17-JUN-2003"
FT   mRNA            join(<12541067..12541259,12560892..12561014,
FT                   12590169..12590447,12619576..12620766)
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing,
FT                   transcript variant mCT190730"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT190730.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<12541067..12541259,12560892..12561014,
FT                   12590169..12590447,12619576..12619823)
FT                   /codon_start=1
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT190730.0
FT                   protein_id=mCP111669.0 isoform=CRA_c"
FT                   /protein_id="EDL13898.1"
FT                   /translation="CFSRQRQAVSCTQHLSSWGPCTPRGRLWLGAWPMSCAGEALAPGP
FT                   AEQQCPVEAGGGRLGSPAHEACNEDNTEKDKRPATSGHTRCGLMRDQSIWPNPSAGELV
FT                   RTQPERLPQLQTSAQEPGKEETGKIKNGGHTRMSNGNGIPHGAKHVSVENHKISAPVSQ
FT                   KMHRKIQSSLSVNNDISKKSKVNAVFSPKAASSPEDCCVHCILACLFCEFLTLCNIVLG
FT                   QASCGICTSEACCCCCGDEMGDDCSCPCDMDCGIMDACCESSDCLEICMECCGICFPS"
FT   CDS             join(12541166..12541259,12560892..12561014,
FT                   12590169..12590447,12619576..12619823)
FT                   /codon_start=1
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT124957.2
FT                   protein_id=mCP44845.2 isoform=CRA_a"
FT                   /protein_id="EDL13896.1"
FT                   /translation="MSCAGEALAPGPAEQQCPVEAGGGRLGSPAHEACNEDNTEKDKRP
FT                   ATSGHTRCGLMRDQSIWPNPSAGELVRTQPERLPQLQTSAQEPGKEETGKIKNGGHTRM
FT                   SNGNGIPHGAKHVSVENHKISAPVSQKMHRKIQSSLSVNNDISKKSKVNAVFSPKAASS
FT                   PEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCSCPCDMDCG
FT                   IMDACCESSDCLEICMECCGICFPS"
FT   assembly_gap    12542094..12542113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(12547702..12547965,12560892..12561014,
FT                   12590169..12590447,12619576..12620887,12620908..12622137)
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing,
FT                   transcript variant mCT175771"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT175771.1
FT                   created on 17-JUN-2003"
FT   CDS             join(12547887..12547965,12560892..12561014,
FT                   12590169..12590447,12619576..12619823)
FT                   /codon_start=1
FT                   /gene="Mdfic"
FT                   /locus_tag="mCG_123722"
FT                   /product="MyoD family inhibitor domain containing, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG123722.2 transcript_id=mCT175771.1
FT                   protein_id=mCP98693.1 isoform=CRA_b"
FT                   /protein_id="EDL13897.1"
FT                   /translation="MEERGTKDKYPGDVAGVSLYSLDIISEACNEDNTEKDKRPATSGH
FT                   TRCGLMRDQSIWPNPSAGELVRTQPERLPQLQTSAQEPGKEETGKIKNGGHTRMSNGNG
FT                   IPHGAKHVSVENHKISAPVSQKMHRKIQSSLSVNNDISKKSKVNAVFSPKAASSPEDCC
FT                   VHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCSCPCDMDCGIMDAC
FT                   CESSDCLEICMECCGICFPS"
FT   assembly_gap    12559184..12559203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12576525..12576878
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    12620888..12620907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12645131..12645150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12663983..12664271
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    12673880..12673899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12704591..12704895
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    12719825..12720031
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    12725230..12725249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12730542..12730561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12732529..12732556
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12780017..12780094
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    12808952..12808971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12814030..12814049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12823233..12824194
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    12833890..12834486
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    12836759..12836895
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    12845441..12845460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12902593..12903131
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    12903973..12903992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12925630..12925970
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    12927622..12927852
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    12930363..12930482
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    12933774..12933946
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    13045021..13045193
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            13059285..13059898
FT                   /pseudo
FT                   /locus_tag="mCG_49151"
FT                   /note="gene_id=mCG49151.1"
FT   mRNA            13059285..13059898
FT                   /pseudo
FT                   /locus_tag="mCG_49151"
FT                   /note="gene_id=mCG49151.1 transcript_id=mCT49334.2 created
FT                   on 12-NOV-2002"
FT   assembly_gap    13068731..13068792
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    13089646..13090812
FT                   /estimated_length=1167
FT                   /gap_type="unknown"
FT   assembly_gap    13134555..13134574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13178776..13178795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13213590..13214166
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   assembly_gap    13248150..13248169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13255019..13255038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13329165..13329184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13358295..13358314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13363617..13363636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13406072..13406091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13414299..13414318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13430268..13430391
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    13437977..13442633
FT                   /estimated_length=4657
FT                   /gap_type="unknown"
FT   assembly_gap    13472377..13472399
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    13478297..13478466
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    13492181..13492200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13514871..13514890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13528430..13528449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13558291..13558310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13591974..13591993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13617633..13617652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13645953..13710841)
FT                   /gene="Tcfec"
FT                   /locus_tag="mCG_13659"
FT                   /note="gene_id=mCG13659.1"
FT   mRNA            complement(join(13645953..13646892,13647765..13647912,
FT                   13653034..13653109,13656760..13656816,13657929..13658043,
FT                   13679871..13680122,13710661..13710841))
FT                   /gene="Tcfec"
FT                   /locus_tag="mCG_13659"
FT                   /product="transcription factor EC, transcript variant
FT                   mCT16742"
FT                   /note="gene_id=mCG13659.1 transcript_id=mCT16742.1 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(13645953..13646892,13647765..13647912,
FT                   13656760..13656816,13657929..13658043,13679871..13680122,
FT                   13710661..>13710799))
FT                   /gene="Tcfec"
FT                   /locus_tag="mCG_13659"
FT                   /product="transcription factor EC, transcript variant
FT                   mCT190740"
FT                   /note="gene_id=mCG13659.1 transcript_id=mCT190740.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(13646515..13646892,13647765..13647912,
FT                   13653034..13653109,13656760..13656816,13657929..13658043,
FT                   13679871..13680050))
FT                   /codon_start=1
FT                   /gene="Tcfec"
FT                   /locus_tag="mCG_13659"
FT                   /product="transcription factor EC, isoform CRA_b"
FT                   /note="gene_id=mCG13659.1 transcript_id=mCT16742.1
FT                   protein_id=mCP15817.2 isoform=CRA_b"
FT                   /protein_id="EDL13895.1"
FT                   /translation="MTFDCRVCDQTLKRAQPPAASCMPLAEHEPMSPDSDAGCAGNPFT
FT                   NLLALGKKDGAEKWHLSGSILDVYSDEQGISSANAGLTDAPCPSILPMRKEIAETDGRA
FT                   LAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVDYIKWL
FT                   QKEQQRARELEHRQKKLEHANRQLRLRIQELEIQARAHGLPILASLGTADVGTHITKQQ
FT                   THPERNLGGCCLQLTPTQGTSPEFYEQAVAFSDPLSHFTDLSFSAALKEEQRLDGMLLS
FT                   DTICPFGTDPLLSAISPAVSKASSRSSLSSEDGDEL"
FT   CDS             complement(join(13646515..13646892,13647765..13647912,
FT                   13656760..>13656803))
FT                   /codon_start=1
FT                   /gene="Tcfec"
FT                   /locus_tag="mCG_13659"
FT                   /product="transcription factor EC, isoform CRA_a"
FT                   /note="gene_id=mCG13659.1 transcript_id=mCT190740.0
FT                   protein_id=mCP111673.0 isoform=CRA_a"
FT                   /protein_id="EDL13894.1"
FT                   /translation="SFGKGETEKGQPQPHDMRWNKGTILKASVDYIKWLQKEQQRAREL
FT                   EHRQKKLEHANRQLRLRIQELEIQARAHGLPILASLGTADVGTHITKQQTHPERNLGGC
FT                   CLQLTPTQGTSPEFYEQAVAFSDPLSHFTDLSFSAALKEEQRLDGMLLSDTICPFGTDP
FT                   LLSAISPAVSKASSRSSLSSEDGDEL"
FT   assembly_gap    13690976..13690995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13735794..13736803
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   gene            13737657..13739342
FT                   /pseudo
FT                   /locus_tag="mCG_50945"
FT                   /note="gene_id=mCG50945.2"
FT   mRNA            13737657..13739342
FT                   /pseudo
FT                   /locus_tag="mCG_50945"
FT                   /note="gene_id=mCG50945.2 transcript_id=mCT51128.2 created
FT                   on 21-FEB-2003"
FT   assembly_gap    13762231..13762732
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    13765691..13765732
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    13788872..13788891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13801417..13801437
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13817097..13821559
FT                   /estimated_length=4463
FT                   /gap_type="unknown"
FT   assembly_gap    13822699..13822753
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    13825277..13825296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13826301..13826712
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    13827588..13829709
FT                   /estimated_length=2122
FT                   /gap_type="unknown"
FT   assembly_gap    13843209..13843354
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    13857737..13857756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13868908..13909714
FT                   /gene="Tes"
FT                   /locus_tag="mCG_11251"
FT                   /note="gene_id=mCG11251.2"
FT   mRNA            join(13868908..13869027,13884807..13884954,
FT                   13886365..13886531,13890025..13890110,13900020..13900272,
FT                   13901154..13901483,13903597..13903812,13904175..13904333,
FT                   13908486..13909714)
FT                   /gene="Tes"
FT                   /locus_tag="mCG_11251"
FT                   /product="testis derived transcript, transcript variant
FT                   mCT171487"
FT                   /note="gene_id=mCG11251.2 transcript_id=mCT171487.0 created
FT                   on 05-AUG-2002"
FT   mRNA            join(13868908..13869027,13890025..13890110,
FT                   13900020..13900272,13901154..13901483,13903597..13903812,
FT                   13904175..13904333,13908486..13909714)
FT                   /gene="Tes"
FT                   /locus_tag="mCG_11251"
FT                   /product="testis derived transcript, transcript variant
FT                   mCT11168"
FT                   /note="gene_id=mCG11251.2 transcript_id=mCT11168.1 created
FT                   on 05-AUG-2002"
FT   CDS             join(13869001..13869027,13890025..13890110,
FT                   13900020..13900272,13901154..13901483,13903597..13903812,
FT                   13904175..13904333,13908486..13908674)
FT                   /codon_start=1
FT                   /gene="Tes"
FT                   /locus_tag="mCG_11251"
FT                   /product="testis derived transcript, isoform CRA_a"
FT                   /note="gene_id=mCG11251.2 transcript_id=mCT11168.1
FT                   protein_id=mCP15809.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q921W7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR010442"
FT                   /db_xref="InterPro:IPR027683"
FT                   /db_xref="InterPro:IPR033724"
FT                   /db_xref="MGI:MGI:105081"
FT                   /db_xref="UniProtKB/TrEMBL:Q921W7"
FT                   /protein_id="EDL13892.1"
FT                   /translation="MDLETKMKKMGLGHEQGFGAPCLKCKENCEGFELHFWRKICRNCK
FT                   CGQEEHDVLLSNEEDRKVGRLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNV
FT                   SINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSK
FT                   CHELSPKEVKEMEQFVKKYKSEALGVGDVKFPSEMNAQGDKVHNPAGNRHAPAAVASKD
FT                   KSAESKKTQYSCYCCKHTMNEGEPAIYAERAGYDKLWHPACFICSTCGELLVDMIYFWK
FT                   NGKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDHILAGKIYVM
FT                   VTDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQ
FT                   KFMPVEGMVFCSVECKRMMS"
FT   assembly_gap    13876711..13877024
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   gene            complement(13880150..>13975712)
FT                   /gene="B930018B01"
FT                   /locus_tag="mCG_1029692"
FT                   /note="gene_id=mCG1029692.1"
FT   mRNA            complement(join(13880150..13881784,13891006..13891131,
FT                   13975248..>13975712))
FT                   /gene="B930018B01"
FT                   /locus_tag="mCG_1029692"
FT                   /product="hypothetical protein B930018B01"
FT                   /note="gene_id=mCG1029692.1 transcript_id=mCT147396.1
FT                   created on 26-MAR-2003"
FT   CDS             join(13890025..13890110,13900020..13900272,
FT                   13901154..13901483,13903597..13903812,13904175..13904333,
FT                   13908486..13908674)
FT                   /codon_start=1
FT                   /gene="Tes"
FT                   /locus_tag="mCG_11251"
FT                   /product="testis derived transcript, isoform CRA_b"
FT                   /note="gene_id=mCG11251.2 transcript_id=mCT171487.0
FT                   protein_id=mCP94406.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3ULB1"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR010442"
FT                   /db_xref="InterPro:IPR033724"
FT                   /db_xref="MGI:MGI:105081"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ULB1"
FT                   /protein_id="EDL13893.1"
FT                   /translation="MGLGHEQGFGAPCLKCKENCEGFELHFWRKICRNCKCGQEEHDVL
FT                   LSNEEDRKVGRLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEW
FT                   APPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEV
FT                   KEMEQFVKKYKSEALGVGDVKFPSEMNAQGDKVHNPAGNRHAPAAVASKDKSAESKKTQ
FT                   YSCYCCKHTMNEGEPAIYAERAGYDKLWHPACFICSTCGELLVDMIYFWKNGKLYCGRH
FT                   YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDHILAGKIYVMVTDKPVCKP
FT                   CYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMV
FT                   FCSVECKRMMS"
FT   assembly_gap    13913730..13913749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13915872..13916081
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    13927210..13927375
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    13949745..13949904
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    13954142..13954270
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13956541..13956560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13972407..13972426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(13975296..>13975712)
FT                   /codon_start=1
FT                   /gene="B930018B01"
FT                   /locus_tag="mCG_1029692"
FT                   /product="hypothetical protein B930018B01"
FT                   /note="gene_id=mCG1029692.1 transcript_id=mCT147396.1
FT                   protein_id=mCP45021.1"
FT                   /protein_id="EDL13891.1"
FT                   /translation="VCVCVLFLPSLCSHMAVFPFCLFSHFPSKYFASSGRLCQAEVGSL
FT                   EDCIPLICGIRLLPWQRLLTRRNTSRSWAIPSSFLPLLHMLGYSDSHTGPERAFSNRKL
FT                   CSWNVNFILFAFQDTEVFGSVYFCSRWAGPSCLF"
FT   assembly_gap    13981443..13981513
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    13992671..13992690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14002052..14014058
FT                   /locus_tag="mCG_144642"
FT                   /note="gene_id=mCG144642.0"
FT   mRNA            join(<14002052..14002119,14005641..14006043,
FT                   14012819..14013030,14013805..14014058)
FT                   /locus_tag="mCG_144642"
FT                   /product="mCG144642"
FT                   /note="gene_id=mCG144642.0 transcript_id=mCT184066.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    14003534..14003564
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   CDS             join(<14005866..14006043,14012819..14012928)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144642"
FT                   /product="mCG144642"
FT                   /note="gene_id=mCG144642.0 transcript_id=mCT184066.0
FT                   protein_id=mCP105346.0"
FT                   /protein_id="EDL13890.1"
FT                   /translation="GIWIFIPLTRLQSPYLFRVFPGKEEKSPIHSHLFASSSRASRPQK
FT                   AQDYNIIPETAKTLGLYNTCAQYPRKPEEDIRTPGLALQTVLFHHLSTEN"
FT   gene            complement(14010735..14194639)
FT                   /locus_tag="mCG_1050983"
FT                   /note="gene_id=mCG1050983.0"
FT   mRNA            complement(join(14010735..14015459,14016875..14017190,
FT                   14017954..14018194,14018774..14018983,14194501..14194639))
FT                   /locus_tag="mCG_1050983"
FT                   /product="mCG1050983"
FT                   /note="gene_id=mCG1050983.0 transcript_id=mCT194772.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(14014351..14014608)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050983"
FT                   /product="mCG1050983"
FT                   /note="gene_id=mCG1050983.0 transcript_id=mCT194772.0
FT                   protein_id=mCP115801.0"
FT                   /protein_id="EDL13882.1"
FT                   /translation="MIHWGSTFNRNSGLFLLLLQVVNQRSFALLHANTALYFLTVDPRA
FT                   LRPTNHEPRPPNLSQNNPTSSPYTFLISNICCNNRKTTAT"
FT   assembly_gap    14037523..14037542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14038873..14046843
FT                   /estimated_length=7971
FT                   /gap_type="unknown"
FT   assembly_gap    14051282..14052439
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   assembly_gap    14077278..14077297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14084699..14092508
FT                   /gene="Cav2"
FT                   /locus_tag="mCG_13470"
FT                   /note="gene_id=mCG13470.2"
FT   mRNA            join(14084699..14084901,14085286..14085473,
FT                   14090288..14092508)
FT                   /gene="Cav2"
FT                   /locus_tag="mCG_13470"
FT                   /product="caveolin 2, transcript variant mCT11500"
FT                   /note="gene_id=mCG13470.2 transcript_id=mCT11500.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(14084699..14084901,14085286..14086075)
FT                   /gene="Cav2"
FT                   /locus_tag="mCG_13470"
FT                   /product="caveolin 2, transcript variant mCT171496"
FT                   /note="gene_id=mCG13470.2 transcript_id=mCT171496.0 created
FT                   on 05-AUG-2002"
FT   CDS             join(14084752..14084901,14085286..14085473,
FT                   14090288..14090438)
FT                   /codon_start=1
FT                   /gene="Cav2"
FT                   /locus_tag="mCG_13470"
FT                   /product="caveolin 2, isoform CRA_a"
FT                   /note="gene_id=mCG13470.2 transcript_id=mCT11500.2
FT                   protein_id=mCP16707.1 isoform=CRA_a"
FT                   /protein_id="EDL13888.1"
FT                   /translation="MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQL
FT                   NSHLKLGFEDLIAEPETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILF
FT                   ATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRSFSSVSMQLSHD"
FT   CDS             join(14084752..14084901,14085286..14085477)
FT                   /codon_start=1
FT                   /gene="Cav2"
FT                   /locus_tag="mCG_13470"
FT                   /product="caveolin 2, isoform CRA_b"
FT                   /note="gene_id=mCG13470.2 transcript_id=mCT171496.0
FT                   protein_id=mCP94415.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q924U4"
FT                   /db_xref="InterPro:IPR001612"
FT                   /db_xref="InterPro:IPR018361"
FT                   /db_xref="InterPro:IPR033306"
FT                   /db_xref="MGI:MGI:107571"
FT                   /db_xref="UniProtKB/TrEMBL:Q924U4"
FT                   /protein_id="EDL13889.1"
FT                   /translation="MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQL
FT                   NSHLKLGFEDLIAEPETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILF
FT                   ATLSCLHIW"
FT   gene            14109749..14145584
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /note="gene_id=mCG13467.2"
FT   mRNA            join(14109749..14109858,14111267..14111431,
FT                   14143373..14145584)
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, transcript variant
FT                   mCT11496"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT11496.1 created
FT                   on 05-AUG-2002"
FT   mRNA            join(14109749..14109858,14111267..14111431,
FT                   14143373..14143735,14144358..14144501)
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, transcript variant
FT                   mCT171495"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171495.0 created
FT                   on 05-AUG-2002"
FT   mRNA            join(14109749..14109858,14111267..14111431,
FT                   14121115..14121310,14131510..14131540)
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, transcript variant
FT                   mCT171494"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171494.0 created
FT                   on 05-AUG-2002"
FT   CDS             join(14109829..14109858,14111267..14111431,
FT                   14143373..14143714)
FT                   /codon_start=1
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT11496.1
FT                   protein_id=mCP16732.0 isoform=CRA_a"
FT                   /protein_id="EDL13883.1"
FT                   /translation="MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAH
FT                   TKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLS
FT                   TIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAI
FT                   GKIFSNIRISTQKEI"
FT   CDS             join(14109829..14109858,14111267..14111431,
FT                   14143373..14143714)
FT                   /codon_start=1
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171495.0
FT                   protein_id=mCP94413.0 isoform=CRA_a"
FT                   /protein_id="EDL13887.1"
FT                   /translation="MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAH
FT                   TKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLS
FT                   TIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAI
FT                   GKIFSNIRISTQKEI"
FT   CDS             join(14109829..14109858,14111267..14111431,
FT                   14121115..14121310,14131510..14131538)
FT                   /codon_start=1
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171494.0
FT                   protein_id=mCP94411.0 isoform=CRA_c"
FT                   /protein_id="EDL13886.1"
FT                   /translation="MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAH
FT                   TKEIDLVNRDPKHLNDDVVKTQRTWSPRTLGPHPRTPSILQQQQQMPVASGVSAKSALY
FT                   PSSYVLTAEDFKAFQTPLHCSLREKRGTVLGTSER"
FT   mRNA            join(14110664..14110704,14111267..14111431,
FT                   14143373..14145584)
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, transcript variant
FT                   mCT171493"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171493.0 created
FT                   on 05-AUG-2002"
FT   mRNA            join(14111109..14111431,14143373..14145584)
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, transcript variant
FT                   mCT171492"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171492.0 created
FT                   on 05-AUG-2002"
FT   CDS             join(14111330..14111431,14143373..14143714)
FT                   /codon_start=1
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171492.0
FT                   protein_id=mCP94412.0 isoform=CRA_b"
FT                   /protein_id="EDL13884.1"
FT                   /translation="MADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPE
FT                   GTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIK
FT                   SFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI"
FT   CDS             join(14111330..14111431,14143373..14143714)
FT                   /codon_start=1
FT                   /gene="Cav1"
FT                   /locus_tag="mCG_13467"
FT                   /product="caveolin, caveolae protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG13467.2 transcript_id=mCT171493.0
FT                   protein_id=mCP94414.0 isoform=CRA_b"
FT                   /protein_id="EDL13885.1"
FT                   /translation="MADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPE
FT                   GTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIK
FT                   SFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI"
FT   assembly_gap    14121496..14121515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14123732..14123751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14126800..14126884
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    14129051..14129070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14159729..14160641
FT                   /estimated_length=913
FT                   /gap_type="unknown"
FT   assembly_gap    14162277..14162296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14178519..14179947
FT                   /estimated_length=1429
FT                   /gap_type="unknown"
FT   assembly_gap    14206629..14206848
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    14245718..14245737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14246237..14246256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14296579..>14378214
FT                   /gene="Met"
FT                   /locus_tag="mCG_13466"
FT                   /note="gene_id=mCG13466.1"
FT   mRNA            join(<14296579..14297775,14320504..14320695,
FT                   14333467..14333601,14334230..14334403,14338577..14338737,
FT                   14341052..14341154,14341263..14341399,14342083..14342244,
FT                   14342979..14343078,14347020..14347238,14353532..14353678,
FT                   14355268..14355421,14355614..14355754,14359792..14360022,
FT                   14362100..14362180,14365262..14365443,14368666..14368775,
FT                   14370057..14370222,14377763..14377899,14378004..>14378214)
FT                   /gene="Met"
FT                   /locus_tag="mCG_13466"
FT                   /product="met proto-oncogene"
FT                   /note="gene_id=mCG13466.1 transcript_id=mCT11497.1 created
FT                   on 05-AUG-2002"
FT   CDS             join(14296579..14297775,14320504..14320695,
FT                   14333467..14333601,14334230..14334403,14338577..14338737,
FT                   14341052..14341154,14341263..14341399,14342083..14342244,
FT                   14342979..14343078,14347020..14347238,14353532..14353678,
FT                   14355268..14355421,14355614..14355754,14359792..14360022,
FT                   14362100..14362180,14365262..14365443,14368666..14368775,
FT                   14370057..14370222,14377763..14377899,14378004..14378214)
FT                   /codon_start=1
FT                   /gene="Met"
FT                   /locus_tag="mCG_13466"
FT                   /product="met proto-oncogene"
FT                   /note="gene_id=mCG13466.1 transcript_id=mCT11497.1
FT                   protein_id=mCP16741.1"
FT                   /protein_id="EDL13881.1"
FT                   /translation="MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPN
FT                   FTAETPIQNVVLHGHHIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSK
FT                   ANSSGGVWKDNINMALLVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFS
FT                   PEEESGQCPDCVVSALGAKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQ
FT                   DGFKFLTDQSYIDVLPEFQDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFC
FT                   SVDSGLHSYMEMPLECILTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDI
FT                   LFGVFAQSKPDSAEPVNRSAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNR
FT                   TLLRNSSGCEARSDEYRTEFTTALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSE
FT                   GRFMQVVLSRTAHLTPHVNFLLDSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGL
FT                   GCGHFQSCSQCLSAPYFIQCGWCHNQCVRFDECPSGTWTQEICLPAVYKVFPTSAPLEG
FT                   GTVLTICGWDFGFRKNNKFDLRKTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNV
FT                   SVIISNSRETTQYSAFSYVDPVITSISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGK
FT                   TCTLKSVSDSILECYTPAQTTSDEFPVKLKIDLANRETSSFSYREDPVVYEIHPTKSFI
FT                   SGGSTITGIGKTLNSVSLPKLVIDVHEVGVNYTVACQHRSNSEIICCTTPSLKQLGLQL
FT                   PLKTKAFFLLDGILSKHFDLTYVHNPVFEPFEKPVMISMGNENVVEIKGNNIDPEAVKG
FT                   EVLKVGNQSCESLHWHSGAVLCTVPSDLLKLNSELNIEWKQAVSSTVLGKVIVQPDQNF
FT                   AGLIIGAVSISVVVLLLSGLFLWMRKRKHKDLGSELVRYDARVHTPHLDRLVSARSVSP
FT                   TTEMVSNESVDYRATFPEDQFPNSSQNGACRQVQYPLTDLSPILTSGDSDISSPLLQNT
FT                   VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAV
FT                   KSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNF
FT                   IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLAR
FT                   DMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPD
FT                   VNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSIFSTFI
FT                   GEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT"
FT   assembly_gap    14316401..14316850
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    14386356..14386920
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   gene            14442682..14472622
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /note="gene_id=mCG13469.2"
FT   mRNA            join(14442682..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14462101,
FT                   14462830..14462909,14466402..14466480,14467752..14467827,
FT                   14470709..14470771,14470953..14472622)
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, transcript variant mCT178409"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT178409.0 created
FT                   on 07-JAN-2003"
FT   mRNA            join(14442682..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14462101,
FT                   14462830..14462909,14466402..14466480,14467752..14467823,
FT                   14470709..14470771,14470953..14472622)
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, transcript variant mCT11499"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT11499.2 created
FT                   on 07-JAN-2003"
FT   mRNA            join(14442682..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14465262)
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, transcript variant mCT178410"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT178410.0 created
FT                   on 07-JAN-2003"
FT   CDS             join(14442798..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14462101,
FT                   14462830..14462909,14466402..14466480,14467752..14467823,
FT                   14470709..14470771,14470953..14471093)
FT                   /codon_start=1
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, isoform CRA_c"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT11499.2
FT                   protein_id=mCP16743.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q5DQJ3"
FT                   /db_xref="InterPro:IPR002189"
FT                   /db_xref="InterPro:IPR017865"
FT                   /db_xref="MGI:MGI:106222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DQJ3"
FT                   /protein_id="EDL13880.1"
FT                   /translation="MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNL
FT                   LREGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKE
FT                   ATDPRPYEAENAIESWRTSVETALRAYVKEHYPNGVCTVYGKKVDGQQTIIACIESHQF
FT                   QAKNFWNGRWRSEWKFTVTPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEV
FT                   QTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGK
FT                   EMQNA"
FT   CDS             join(14442798..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14462101,
FT                   14462830..14462909,14466402..14466480,14467752..14467827,
FT                   14470709..14470713)
FT                   /codon_start=1
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, isoform CRA_a"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT178409.0
FT                   protein_id=mCP101331.0 isoform=CRA_a"
FT                   /protein_id="EDL13878.1"
FT                   /translation="MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNL
FT                   LREGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKE
FT                   ATDPRPYEAENAIESWRTSVETALRAYVKEHYPNGVCTVYGKKVDGQQTIIACIESHQF
FT                   QAKNFWNGRWRSEWKFTVTPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSVK"
FT   CDS             join(14442798..14442836,14454194..14454257,
FT                   14455677..14455728,14459781..14459844,14461895..14462188)
FT                   /codon_start=1
FT                   /gene="Capza2"
FT                   /locus_tag="mCG_13469"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   alpha 2, isoform CRA_b"
FT                   /note="gene_id=mCG13469.2 transcript_id=mCT178410.0
FT                   protein_id=mCP101332.0 isoform=CRA_b"
FT                   /protein_id="EDL13879.1"
FT                   /translation="MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNL
FT                   LREGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKE
FT                   ATDPRPYEAENAIESWRTSVETALRAYVKEHYPNGVCTVSRQWAVLPCCFLYRCASLYN
FT                   SLKLTVI"
FT   gene            14499639..14755195
FT                   /gene="St7"
FT                   /locus_tag="mCG_13471"
FT                   /note="gene_id=mCG13471.2"
FT   mRNA            join(14499639..14500004,14627931..14628013,
FT                   14644119..14644278,14654413..14654467,14655703..14655818,
FT                   14657508..14657583,14659861..14659929,14661762..14661916,
FT                   14664435..14664532,14695510..14695624,14714426..14714498,
FT                   14715937..14716039,14731518..14731653,14740296..14740388,
FT                   14743648..14743787,14754845..14755195)
FT                   /gene="St7"
FT                   /locus_tag="mCG_13471"
FT                   /product="Suppression of tumorigenicity 7, transcript
FT                   variant mCT147241"
FT                   /note="gene_id=mCG13471.2 transcript_id=mCT147241.1 created
FT                   on 05-AUG-2002"
FT   CDS             join(14499854..14500004,14627931..14628013,
FT                   14644119..14644278,14654413..14654467,14655703..14655818,
FT                   14657508..14657583,14659861..14659929,14661762..14661916,
FT                   14664435..14664532,14695510..14695624,14714426..14714498,
FT                   14715937..14716039,14731518..14731653,14740296..14740388,
FT                   14743648..14743787,14754845..14754940)
FT                   /codon_start=1
FT                   /gene="St7"
FT                   /locus_tag="mCG_13471"
FT                   /product="Suppression of tumorigenicity 7, isoform CRA_b"
FT                   /note="gene_id=mCG1347