spacer

EBI Dbfetch

ID   CH466532; SV 2; linear; genomic DNA; CON; MUS; 46464433 BP.
XX
AC   CH466532;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009764095 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-46464433
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-46464433
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-46464433
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 9624c634e0ae0bb8f12be0ce5fb8233a.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000211.
DR   Ensembl-Gn; ENSMUSG00000000339; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000340; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005813; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027961; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027967; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027973; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027977; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027985; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027997; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028133; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028159; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028165; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028174; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028179; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028186; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028188; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028189; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028195; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028266; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028271; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033554; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036832; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036853; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038975; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039174; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039865; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040016; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042943; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044522; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045092; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046688; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052430; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052544; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053870; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054942; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058897; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062006; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068523; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074182; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074195; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074264; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000080907; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089911; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090202; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094685; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029573; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029598; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029648; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029658; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029842; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039761; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040787; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043342; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049703; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053855; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062601; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072875; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090031; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093951; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106291; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106466; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106540; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120310; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171263; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178485; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189799; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980448.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..46464433
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(2546..>12435)
FT                   /locus_tag="mCG_11265"
FT                   /note="gene_id=mCG11265.2"
FT   mRNA            complement(join(2546..3472,5055..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9371..9601,10356..10432,
FT                   11710..11782,12113..12435))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT174947"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174947.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(2546..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,11636..11782,
FT                   12113..12435))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT174948"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174948.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(2546..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9536..9601,10356..10544,
FT                   11636..11782,12113..12435))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT174945"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174945.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(2546..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9371..9601,10356..10544,
FT                   11636..11782,12113..>12435))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT11249"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT11249.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(2546..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,10356..10544,11636..11782,
FT                   12154..12258))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT174944"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174944.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(2546..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9536..9601,10356..10544,
FT                   11636..11782,12154..12258))
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, transcript variant mCT174946"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174946.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(3283..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9371..9601,10356..10544,
FT                   11636..11782,12113..>12295))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_a"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT11249.2
FT                   protein_id=mCP20764.1 isoform=CRA_a"
FT                   /protein_id="EDL12413.1"
FT                   /translation="QLQSKMKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIA
FT                   KECERYLAPKGFGGVQVSPPNENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVT
FT                   RCNNVGVRIYVDAVINHMCGAGNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNG
FT                   EIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPG
FT                   DIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGT
FT                   VIRKWNGEKMSYLKNWGEGWGMVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKM
FT                   AVGFMLAHPYGFTRVMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDW
FT                   VCEHRWRQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQ
FT                   TGLPAGTYCDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFIAIHADSKL"
FT   CDS             complement(join(3283..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,11636..11782,
FT                   12113..12280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_f"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174948.0
FT                   protein_id=mCP97863.0 isoform=CRA_f"
FT                   /protein_id="EDL12418.1"
FT                   /translation="MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECER
FT                   YLAPKGFGGVQVSPPNENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNV
FT                   GVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGMVPSDR
FT                   ALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNFQN
FT                   GKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNW
FT                   WDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN
FT                   VGSDGKAHFSISNSAEDPFIAIHADSKL"
FT   CDS             complement(join(3283..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9536..9601,10356..10544,
FT                   11636..11782,12113..12280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_e"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174945.0
FT                   protein_id=mCP97864.0 isoform=CRA_e"
FT                   /protein_id="EDL12417.1"
FT                   /translation="MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECER
FT                   YLAPKGFGGVQVSPPNENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNV
FT                   GVRIYVDAVINHMCGAGNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNY
FT                   NDAYQVRNCRLTGLLDLALEKDYVRTKVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTV
FT                   IRKWNGEKMSYLKNWGEGWGMVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMA
FT                   VGFMLAHPYGFTRVMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWV
FT                   CEHRWRQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQT
FT                   GLPAGTYCDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFIAIHADSKL"
FT   CDS             complement(join(3283..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,10356..10544,11636..11782,
FT                   12154..12231))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_b"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174944.0
FT                   protein_id=mCP97865.0 isoform=CRA_b"
FT                   /protein_id="EDL12414.1"
FT                   /translation="MTHILQMGGLLLSTCSSGAGLILPRNVSPPNENVVVHNPSRPWWE
FT                   RYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGAGNPAGTSSTCGSYL
FT                   NPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVIDLGGEAIKGSEYFGNGRVTEFKY
FT                   GAKLGTVIRKWNGEKMSYLKNWGEGWGMVPSDRALVFVDNHDNQRGHGAGGSSILTFWD
FT                   ARMYKMAVGFMLAHPYGFTRVMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADT
FT                   TCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWA
FT                   LSATLQTGLPAGTYCDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFIAIHADS
FT                   KL"
FT   CDS             complement(join(3283..3472,5059..5184,5293..5411,
FT                   6579..6678,6771..6893,7571..7704,9536..9601,10356..10544,
FT                   11636..11782,12154..12231))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_c"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174946.0
FT                   protein_id=mCP97867.0 isoform=CRA_c"
FT                   /protein_id="EDL12415.1"
FT                   /translation="MTHILQMGGLLLSTCSSGAGLILPRNVSPPNENVVVHNPSRPWWE
FT                   RYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGAGNPAGTSSTCGSYL
FT                   NPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVID
FT                   LGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGMVPSDRALVF
FT                   VDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNFQNGKDQ
FT                   NDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNWWDNN
FT                   SNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVNVGSD
FT                   GKAHFSISNSAEDPFIAIHADSKL"
FT   CDS             complement(join(5055..5184,5293..5411,6579..6678,
FT                   6771..6893,7571..7704,9371..9601,10356..10432,11710..11782,
FT                   12113..12280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11265"
FT                   /product="mCG11265, isoform CRA_d"
FT                   /note="gene_id=mCG11265.2 transcript_id=mCT174947.0
FT                   protein_id=mCP97866.0 isoform=CRA_d"
FT                   /protein_id="EDL12416.1"
FT                   /translation="MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECER
FT                   YLAPKGFGGVQVSPPNENVVVHNPSRPWWERYQPITVPYSAWDFNDNKCNGEIDNYNDA
FT                   YQVRNCRLTGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDK
FT                   LHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGE
FT                   KMSYLKNWGEGWGMVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAH
FT                   PYGFTRVMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQ
FT                   IRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDW"
FT   assembly_gap    11194..11213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31438..31608
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   gene            complement(35769..57798)
FT                   /locus_tag="mCG_11264"
FT                   /note="gene_id=mCG11264.1"
FT   mRNA            complement(join(35769..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50123,57767..57798))
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, transcript variant mCT171290"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT171290.0 created
FT                   on 29-JUL-2002"
FT   mRNA            complement(join(35769..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50123,54670..54828))
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, transcript variant mCT11248"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT11248.1 created
FT                   on 29-JUL-2002"
FT   mRNA            complement(join(35769..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50123,54237..54320))
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, transcript variant mCT171289"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT171289.0 created
FT                   on 29-JUL-2002"
FT   CDS             complement(join(36039..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50078))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, isoform CRA_a"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT11248.1
FT                   protein_id=mCP20762.1 isoform=CRA_a"
FT                   /db_xref="GOA:P00687"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="MGI:MGI:88019"
FT                   /protein_id="EDL12410.1"
FT                   /translation="MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECER
FT                   YLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNV
FT                   GVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGI
FT                   ENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDI
FT                   KAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVM
FT                   RKWDGEKMSYLKNWGEGWGLMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV
FT                   GFMLAHPYGFTRVMSSYYWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWIC
FT                   EHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTG
FT                   LPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESKI"
FT   CDS             complement(join(36039..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50078))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, isoform CRA_a"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT171289.0
FT                   protein_id=mCP94208.0 isoform=CRA_a"
FT                   /db_xref="GOA:P00687"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="MGI:MGI:88019"
FT                   /protein_id="EDL12411.1"
FT                   /translation="MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECER
FT                   YLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNV
FT                   GVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGI
FT                   ENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDI
FT                   KAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVM
FT                   RKWDGEKMSYLKNWGEGWGLMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV
FT                   GFMLAHPYGFTRVMSSYYWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWIC
FT                   EHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTG
FT                   LPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESKI"
FT   CDS             complement(join(36039..36228,38152..38277,38381..38499,
FT                   41688..41787,41880..42002,42684..42817,43501..43731,
FT                   44925..45122,49448..49594,49911..50078))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11264"
FT                   /product="mCG11264, isoform CRA_a"
FT                   /note="gene_id=mCG11264.1 transcript_id=mCT171290.0
FT                   protein_id=mCP94209.0 isoform=CRA_a"
FT                   /db_xref="GOA:P00687"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="MGI:MGI:88019"
FT                   /protein_id="EDL12412.1"
FT                   /translation="MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECER
FT                   YLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNV
FT                   GVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGI
FT                   ENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDI
FT                   KAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVM
FT                   RKWDGEKMSYLKNWGEGWGLMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV
FT                   GFMLAHPYGFTRVMSSYYWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWIC
FT                   EHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTG
FT                   LPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESKI"
FT   assembly_gap    70052..70173
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            complement(85610..110352)
FT                   /gene="Rnpc3"
FT                   /locus_tag="mCG_141953"
FT                   /note="gene_id=mCG141953.0"
FT   mRNA            complement(join(85610..85842,88535..88606,89233..89365,
FT                   91253..91311,91404..91498,93953..94111,95574..95722,
FT                   96959..97084,100236..100378,101320..101388,102043..102154,
FT                   102577..102660,105150..105268,108556..108603,
FT                   110074..110352))
FT                   /gene="Rnpc3"
FT                   /locus_tag="mCG_141953"
FT                   /product="RNA-binding region (RNP1, RRM) containing 3"
FT                   /note="gene_id=mCG141953.0 transcript_id=mCT178102.0
FT                   created on 02-JAN-2003"
FT   CDS             complement(join(88550..88606,89233..89365,91253..91311,
FT                   91404..91498,93953..94111,95574..95722,96959..97084,
FT                   100236..100378,101320..101388,102043..102154,
FT                   102577..102660,105150..105268,108556..108603,
FT                   110074..110265))
FT                   /codon_start=1
FT                   /gene="Rnpc3"
FT                   /locus_tag="mCG_141953"
FT                   /product="RNA-binding region (RNP1, RRM) containing 3"
FT                   /note="gene_id=mCG141953.0 transcript_id=mCT178102.0
FT                   protein_id=mCP101024.0"
FT                   /protein_id="EDL12409.1"
FT                   /translation="MAGPEPPMPLSRGGPGSASLSPPRGDRTLLVRHLPAELTAEEKED
FT                   LLKYFGAQSVRVLSDKGRLKHTAFATFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQD
FT                   RVHSPCSTSNTEKKKRLDDTVENDKEKKEPDILTVENGIAPNHGLTFPLNSCLKYMYPP
FT                   PSSTILANIVNALASVPKFYVQVLHLMNKMNLPTPFGPITARPPMYEDYMPLHAPLPPT
FT                   SPQPPEEPPLPDEDEDLSSKESEYESSDEEDRQRMNRLMELANLQPKRPKTEKPRHVRK
FT                   KRKIKDMLNIPSSASHSLHPVLLPSDVFDQPQSVGNKKIEFNISTNMPAAFNKDLETQP
FT                   NNEEENSDSPDTGLDSNTGFGKIFPKPNLNITEEITEDSDEIPSQFISRKELEKGRISR
FT                   EEMETLSVFRSYEPGEPNCRIYVKNLARHVQEKDLKFIFGRYVDFSSETQRIMFDIRLM
FT                   KEGRMKGQAFVGLPNEKAAAKALKEANGYVLFGKPMVVQFARSARPKQDSKEGKRK"
FT   gene            complement(111789..112396)
FT                   /pseudo
FT                   /locus_tag="mCG_61293"
FT                   /note="gene_id=mCG61293.2"
FT   mRNA            complement(111789..112396)
FT                   /pseudo
FT                   /locus_tag="mCG_61293"
FT                   /note="gene_id=mCG61293.2 transcript_id=mCT61476.2 created
FT                   on 24-FEB-2003"
FT   assembly_gap    124890..125382
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    136096..136310
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    151581..154091
FT                   /estimated_length=2511
FT                   /gap_type="unknown"
FT   assembly_gap    155643..155662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    157821..158361
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    199131..199242
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    208310..208329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            209534..209783
FT                   /pseudo
FT                   /locus_tag="mCG_142541"
FT                   /note="gene_id=mCG142541.0"
FT   mRNA            209534..209783
FT                   /pseudo
FT                   /locus_tag="mCG_142541"
FT                   /note="gene_id=mCG142541.0 transcript_id=mCT180719.0
FT                   created on 24-FEB-2003"
FT   assembly_gap    223026..223173
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    244199..244445
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    245463..245482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    256040..256204
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    262687..262706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    275507..275627
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    282224..282414
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    283535..287272
FT                   /estimated_length=3738
FT                   /gap_type="unknown"
FT   assembly_gap    290826..290918
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    293583..293976
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    301016..301035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    302546..302565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    327403..327422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    328863..328882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            331045..332478
FT                   /pseudo
FT                   /locus_tag="mCG_142542"
FT                   /note="gene_id=mCG142542.0"
FT   mRNA            join(331045..331958,332298..332478)
FT                   /pseudo
FT                   /locus_tag="mCG_142542"
FT                   /note="gene_id=mCG142542.0 transcript_id=mCT180718.0
FT                   created on 24-FEB-2003"
FT   assembly_gap    360337..360873
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    367697..368992
FT                   /estimated_length=1296
FT                   /gap_type="unknown"
FT   assembly_gap    371530..371549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    395372..395391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    405744..405763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    412938..412957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    415680..415699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    433761..433780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    445483..447044
FT                   /estimated_length=1562
FT                   /gap_type="unknown"
FT   assembly_gap    454254..454616
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    455447..458098
FT                   /estimated_length=2652
FT                   /gap_type="unknown"
FT   gene            499949..695643
FT                   /gene="Col11a1"
FT                   /locus_tag="mCG_5091"
FT                   /note="gene_id=mCG5091.1"
FT   mRNA            join(499949..500228,524998..525165,530754..530967,
FT                   535811..535973,559613..559738,564279..564395,
FT                   564963..565055,566762..567016,567590..567619,
FT                   569567..569629,571198..571272,572000..572083,
FT                   574852..574908,577738..577791,581493..581546,
FT                   581663..581716,581876..581929,583009..583062,
FT                   583176..583220,584380..584433,584881..584925,
FT                   585126..585179,585778..585822,590664..590717,
FT                   593031..593075,593450..593503,593583..593627,
FT                   598660..598713,600847..600954,602423..602476,
FT                   607683..607736,607861..607905,608012..608065,
FT                   608189..608233,612310..612363,617036..617089,
FT                   620641..620694,621875..621982,622371..622460,
FT                   622961..623014,627406..627513,633681..633788,
FT                   634568..634621,636305..636358,636819..636926,
FT                   642721..642774,650696..650749,651967..652020,
FT                   654212..654265,654850..654957,655236..655289,
FT                   655878..655931,657048..657101,663242..663295,
FT                   663427..663534,664084..664137,679854..679907,
FT                   680889..680996,681477..681530,681631..681666,
FT                   681760..681813,683445..683694,687430..687542,
FT                   688575..688643,692333..692566,694046..695643)
FT                   /gene="Col11a1"
FT                   /locus_tag="mCG_5091"
FT                   /product="procollagen, type XI, alpha 1"
FT                   /note="gene_id=mCG5091.1 transcript_id=mCT3720.2 created on
FT                   29-JUL-2002"
FT   CDS             join(500126..500228,524998..525165,530754..530967,
FT                   535811..535973,559613..559738,564279..564395,
FT                   564963..565055,566762..567016,567590..567619,
FT                   569567..569629,571198..571272,572000..572083,
FT                   574852..574908,577738..577791,581493..581546,
FT                   581663..581716,581876..581929,583009..583062,
FT                   583176..583220,584380..584433,584881..584925,
FT                   585126..585179,585778..585822,590664..590717,
FT                   593031..593075,593450..593503,593583..593627,
FT                   598660..598713,600847..600954,602423..602476,
FT                   607683..607736,607861..607905,608012..608065,
FT                   608189..608233,612310..612363,617036..617089,
FT                   620641..620694,621875..621982,622371..622460,
FT                   622961..623014,627406..627513,633681..633788,
FT                   634568..634621,636305..636358,636819..636926,
FT                   642721..642774,650696..650749,651967..652020,
FT                   654212..654265,654850..654957,655236..655289,
FT                   655878..655931,657048..657101,663242..663295,
FT                   663427..663534,664084..664137,679854..679907,
FT                   680889..680996,681477..681530,681631..681666,
FT                   681760..681813,683445..683694,687430..687542,
FT                   688575..688643,692333..692566,694046..694192)
FT                   /codon_start=1
FT                   /gene="Col11a1"
FT                   /locus_tag="mCG_5091"
FT                   /product="procollagen, type XI, alpha 1"
FT                   /note="gene_id=mCG5091.1 transcript_id=mCT3720.2
FT                   protein_id=mCP20763.2"
FT                   /protein_id="EDL12408.1"
FT                   /translation="MEPWSRWKTKRWIWDLTISTLALTFLFQAREVRGAAPVDILKALD
FT                   FHNSPVGISKTTGFCTNRKNSKDPDVAYRVTEEAQISAPTKQLFPGGIFPQDFSILFTI
FT                   KPKKGTQAFLLSLYNEHGIQQLGVEVGRSPVFLFEDHTGKPTPENYPLFSTVNIADGKW
FT                   HRVAISVEKKTVTMIVDCKKKITKPLDRSERSIVDTNGIMVFGTRILETDVFQGDIQQF
FT                   LITGDPKAAYDYCDHYSPDCDLTSKAAQAQEPHIDEYAPEDIIEYDYEYGETDYKEAES
FT                   VTEMPTFTEETVAQTEANIVDDFQDYNYGTMEPYQTETPRRVSGSNEPNPVEEGFTEEY
FT                   LTGEDYDVQRNTSEDILYGNKGVDGRDSDVLVDGDLGEYDFYEYKEYEERTTTSPNEEF
FT                   GPGVPAETDFTETSINGHGAYGEKGLMGPPGLQGPSGLPGDPGDRGPPGRPGLPGADGL
FT                   PGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRPGPVG
FT                   GPGSAGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGESGSKGDRGFD
FT                   GLPGLPGDKGHRGERGPQGPPGLPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGP
FT                   PGQPGIGGIDGPQGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPG
FT                   LAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEK
FT                   GEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGV
FT                   PGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGSRGARGPTG
FT                   KPGPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPAGKDGLPGHPGQRGETGFQ
FT                   GKTGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGI
FT                   SGKDGPAGIRGFPGERGLPGAQGAPGLKGGEGPQGPQGPVGSPGERGSAGTAGPIGLPG
FT                   RPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEP
FT                   GQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGL
FT                   PGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGVVG
FT                   DKGEPGEAGNPGPPGEAGSGGLKGERGEKGEAGPPGAAGPAGIKGPPGDDGPKGNPGPV
FT                   GFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGASGS
FT                   EGRQGEKGAKGEAGAEGPPGKTGPVGPQGPSGKPGPEGLRGIPGPVGEQGLPGAAGQDG
FT                   PPGPLGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDG
FT                   GIPGPAGPIGPPGPPGLPGPAGPKGNKGSSGPTGQKGDSGMPGPPGPPGPPGEVIQPLP
FT                   ILSPKKTRRHTESIQGDAGDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPART
FT                   CKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTAGGETCIYPDKKSEGVRISSWPK
FT                   EKPGSWYSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYNCHQSAAWYDVL
FT                   SGSYDKALRFLGSNDEEMSYENNPHIKALYDGCASRKGYEKTVIEINTPKIDQVPIIDV
FT                   MINDFGDQNQKFGFEVGPACFLG"
FT   assembly_gap    512714..512808
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    517390..517989
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    567621..567745
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    573302..573432
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    608855..608874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    637162..637255
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    673110..673129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    675703..675722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    678135..678154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    680216..680235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    721144..721366
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    723894..723913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    726927..727447
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    729004..729023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    731104..731123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    740802..741513
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    750989..751008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    755274..756154
FT                   /estimated_length=881
FT                   /gap_type="unknown"
FT   assembly_gap    759235..759254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    763057..763076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    768034..768053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    785368..785387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    803308..803327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    807261..807280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    808658..808677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    810314..810333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    818659..818678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    825484..825503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    826653..827444
FT                   /estimated_length=792
FT                   /gap_type="unknown"
FT   assembly_gap    830379..830570
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    837012..837031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    858731..858750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    895660..896119
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    904681..905010
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    906023..908308
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    925885..925904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    929342..930007
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    932298..932891
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    937593..937612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    938660..938679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    958347..959074
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   assembly_gap    972863..973012
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    985329..985411
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    997983..998976
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    1000221..1000240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1001583..1001602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1002901..1002920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1004082..1004101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1011181..1011200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1012480..1012499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1033845..1033864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1034914..1034933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1037349..1037368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1040333..1045524
FT                   /estimated_length=5192
FT                   /gap_type="unknown"
FT   assembly_gap    1048408..1048427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1049579..1050722
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    1054610..1054897
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    1056879..1056898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1075219..1075784
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    1082428..1082580
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1101554..1101573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1102640..1102659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1103822..1103841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1104869..1104888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1107803..1107822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1130251..1130545
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    1131902..1131921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1133095..1134245
FT                   /estimated_length=1151
FT                   /gap_type="unknown"
FT   assembly_gap    1134616..1134635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1141125..1141144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1142333..1142352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1143723..1143742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1145712..1145731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1148799..1149784
FT                   /estimated_length=986
FT                   /gap_type="unknown"
FT   assembly_gap    1150590..1152281
FT                   /estimated_length=1692
FT                   /gap_type="unknown"
FT   assembly_gap    1154359..1154549
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    1156965..1157581
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    1163176..1163672
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    1165101..1165120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1170725..1170744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1174877..1175724
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    1176809..1176828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1177649..1179931
FT                   /estimated_length=2283
FT                   /gap_type="unknown"
FT   assembly_gap    1181753..1181772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1191164..1191183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1193046..1193065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1194782..1195178
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1225836..1225961
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    1237468..1237487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1252408..1252427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1261506..1262428
FT                   /estimated_length=923
FT                   /gap_type="unknown"
FT   assembly_gap    1273670..1273689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1275563..1278095
FT                   /estimated_length=2533
FT                   /gap_type="unknown"
FT   assembly_gap    1283828..1283847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1287666..1287723
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    1291726..1291745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1296753..1296772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1300239..1300258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303858..1303951
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    1312025..1312044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1316093..1316112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1317852..1317871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1326238..1326725
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    1356732..1366589
FT                   /estimated_length=9858
FT                   /gap_type="unknown"
FT   assembly_gap    1368122..1368141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1369153..1369690
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    1370910..1371161
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    1378031..1378050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1383734..1383819
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            1407226..1637677
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /note="gene_id=mCG1829.2"
FT   mRNA            join(1407226..1407701,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1637677)
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, transcript variant mCT174952"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT174952.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(1407633..1407701,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1634770)
FT                   /codon_start=1
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, isoform CRA_a"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT174952.0
FT                   protein_id=mCP97871.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UVC5"
FT                   /db_xref="InterPro:IPR003112"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022082"
FT                   /db_xref="MGI:MGI:2387329"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVC5"
FT                   /protein_id="EDL12405.1"
FT                   /translation="MQARSSFLNLLLLSLLAGLDPSKTQISPKEGWQVYSSAQDPDGRC
FT                   ICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGL
FT                   KAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSV
FT                   LTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWM
FT                   TDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGS
FT                   LYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
FT                   ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYS
FT                   YSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
FT                   "
FT   mRNA            join(<1407784..1407854,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1637677)
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, transcript variant mCT180900"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT180900.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(<1407786..1407854,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1634770)
FT                   /codon_start=1
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, isoform CRA_c"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT180900.0
FT                   protein_id=mCP103822.0 isoform=CRA_c"
FT                   /protein_id="EDL12407.1"
FT                   /translation="TWGTVLSATLWCLMHPRCLEDNKTQISPKEGWQVYSSAQDPDGRC
FT                   ICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGL
FT                   KAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSV
FT                   LTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWM
FT                   TDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGS
FT                   LYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
FT                   ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYS
FT                   YSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
FT                   "
FT   assembly_gap    1423987..1424006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1425168..1425187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1455460..1455479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1468703..1468722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1470208..1474638
FT                   /estimated_length=4431
FT                   /gap_type="unknown"
FT   assembly_gap    1487958..1488667
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    1516336..1516873
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    1518810..1518829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1520083..1520102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1521002..1521021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1525356..1525375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1528309..1529637
FT                   /estimated_length=1329
FT                   /gap_type="unknown"
FT   assembly_gap    1530789..1530808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1539007..1539026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1554837..1554864
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1591679..1591698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(1592865..1593085,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1637677)
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, transcript variant mCT7779"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT7779.3 created on
FT                   05-MAR-2003"
FT   CDS             join(1592957..1593085,1601988..1602134,1608783..1608938,
FT                   1613711..1613930,1632807..1632913,1634093..1634770)
FT                   /codon_start=1
FT                   /gene="Olfm3"
FT                   /locus_tag="mCG_1829"
FT                   /product="olfactomedin 3, isoform CRA_b"
FT                   /note="gene_id=mCG1829.2 transcript_id=mCT7779.3
FT                   protein_id=mCP20761.1 isoform=CRA_b"
FT                   /protein_id="EDL12406.1"
FT                   /translation="MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTLTQ
FT                   ISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLN
FT                   LRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQY
FT                   KTDAKLITQFKEEIRNLSSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKL
FT                   MKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAES
FT                   RTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYT
FT                   WGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFM
FT                   ICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNN
FT                   GHQVLFNVTLFHIIKTEDDT"
FT   assembly_gap    1638827..1638846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1639933..1639952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1657939..1658044
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1658321..1658477
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1672540..1672559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1672584..1673872)
FT                   /locus_tag="mCG_125894"
FT                   /note="gene_id=mCG125894.1"
FT   mRNA            complement(1672584..1673872)
FT                   /locus_tag="mCG_125894"
FT                   /product="mCG125894, transcript variant mCT127158"
FT                   /note="gene_id=mCG125894.1 transcript_id=mCT127158.1
FT                   created on 25-OCT-2002"
FT   mRNA            complement(join(1672602..1672820,1672999..1673872))
FT                   /locus_tag="mCG_125894"
FT                   /product="mCG125894, transcript variant mCT174951"
FT                   /note="gene_id=mCG125894.1 transcript_id=mCT174951.0
FT                   created on 25-OCT-2002"
FT   CDS             complement(join(1672818..1672820,1672999..1673781))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125894"
FT                   /product="mCG125894, isoform CRA_b"
FT                   /note="gene_id=mCG125894.1 transcript_id=mCT174951.0
FT                   protein_id=mCP97870.0 isoform=CRA_b"
FT                   /protein_id="EDL12404.1"
FT                   /translation="MEDSMDMYMSPLRPQNYLFDCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPK"
FT   CDS             complement(1672903..1673781)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125894"
FT                   /product="mCG125894, isoform CRA_a"
FT                   /note="gene_id=mCG125894.1 transcript_id=mCT127158.1
FT                   protein_id=mCP89437.1 isoform=CRA_a"
FT                   /protein_id="EDL12403.1"
FT                   /translation="MEDSMDMYMSPLRPQNYLFDCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   assembly_gap    1679622..1679641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1682462..1682481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1696896..1696915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1700200..1700219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1704594..1704613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1705677..1705696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1710218..1710395
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    1832234..1832303
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1864192..1864211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1875163..1875272
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1884167..1884186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1885272..1885291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1887312..1887331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890974..1890993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1892284..1892303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1893948..1894025
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    1903457..1903476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1904537..1904962
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    1906205..1906224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1909043..1909062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1916160..1916269
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1917784..1917803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1919029..1919048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1920158..1920757
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    1923623..1923642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1924959..1924978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1926144..1926163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1927844..1927863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1934520..1934539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1935861..1935880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1937152..1937171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1939081..1939100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1946027..1951892
FT                   /estimated_length=5866
FT                   /gap_type="unknown"
FT   assembly_gap    1959842..1960653
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    1961736..1962145
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    1963500..1963584
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    1964649..1965283
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    1968145..1968291
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    1976985..1977079
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1978562..1979010
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    1981101..1982207
FT                   /estimated_length=1107
FT                   /gap_type="unknown"
FT   assembly_gap    2014806..2014825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2030327..2030427
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            2040708..2041536
FT                   /pseudo
FT                   /locus_tag="mCG_1045682"
FT                   /note="gene_id=mCG1045682.1"
FT   mRNA            join(2040708..2040909,2041346..2041536)
FT                   /pseudo
FT                   /locus_tag="mCG_1045682"
FT                   /note="gene_id=mCG1045682.1 transcript_id=mCT163386.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    2066061..2066080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2087148..2087250
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    2100455..2100723
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    2113833..2113852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2143036..2143055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2150128..2150147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2163494..2163513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2187988..2188093
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2192352..2192371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2223117..2223285
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    2230531..2230550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2231146..2235779)
FT                   /gene="Edg1"
FT                   /locus_tag="mCG_1828"
FT                   /note="gene_id=mCG1828.1"
FT   mRNA            complement(join(2231146..2233826,2235441..2235779))
FT                   /gene="Edg1"
FT                   /locus_tag="mCG_1828"
FT                   /product="endothelial differentiation sphingolipid
FT                   G-protein-coupled receptor 1"
FT                   /note="gene_id=mCG1828.1 transcript_id=mCT7778.1 created on
FT                   29-JUL-2002"
FT   CDS             complement(2232507..2233655)
FT                   /codon_start=1
FT                   /gene="Edg1"
FT                   /locus_tag="mCG_1828"
FT                   /product="endothelial differentiation sphingolipid
FT                   G-protein-coupled receptor 1"
FT                   /note="gene_id=mCG1828.1 transcript_id=mCT7778.1
FT                   protein_id=mCP20760.0"
FT                   /db_xref="GOA:O08530"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000987"
FT                   /db_xref="InterPro:IPR004061"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1096355"
FT                   /protein_id="EDL12402.1"
FT                   /translation="MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGI
FT                   KLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLL
FT                   SGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLL
FT                   ISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYC
FT                   RIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVG
FT                   CKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKF
FT                   KRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS"
FT   assembly_gap    2258057..2258094
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2276878..2277290
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    2279316..2279335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2280453..2280729
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    2296972..2296991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2313564..2313583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2401010..2407906)
FT                   /locus_tag="mCG_61717"
FT                   /note="gene_id=mCG61717.2"
FT   mRNA            complement(join(2401010..2401267,2407540..2407906))
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, transcript variant mCT178440"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178440.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(2401010..2401267,2407552..2407879))
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, transcript variant mCT61900"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT61900.2 created
FT                   on 11-JAN-2003"
FT   mRNA            complement(join(2401010..2401267,2406094..2406147,
FT                   2407552..2407879))
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, transcript variant mCT178438"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178438.0 created
FT                   on 11-JAN-2003"
FT   mRNA            complement(join(2401010..2401267,2405986..2406147,
FT                   2407552..2407879))
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, transcript variant mCT178441"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178441.0 created
FT                   on 11-JAN-2003"
FT   mRNA            complement(join(2401010..2401267,2405986..2406152,
FT                   2407552..2407879))
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, transcript variant mCT178439"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178439.0 created
FT                   on 11-JAN-2003"
FT   assembly_gap    2402404..2402423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(2407624..2407779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, isoform CRA_a"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178438.0
FT                   protein_id=mCP101361.0 isoform=CRA_a"
FT                   /protein_id="EDL12397.1"
FT                   /translation="MGPAVRLERTQRAHAPGKPGLKHPQRASGLMTIAPNRPPDAHWQE
FT                   QPEGLP"
FT   CDS             complement(2407624..2407779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, isoform CRA_a"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178441.0
FT                   protein_id=mCP101362.0 isoform=CRA_a"
FT                   /protein_id="EDL12398.1"
FT                   /translation="MGPAVRLERTQRAHAPGKPGLKHPQRASGLMTIAPNRPPDAHWQE
FT                   QPEGLP"
FT   CDS             complement(2407624..2407779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, isoform CRA_a"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178439.0
FT                   protein_id=mCP101360.0 isoform=CRA_a"
FT                   /protein_id="EDL12399.1"
FT                   /translation="MGPAVRLERTQRAHAPGKPGLKHPQRASGLMTIAPNRPPDAHWQE
FT                   QPEGLP"
FT   CDS             complement(2407624..2407779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, isoform CRA_a"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT178440.0
FT                   protein_id=mCP101363.0 isoform=CRA_a"
FT                   /protein_id="EDL12400.1"
FT                   /translation="MGPAVRLERTQRAHAPGKPGLKHPQRASGLMTIAPNRPPDAHWQE
FT                   QPEGLP"
FT   CDS             complement(2407624..2407779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61717"
FT                   /product="mCG61717, isoform CRA_a"
FT                   /note="gene_id=mCG61717.2 transcript_id=mCT61900.2
FT                   protein_id=mCP35365.2 isoform=CRA_a"
FT                   /protein_id="EDL12401.1"
FT                   /translation="MGPAVRLERTQRAHAPGKPGLKHPQRASGLMTIAPNRPPDAHWQE
FT                   QPEGLP"
FT   gene            2407939..2440541
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /note="gene_id=mCG4661.2"
FT   mRNA            join(2407939..2408052,2408215..2408372,2412486..2412610,
FT                   2420055..2420163,2432471..2432591,2436662..2436701,
FT                   2438147..2438250,2439963..2440541)
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), transcript variant
FT                   mCT4163"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT4163.2 created on
FT                   25-OCT-2002"
FT   mRNA            join(2407939..2408052,2408215..2408372,2412486..2412610,
FT                   2420055..2420163,2432471..2432591,2436662..2437059)
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), transcript variant
FT                   mCT174965"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT174965.0 created
FT                   on 25-OCT-2002"
FT   mRNA            join(2407939..2408052,2408215..2408372,2412486..2412610,
FT                   2420055..2420355)
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), transcript variant
FT                   mCT174966"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT174966.0 created
FT                   on 25-OCT-2002"
FT   CDS             join(2408238..2408372,2412486..2412610,2420055..2420163,
FT                   2432471..2432591,2436662..2436701,2438147..2438250,
FT                   2439963..2440174)
FT                   /codon_start=1
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT4163.2
FT                   protein_id=mCP14243.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9CWQ0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="MGI:MGI:1916990"
FT                   /protein_id="EDL12395.1"
FT                   /translation="MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEAL
FT                   EEFYGRKLILADREEVEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIP
FT                   YQVIHNASIMNAVGCCGLQLYRFGETVSIVFWTDTWRPESFFDKVKRNRANGMHTLCLL
FT                   DIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQQLLEIVQNHRARGEEPAITEETLCVGL
FT                   ARVGAEDQKIAAGTLQQMCTVSLGEPLHSLVITGGNLHPLEMEMLSLFSIPESQSTDGL
FT                   "
FT   CDS             join(2408238..2408372,2412486..2412610,2420055..2420163,
FT                   2432471..2432591,2436662..2436705)
FT                   /codon_start=1
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT174965.0
FT                   protein_id=mCP97885.0 isoform=CRA_b"
FT                   /db_xref="GOA:V9GXP1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="MGI:MGI:1916990"
FT                   /db_xref="UniProtKB/TrEMBL:V9GXP1"
FT                   /protein_id="EDL12394.1"
FT                   /translation="MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEAL
FT                   EEFYGRKLILADREEVEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIP
FT                   YQVIHNASIMNAVGCCGLQLYRFGETVSIVFWTDTWRPESFFDKVKRNRANGMHTLCLL
FT                   DIKVKEQSLENLIR"
FT   CDS             join(2408238..2408372,2412486..2412610,2420055..2420232)
FT                   /codon_start=1
FT                   /gene="Dph5"
FT                   /locus_tag="mCG_4661"
FT                   /product="DPH5 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG4661.2 transcript_id=mCT174966.0
FT                   protein_id=mCP97884.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BG20"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="MGI:MGI:1916990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BG20"
FT                   /protein_id="EDL12393.1"
FT                   /translation="MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEAL
FT                   EEFYGRKLILADREEVEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIP
FT                   YQVIHNASIMNAVGCCGLQVMPQRKCVLFPGSYKLILFHEL"
FT   assembly_gap    2418137..2418156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2426801..>2431916)
FT                   /locus_tag="mCG_125898"
FT                   /note="gene_id=mCG125898.1"
FT   mRNA            complement(<2426801..>2431916)
FT                   /locus_tag="mCG_125898"
FT                   /product="mCG125898"
FT                   /note="gene_id=mCG125898.1 transcript_id=mCT127162.1
FT                   created on 25-OCT-2002"
FT   CDS             complement(<2426801..>2431916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125898"
FT                   /product="mCG125898"
FT                   /note="gene_id=mCG125898.1 transcript_id=mCT127162.1
FT                   protein_id=mCP89461.1"
FT                   /protein_id="EDL12396.1"
FT                   /translation="FCMPGLTVLRLLYAGSHSSQALYAGSYSSQALYAGPYSSQALYAG
FT                   SYSSVCRVLQFSGSVCRVLQFCMPGLTVLYAGSYSSVCRVSQFCMPGLTVLRLCMPGLT
FT                   VLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLYAGSHSSVCRVSQFCMP
FT                   GLIVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCM
FT                   PGLTVLYAGSHSSVCRVSQFCMPGLTVLYAGSYSSQALYAGSYSSQALYAGSYSSQALY
FT                   AGSYSSVCRVSQFSGSVCRVSQFCMPGLTVLRLCMPGLTVLRLCMLGLTVLRLCMPGLT
FT                   VLYARSHISVCRVLQFSGSVCRVLQFSGSVCRVLQFSGSVCRALQFSGSVCRVLQFSGS
FT                   VCRVLQFCMPGLTVLYAGSYSSVCRVSQFCMPGLTVLRLCMPGLTVLRLCMPGLTVLRL
FT                   CMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLR
FT                   LCMPVLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVL
FT                   YAGSHSSVCRVLQFSGSVCRVLQFCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGL
FT                   TVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPG
FT                   LTVLYAGSQFQFCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLYAGSYSSQA
FT                   LYAGSHSSVCRVSQFCMPGLTVLYAGSHSSVCRVLQFSGSVCRVLQFSGSVCRVLQFSG
FT                   SVCRGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGLTVL
FT                   RLCMPGLTVLYAGSHSSVCRVLQFSGSVCRVLQFSGSVCRILQFSGSVCRVLQFCMPGL
FT                   TVLRLCMPGLTVLYAGSYSSQALYAGSYSSQALYAGSYSSQALYAGSHSSVCRVSQFCM
FT                   PGLTVLRLCMPGLTVLKLCMPGLTVLYAGSHSSQALYAGSYSSQALYAGPYSSQALYAG
FT                   SHSSQALYAGPYSSQALYAGSYSSQALYAGSYSSQALYAGSYSSVCRVLQFSGSVCRVL
FT                   QFCMPGLTVLRLCMPGLTVLRLCMPGLTVLRLCMPGSHSSQALYAGSYSSQALYAGSYS
FT                   SQALYAGSYSSQALYAGSYSSQALYAGSYSSQALYAGSHSSVCRVSQFCMPGLTVLRLC
FT                   MPGLTVLRLCMPDLTVLRLCMPGLTVLYAGSHSSQALYAGSHSSVCRVLQFSGSVCRVL
FT                   QFSGSVCRVLQFSGSVCRVSQFCMPGLTVLYAGSYSSQALYAGSYSSQALYAGSHSSVC
FT                   RVSQFSGSVCRVLQFSGSVCRALQFSGSVCRVSQFSGSVCRALQFSGSVCRVLQFSGSV
FT                   CRVLQFCMPGLTVLRLCMPGLTVLYAGSYSSQALYAGSYSSQALYAGSYSSQALYAGSY
FT                   SSQALYAGSYSSQALYAGSYSSQALYAGSYSSVCRVLQFCMPGLTVLYAGSHSSVCRVL
FT                   QFSGSVCRVSQFSGSVCRVLQFSGSVCRALQFSGSVCRVLQFCMPGLTVLRLCMPGLTV
FT                   LYAGSHSSVCRVLQFCMPGLTVLYAGSYSSQALYAGSYSSQALYAGSHSSQALYAGPYS
FT                   SQALYAGSYSSQALYAGSYSSQALYAGSHSSVCRVSQFCMPGLTVLRLCMPGLTVLRLC
FT                   MPGLTVLY"
FT   assembly_gap    2431951..2431970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2433188..2433207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2434520..2434539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2454405..2455569
FT                   /pseudo
FT                   /locus_tag="mCG_48682"
FT                   /note="gene_id=mCG48682.1"
FT   mRNA            2454405..2455569
FT                   /pseudo
FT                   /locus_tag="mCG_48682"
FT                   /note="gene_id=mCG48682.1 transcript_id=mCT48865.2 created
FT                   on 29-OCT-2002"
FT   gene            complement(2457250..2518739)
FT                   /gene="Slc30a7"
FT                   /locus_tag="mCG_140759"
FT                   /note="gene_id=mCG140759.0"
FT   mRNA            complement(join(2457250..2458016,2465361..2465510,
FT                   2468145..2468235,2489706..2489841,2492826..2492876,
FT                   2495858..2496007,2501233..2501359,2501948..2502035,
FT                   2504156..2504269,2518167..2518268,2518468..2518739))
FT                   /gene="Slc30a7"
FT                   /locus_tag="mCG_140759"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 7"
FT                   /note="gene_id=mCG140759.0 transcript_id=mCT171296.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(2457969..2458016,2465361..2465510,
FT                   2468145..2468235,2489706..2489841,2492826..2492876,
FT                   2495858..2496007,2501233..2501359,2501948..2502035,
FT                   2504156..2504269,2518167..2518268,2518468..2518547))
FT                   /codon_start=1
FT                   /gene="Slc30a7"
FT                   /locus_tag="mCG_140759"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 7"
FT                   /note="gene_id=mCG140759.0 transcript_id=mCT171296.0
FT                   protein_id=mCP94215.0"
FT                   /protein_id="EDL12392.1"
FT                   /translation="MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLN
FT                   LSFAFVELLYGIWSNCLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAE
FT                   VLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGG
FT                   HGHSHGSGHGHSHSLFNGALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDG
FT                   PSFKATAGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIV
FT                   VSVIPLLRESVGILMQRTPPSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTL
FT                   KLVVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM"
FT   assembly_gap    2471422..2471608
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    2499428..2499447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2506962..2506994
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            2518854..2540295
FT                   /gene="Extl2"
FT                   /locus_tag="mCG_4662"
FT                   /note="gene_id=mCG4662.2"
FT   mRNA            join(2518854..2519215,2521957..2522031,2535344..2535771,
FT                   2536657..2536727,2538347..2540295)
FT                   /gene="Extl2"
FT                   /locus_tag="mCG_4662"
FT                   /product="exotoses (multiple)-like 2, transcript variant
FT                   mCT171295"
FT                   /note="gene_id=mCG4662.2 transcript_id=mCT171295.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2519665..2519870,2521957..2522031,2535344..2535771,
FT                   2536657..2536727,2538347..2540295)
FT                   /gene="Extl2"
FT                   /locus_tag="mCG_4662"
FT                   /product="exotoses (multiple)-like 2, transcript variant
FT                   mCT4160"
FT                   /note="gene_id=mCG4662.2 transcript_id=mCT4160.1 created on
FT                   29-JUL-2002"
FT   CDS             join(2522024..2522031,2535344..2535771,2536657..2536727,
FT                   2538347..2538832)
FT                   /codon_start=1
FT                   /gene="Extl2"
FT                   /locus_tag="mCG_4662"
FT                   /product="exotoses (multiple)-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG4662.2 transcript_id=mCT171295.0
FT                   protein_id=mCP94214.0 isoform=CRA_a"
FT                   /protein_id="EDL12390.1"
FT                   /translation="MMRGCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTNLLPNIK
FT                   EDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVG
FT                   EKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVF
FT                   AFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSK
FT                   YLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYS
FT                   GMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM"
FT   CDS             join(2522024..2522031,2535344..2535771,2536657..2536727,
FT                   2538347..2538832)
FT                   /codon_start=1
FT                   /gene="Extl2"
FT                   /locus_tag="mCG_4662"
FT                   /product="exotoses (multiple)-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG4662.2 transcript_id=mCT4160.1
FT                   protein_id=mCP14235.1 isoform=CRA_a"
FT                   /protein_id="EDL12391.1"
FT                   /translation="MMRGCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTNLLPNIK
FT                   EDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVG
FT                   EKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVF
FT                   AFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSK
FT                   YLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYS
FT                   GMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM"
FT   assembly_gap    2570131..2571760
FT                   /estimated_length=1630
FT                   /gap_type="unknown"
FT   assembly_gap    2576001..2577787
FT                   /estimated_length=1787
FT                   /gap_type="unknown"
FT   assembly_gap    2578801..2578820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2579825..2579844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2582199..2582218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2583344..2583363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2585350..2585369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2612010..2612029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2619221..2619240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2621445..2621464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2624197..2624216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2625776..>2645514)
FT                   /gene="Vcam1"
FT                   /locus_tag="mCG_19764"
FT                   /note="gene_id=mCG19764.2"
FT   mRNA            complement(join(2625776..2626862,2630179..2630445,
FT                   2631710..2631976,2633034..2633354,2636610..2636885,
FT                   2640195..2640461,2641764..2642084,2644306..2644581,
FT                   2645130..2645514))
FT                   /gene="Vcam1"
FT                   /locus_tag="mCG_19764"
FT                   /product="vascular cell adhesion molecule 1, transcript
FT                   variant mCT21812"
FT                   /note="gene_id=mCG19764.2 transcript_id=mCT21812.2 created
FT                   on 29-JUL-2002"
FT   mRNA            complement(join(2625851..2626862,2630179..2630445,
FT                   2631710..2631976,2633034..2633354,2636610..2636885,
FT                   2640195..2640461,2641764..2642084,2644306..2644575,
FT                   2645126..>2645514))
FT                   /gene="Vcam1"
FT                   /locus_tag="mCG_19764"
FT                   /product="vascular cell adhesion molecule 1, transcript
FT                   variant mCT190588"
FT                   /note="gene_id=mCG19764.2 transcript_id=mCT190588.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2626702..2626862,2630179..2630445,
FT                   2631710..2631976,2633034..2633354,2636610..2636885,
FT                   2640195..2640461,2641764..2642084,2644306..2644581,
FT                   2645130..2645193))
FT                   /codon_start=1
FT                   /gene="Vcam1"
FT                   /locus_tag="mCG_19764"
FT                   /product="vascular cell adhesion molecule 1, isoform CRA_b"
FT                   /note="gene_id=mCG19764.2 transcript_id=mCT21812.2
FT                   protein_id=mCP14242.2 isoform=CRA_b"
FT                   /protein_id="EDL12389.1"
FT                   /translation="MPVKMVAVLGASTVLWILFAVSQAFKIEISPEYKTIAQIGDSMAL
FT                   TCSTTGCESPLFSWRTQIDSPLNAKVRTEGSKSVLTMEPVSFENEHSYLCTATCGSGKL
FT                   ERSIHVDIYSFPKDPEIQFSGPLEVGKPVTVKCLAPDIYPVYRLEIDLFKGDQLMNRQE
FT                   FSSEEMTKSLETKSLEVTFTPVIEDIGKALVCRAKLHIDQIDSTLKERETVKELQVYIS
FT                   PRNTTISVHPSTRLQEGGAVTMTCSSEGLPAPEIFWGRKLDNEVLQLLSGNATLTLIAM
FT                   RMEDSGVYVCEGVNLIGRDKAEVELVVQEKPFIVDISPGSQVAAQVGDSVVLTCAAIGC
FT                   DSPSFSWRTQTDSPLNGVVRNEGAKSTLVLSSVGFEDEHSYLCAVTCLQRTLEKRTQVE
FT                   VYSFPEDPVIKMSGPLVHGRPVTVNCTVPNVYPFDHLEIELLKGETTLMKKYFLEEMGI
FT                   KSLETKILETTFIPTIEDTGKSLVCLARLHSGEMESEPKQRQSVQPLYVNVAPKETTIW
FT                   VSPSPILEEGSPVNLTCSSDGIPAPKILWSRQLNNGELQPLSENTTLTFMSTKRDDSGI
FT                   YVCEGINEAGISRKSVELIIQVSPKDIQLTVFPSKSVKEGDTVIISCTCGNVPETWIIL
FT                   KKKAKTGDMVLKSVDGSYTIRQAQLQDAGIYECESKTEVGSQLRSLTLDVKGKEHNKDY
FT                   FSPELLALYCASSLVIPAIGMIVYFARKANMKGSYSLVEAQKSKV"
FT   CDS             complement(join(2626702..2626862,2630179..2630445,
FT                   2631710..2631976,2633034..2633354,2636610..2636885,
FT                   2640195..2640461,2641764..2642084,2644306..2644575,
FT                   2645126..>2645183))
FT                   /codon_start=1
FT                   /gene="Vcam1"
FT                   /locus_tag="mCG_19764"
FT                   /product="vascular cell adhesion molecule 1, isoform CRA_a"
FT                   /note="gene_id=mCG19764.2 transcript_id=mCT190588.0
FT                   protein_id=mCP111547.0 isoform=CRA_a"
FT                   /protein_id="EDL12388.1"
FT                   /translation="RWSRSWEPQRYFGYCLQSVTFKIEISPEYKTIAQIGDSMALTCST
FT                   TGCESPLFSWRTQIDSPLNAKVRTEGSKSVLTMEPVSFENEHSYLCTATCGSGKLERSI
FT                   HVDIYSFPKDPEIQFSGPLEVGKPVTVKCLAPDIYPVYRLEIDLFKGDQLMNRQEFSSE
FT                   EMTKSLETKSLEVTFTPVIEDIGKALVCRAKLHIDQIDSTLKERETVKELQVYISPRNT
FT                   TISVHPSTRLQEGGAVTMTCSSEGLPAPEIFWGRKLDNEVLQLLSGNATLTLIAMRMED
FT                   SGVYVCEGVNLIGRDKAEVELVVQEKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPS
FT                   FSWRTQTDSPLNGVVRNEGAKSTLVLSSVGFEDEHSYLCAVTCLQRTLEKRTQVEVYSF
FT                   PEDPVIKMSGPLVHGRPVTVNCTVPNVYPFDHLEIELLKGETTLMKKYFLEEMGIKSLE
FT                   TKILETTFIPTIEDTGKSLVCLARLHSGEMESEPKQRQSVQPLYVNVAPKETTIWVSPS
FT                   PILEEGSPVNLTCSSDGIPAPKILWSRQLNNGELQPLSENTTLTFMSTKRDDSGIYVCE
FT                   GINEAGISRKSVELIIQVSPKDIQLTVFPSKSVKEGDTVIISCTCGNVPETWIILKKKA
FT                   KTGDMVLKSVDGSYTIRQAQLQDAGIYECESKTEVGSQLRSLTLDVKGKEHNKDYFSPE
FT                   LLALYCASSLVIPAIGMIVYFARKANMKGSYSLVEAQKSKV"
FT   assembly_gap    2644582..2644620
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    2649826..2650115
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    2656585..2656921
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    2663014..2663033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2666238..2682605
FT                   /locus_tag="mCG_144627"
FT                   /note="gene_id=mCG144627.0"
FT   mRNA            join(<2666238..2666548,2675131..2675183,2675466..2675604,
FT                   2677538..2677647,2678078..2678135,2680513..2682605)
FT                   /locus_tag="mCG_144627"
FT                   /product="mCG144627"
FT                   /note="gene_id=mCG144627.0 transcript_id=mCT184051.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2672562..2675030
FT                   /estimated_length=2469
FT                   /gap_type="unknown"
FT   CDS             join(<2675475..2675604,2677538..2677647,2678078..2678092)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144627"
FT                   /product="mCG144627"
FT                   /note="gene_id=mCG144627.0 transcript_id=mCT184051.0
FT                   protein_id=mCP106166.0"
FT                   /protein_id="EDL12387.1"
FT                   /translation="LVIPNGGEEPEEERTTMHFLPEGDIPLMCLGLPMGLFLPSRNLGS
FT                   PLPSSKVTCSRSVRTLFYPFCCMIGRRVEHFASDVHVYS"
FT   assembly_gap    2680320..2680339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2686696..2686908
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    2694773..2694858
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    2700409..2700597
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2724712..2724831
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2760396..2760522
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(2766512..2770315)
FT                   /gene="Gpr88"
FT                   /locus_tag="mCG_2013"
FT                   /note="gene_id=mCG2013.2"
FT   mRNA            complement(join(2766512..2769589,2769975..2770315))
FT                   /gene="Gpr88"
FT                   /locus_tag="mCG_2013"
FT                   /product="G-protein coupled receptor 88"
FT                   /note="gene_id=mCG2013.2 transcript_id=mCT1187.2 created on
FT                   26-JUL-2002"
FT   CDS             complement(2768363..2769517)
FT                   /codon_start=1
FT                   /gene="Gpr88"
FT                   /locus_tag="mCG_2013"
FT                   /product="G-protein coupled receptor 88"
FT                   /note="gene_id=mCG2013.2 transcript_id=mCT1187.2
FT                   protein_id=mCP23629.2"
FT                   /db_xref="GOA:B2RXU4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1927653"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXU4"
FT                   /protein_id="EDL12386.1"
FT                   /translation="MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGG
FT                   TLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPSGSAEPPGD
FT                   WDGGGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTVGMLA
FT                   LSWALALGLVLLLPPWAPKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVS
FT                   VKRVSVLNFHLLHQLPGCAAAAAAFPAAPHAPGPGGAAHPAQPQPLPAALQPRRAQRRL
FT                   SGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRN
FT                   EEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW"
FT   assembly_gap    2783666..2802050
FT                   /estimated_length=18385
FT                   /gap_type="unknown"
FT   assembly_gap    2803457..2803554
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2805192..2805633
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   gene            complement(<2807565..2938012)
FT                   /locus_tag="mCG_2012"
FT                   /note="gene_id=mCG2012.2"
FT   mRNA            complement(join(<2807565..2808042,2808707..2808868,
FT                   2812393..2812492,2822121..2822281,2836073..2836211,
FT                   2842653..2842883,2847019..2847106,2862594..2862656,
FT                   2865346..2865412,2880804..2880883,2918535..2918610,
FT                   2936556..2936646,2937426..2938012))
FT                   /locus_tag="mCG_2012"
FT                   /product="mCG2012"
FT                   /note="gene_id=mCG2012.2 transcript_id=mCT1186.2 created on
FT                   25-OCT-2002"
FT   CDS             complement(join(2807565..2808042,2808707..2808868,
FT                   2812393..2812492,2822121..2822281,2836073..2836211,
FT                   2842653..2842883,2847019..2847106,2862594..2862656,
FT                   2865346..2865412,2880804..2880883,2918535..2918610,
FT                   2936556..2936646,2937426..2937474))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2012"
FT                   /product="mCG2012"
FT                   /note="gene_id=mCG2012.2 transcript_id=mCT1186.2
FT                   protein_id=mCP23628.2"
FT                   /protein_id="EDL12385.1"
FT                   /translation="MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVY
FT                   ENFYADFGPLNLAMVYRYCCKLNKKLKVIYLKKTPEEAYRALLSGSNPPYLPFRDASFG
FT                   NCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGP
FT                   HPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDAGFEHYDLFFIDGS
FT                   TPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICR
FT                   PGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIISTLDDMSIGANLSKL
FT                   QSTERIGRDEDMEIKNNVTQGDKLRALKSQRHPRSSPSCAFSVTLCPLPSHPPQRLSSS
FT                   PQPTMSTMKTSKVCLSPSVTAKKISRGSLSSGANIRSFSINSRLASSLGNLNAGTEEPE
FT                   TKKTTSLTKAAFIASPFTSFLNGSTQTPGRNYPELNNNQYTRSSNSNSSSSSSGLGGNL
FT                   NSSPVPQSAKPEEHTTILRPSFPGSLSSSSVRFLSRSIPVSSQTPPLGPQNPECNFYTL
FT                   PSQPRLPPKKFNSAKETF"
FT   assembly_gap    2813753..2814012
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    2837013..2837252
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    2846000..2846069
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2852385..2852477
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    2907023..2907089
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    2960733..2960768
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    2989242..2990022
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   gene            complement(3002807..3021957)
FT                   /gene="Rtcd1"
FT                   /locus_tag="mCG_2349"
FT                   /note="gene_id=mCG2349.2"
FT   mRNA            complement(join(3002807..3003179,3006796..3006900,
FT                   3007894..3007988,3009447..3009505,3011401..3011525,
FT                   3013357..3013498,3014923..3014981,3018156..3018257,
FT                   3020646..3020789,3021562..3021662,3021756..3021957))
FT                   /gene="Rtcd1"
FT                   /locus_tag="mCG_2349"
FT                   /product="RNA terminal phosphate cyclase domain 1,
FT                   transcript variant mCT174964"
FT                   /note="gene_id=mCG2349.2 transcript_id=mCT174964.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(3002807..3003179,3006796..3006900,
FT                   3007894..3007988,3009447..3009505,3011401..3011525,
FT                   3013357..3013498,3014923..3014981,3018156..3018279,
FT                   3020646..3020789,3021562..3021662,3021756..3021957))
FT                   /gene="Rtcd1"
FT                   /locus_tag="mCG_2349"
FT                   /product="RNA terminal phosphate cyclase domain 1,
FT                   transcript variant mCT1198"
FT                   /note="gene_id=mCG2349.2 transcript_id=mCT1198.2 created on
FT                   25-OCT-2002"
FT   CDS             complement(join(3003078..3003179,3006796..3006900,
FT                   3007894..3007988,3009447..3009505,3011401..3011525,
FT                   3013357..3013498,3014923..3014981,3018156..3018279,
FT                   3020646..3020789,3021562..3021662,3021756..3021800))
FT                   /codon_start=1
FT                   /gene="Rtcd1"
FT                   /locus_tag="mCG_2349"
FT                   /product="RNA terminal phosphate cyclase domain 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2349.2 transcript_id=mCT1198.2
FT                   protein_id=mCP23618.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D7H3"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="MGI:MGI:1913618"
FT                   /protein_id="EDL12384.1"
FT                   /translation="MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRST
FT                   PGLRPQHLSGLEMVRDLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQ
FT                   VSMPCVLFAASPSELRLKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPK
FT                   GGGEVIVRVSPVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIRKEI
FT                   RDLYVSIQPVQEARDQAFGNGSGIIIVAETSTGCLFAGSSLGKRGVNADKVGIEAAEML
FT                   LANLRHGGTVDEYLQDQLIIFMALANGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKK
FT                   SEEEEDATKDTYVIECEGIGMANPHL"
FT   CDS             complement(join(3003078..3003179,3006796..3006900,
FT                   3007894..3007988,3009447..3009505,3011401..3011525,
FT                   3013357..3013498,3014923..3014981,3018156..3018251))
FT                   /codon_start=1
FT                   /gene="Rtcd1"
FT                   /locus_tag="mCG_2349"
FT                   /product="RNA terminal phosphate cyclase domain 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2349.2 transcript_id=mCT174964.0
FT                   protein_id=mCP97883.0 isoform=CRA_a"
FT                   /protein_id="EDL12383.1"
FT                   /translation="MPCVLFAASPSELRLKGGTNAEMAPQIDYTMMVFKPIAEKFGFTF
FT                   NCDIKTRGYYPKGGGEVIVRVSPVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDM
FT                   AAAAVRCIRKEIRDLYVSIQPVQEARDQAFGNGSGIIIVAETSTGCLFAGSSLGKRGVN
FT                   ADKVGIEAAEMLLANLRHGGTVDEYLQDQLIIFMALANGISRIKTGSVTLHTQTAIHFA
FT                   EQLAKAKFTVKKSEEEEDATKDTYVIECEGIGMANPHL"
FT   gene            3026924..3063901
FT                   /gene="Dbt"
FT                   /locus_tag="mCG_2010"
FT                   /note="gene_id=mCG2010.2"
FT   mRNA            join(3026924..3027002,3034145..3034268,3037260..3037335,
FT                   3047171..3047352,3048661..3048782,3053006..3053222,
FT                   3053572..3053738,3057685..3057762,3059898..3060089,
FT                   3060210..3060281,3061959..3063901)
FT                   /gene="Dbt"
FT                   /locus_tag="mCG_2010"
FT                   /product="dihydrolipoamide branched chain transacylase E2"
FT                   /note="gene_id=mCG2010.2 transcript_id=mCT1184.2 created on
FT                   26-JUL-2002"
FT   CDS             join(3026952..3027002,3034145..3034268,3037260..3037335,
FT                   3047171..3047352,3048661..3048782,3053006..3053222,
FT                   3053572..3053738,3057685..3057762,3059898..3060089,
FT                   3060210..3060281,3061959..3062126)
FT                   /codon_start=1
FT                   /gene="Dbt"
FT                   /locus_tag="mCG_2010"
FT                   /product="dihydrolipoamide branched chain transacylase E2"
FT                   /note="gene_id=mCG2010.2 transcript_id=mCT1184.2
FT                   protein_id=mCP23620.1"
FT                   /db_xref="GOA:P53395"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR015761"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="MGI:MGI:105386"
FT                   /protein_id="EDL12381.1"
FT                   /translation="MAAARVLRTWSQNAVRLTCVRYFQTFNSARVLKPKCVCSVGYPLF
FT                   KYSQPRHSLRTAAVLQGQVVQFKLSDIGEGIREVTIKEWYVKEGDTVSQFDSICEVQSD
FT                   KASVTITSRYDGVIKRLYYNLDDIAYVGKPLIDIETEALKDSEEDVVETPAVSHDEHTH
FT                   QEIKGQKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILSFLEKQTGAILPPSPK
FT                   SEITPPPPQPKDRTFPTPIAKPPVFTGKDRTEPVTGFQKAMVKTMSAALKIPHFGYCDE
FT                   IDLTQLVKLREELKPVALARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKA
FT                   SHNIGIAMDTELGLIVPNVKNVQVRSVFEIAMELNRLQKLGSSGQLGTTDLTGGTFTLS
FT                   NIGSIGGTYAKPVILPPEVAIGALGAIKALPRFDQKGDVYKAQIMNVSWSADHRVIDGA
FT                   TMSRFSNLWKSYLENPAFMLLDLK"
FT   assembly_gap    3028463..3028534
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(3041230..3042639)
FT                   /locus_tag="mCG_2007"
FT                   /note="gene_id=mCG2007.2"
FT   mRNA            complement(3041230..3042639)
FT                   /locus_tag="mCG_2007"
FT                   /product="mCG2007"
FT                   /note="gene_id=mCG2007.2 transcript_id=mCT1192.2 created on
FT                   25-OCT-2002"
FT   CDS             complement(3042049..3042492)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2007"
FT                   /product="mCG2007"
FT                   /note="gene_id=mCG2007.2 transcript_id=mCT1192.2
FT                   protein_id=mCP23621.1"
FT                   /protein_id="EDL12382.1"
FT                   /translation="MALKLINKELSDLALDPPAQCPAGPVGDDMFHWQATIRGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNSNSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLICDPNPDDPLVPEIAWIYKTDRDTYNRISREWSQKYAV"
FT   gene            complement(3074534..3075450)
FT                   /locus_tag="mCG_2011"
FT                   /note="gene_id=mCG2011.1"
FT   mRNA            complement(3074534..3075450)
FT                   /locus_tag="mCG_2011"
FT                   /product="mCG2011"
FT                   /note="gene_id=mCG2011.1 transcript_id=mCT1185.1 created on
FT                   25-OCT-2002"
FT   CDS             complement(3074863..3075333)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2011"
FT                   /product="mCG2011"
FT                   /note="gene_id=mCG2011.1 transcript_id=mCT1185.1
FT                   protein_id=mCP23623.1"
FT                   /protein_id="EDL12380.1"
FT                   /translation="MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNP
FT                   PGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNDEKRSRNRGPPPSWGRRPRDDY
FT                   RRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRS"
FT   gene            3076878..3095410
FT                   /gene="Lrrc39"
FT                   /locus_tag="mCG_2180"
FT                   /note="gene_id=mCG2180.2"
FT   mRNA            join(3076878..3077030,3079632..3079822,3082660..3082765,
FT                   3083984..3084140,3084823..3084959,3091403..3091548,
FT                   3092229..3092381,3093491..3093627,3095207..3095410)
FT                   /gene="Lrrc39"
FT                   /locus_tag="mCG_2180"
FT                   /product="leucine rich repeat containing 39"
FT                   /note="gene_id=mCG2180.2 transcript_id=mCT1194.2 created on
FT                   25-OCT-2002"
FT   CDS             join(3079710..3079822,3082660..3082765,3083984..3084140,
FT                   3084823..3084959,3091403..3091548,3092229..3092381,
FT                   3093491..3093627,3095207..3095271)
FT                   /codon_start=1
FT                   /gene="Lrrc39"
FT                   /locus_tag="mCG_2180"
FT                   /product="leucine rich repeat containing 39"
FT                   /note="gene_id=mCG2180.2 transcript_id=mCT1194.2
FT                   protein_id=mCP23631.2"
FT                   /db_xref="GOA:Q0VDT4"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:1924557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VDT4"
FT                   /protein_id="EDL12379.1"
FT                   /translation="MTESAVCTGAVSAVKEVWEERIKKHHEDVKREKEFQHKLVRIWED
FT                   RVSLTKLKEKVTREDGRVILRIEKEEWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGR
FT                   FQHLIVLDLSRNTISEIPRGIGLLTRLQELILSYNKIKTVPKELSNCTSLEKLELAVNR
FT                   DISDLPPELSKLLKLTHLDLSMNQFTTIPHAVLDMPALEWLDMGSNSLQQLPDSLDRMR
FT                   SLHTLWLQRNEITCLPETIKNMKNLGTLVLSNNKLQDIPGCMEEMTNLRFVNFRDNPLR
FT                   LEVTLPPSDNTDGEEEQELFGLQFMHAYIQESRRTEDQVNCLTQMPSSIHSDGESN"
FT   assembly_gap    3083446..3083695
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   gene            complement(3094715..3108922)
FT                   /locus_tag="mCG_2008"
FT                   /note="gene_id=mCG2008.2"
FT   mRNA            complement(join(3094715..3095596,3096481..3096711,
FT                   3099230..3099304,3099789..3099861,3102506..3102673,
FT                   3103525..3103631,3103768..3103837,3104264..3104326,
FT                   3106227..3106293,3106498..3106544,3108673..3108922))
FT                   /locus_tag="mCG_2008"
FT                   /product="mCG2008, transcript variant mCT174954"
FT                   /note="gene_id=mCG2008.2 transcript_id=mCT174954.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(3094715..3095596,3096481..3096910,
FT                   3099230..3099304,3099789..3099861,3102506..3102673,
FT                   3103525..3103631,3103768..3103837,3104264..3104326,
FT                   3106227..3106293,3106498..3106544,3108673..3108922))
FT                   /locus_tag="mCG_2008"
FT                   /product="mCG2008, transcript variant mCT1193"
FT                   /note="gene_id=mCG2008.2 transcript_id=mCT1193.2 created on
FT                   25-OCT-2002"
FT   CDS             complement(join(3095398..3095596,3096481..3096910,
FT                   3099230..3099304,3099789..3099861,3102506..3102673,
FT                   3103525..3103631,3103768..3103837,3104264..3104326,
FT                   3106227..3106293,3106498..3106544,3108673..3108819))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2008"
FT                   /product="mCG2008, isoform CRA_a"
FT                   /note="gene_id=mCG2008.2 transcript_id=mCT1193.2
FT                   protein_id=mCP23619.2 isoform=CRA_a"
FT                   /protein_id="EDL12377.1"
FT                   /translation="MEAPAATSPSIGFPIDGRCNYFVEKKKRFCRMVAAAGKRFCGEHA
FT                   GSAEEENTRKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFFIQDINAGLKDETEI
FT                   PEQLVPFSSLSEEQLENLIKKLRKASEGLNSTHEDHIMSHPALHDALNDPRNGDCAVKH
FT                   LKQQASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRF
FT                   KVDGKHRKKDSVFERLQIDIQHLCLNRVPVLREGRLPVVGIGKHLCGVATDVALRCLVE
FT                   TYAASFEEKDEEPLAKRIKNDKTEKESNTLAKEGSEKDVPETWTPVAGIVIALCCHHRC
FT                   DWRHYVGKEYFKALGLGAVEFYYFQRMSSWATCGMRTSLEGSDVTPERKDAQRDENEEH
FT                   DDGGDRLTDGNTDSLPGILTVEEKKKIGHLCKLLIDQGRLQYLQQKGFSPALQYYTDPL
FT                   VSLENVLLTAVPAHPSSQEKHHQ"
FT   CDS             complement(join(3096650..3096711,3099230..3099304,
FT                   3099789..3099861,3102506..3102673,3103525..3103631,
FT                   3103768..3103837,3104264..3104326,3106227..3106293,
FT                   3106498..3106544,3108673..3108819))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2008"
FT                   /product="mCG2008, isoform CRA_b"
FT                   /note="gene_id=mCG2008.2 transcript_id=mCT174954.0
FT                   protein_id=mCP97873.0 isoform=CRA_b"
FT                   /db_xref="GOA:V9GWW9"
FT                   /db_xref="InterPro:IPR007871"
FT                   /db_xref="InterPro:IPR021721"
FT                   /db_xref="InterPro:IPR022776"
FT                   /db_xref="MGI:MGI:1925219"
FT                   /db_xref="UniProtKB/TrEMBL:V9GWW9"
FT                   /protein_id="EDL12378.1"
FT                   /translation="MEAPAATSPSIGFPIDGRCNYFVEKKKRFCRMVAAAGKRFCGEHA
FT                   GSAEEENTRKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFFIQDINAGLKDETEI
FT                   PEQLVPFSSLSEEQLENLIKKLRKASEGLNSTHEDHIMSHPALHDALNDPRNGDCAVKH
FT                   LKQQASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRF
FT                   KVDGKHRKKDSVFERLQIDIQHLCLNRVPVLREGRLPVVGIGKHLCGVATGVTGDIMWA
FT                   KSISRLLDLGR"
FT   assembly_gap    3098078..3098097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3108714..3142887
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /note="gene_id=mCG2348.2"
FT   mRNA            join(3108714..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135215,3140825..3140919,
FT                   3142270..3142364,3142460..3142887)
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans),
FT                   transcript variant mCT1197"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT1197.2 created on
FT                   25-OCT-2002"
FT   mRNA            join(3108714..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135215,3140825..3141313)
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans),
FT                   transcript variant mCT174963"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT174963.0 created
FT                   on 25-OCT-2002"
FT   mRNA            join(3108714..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135309)
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans),
FT                   transcript variant mCT174962"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT174962.0 created
FT                   on 25-OCT-2002"
FT   CDS             join(3109148..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135215,3140825..3140919,
FT                   3142270..3142364,3142460..3142566)
FT                   /codon_start=1
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT1197.2
FT                   protein_id=mCP23627.2 isoform=CRA_a"
FT                   /protein_id="EDL12374.1"
FT                   /translation="MSQVLFQQLVPLLVKCKDCEERRGSVRVSIELQSLSNPVHRKDLV
FT                   IRLTDDTDPFFLYNLVISEEDFQSLKLQQGLLVDFLAFPQKFIDLLQQCMQEHAKETPR
FT                   FLLQLLSSATLLENSPVLLNVVETNPFKHLIHLSLKLLPGNDVEIKKFLAGCLKCSKEE
FT                   KLSLTRSLDDVTRQLHITQETLSEKMQELDKLRSEWASHTASLTNKHSQELTAEKEKAL
FT                   QTQVQCQQQHEQQKKELETLHQRNIHQLQSRLSELEAANKELTERKYKGDSTVRELKAK
FT                   LAGVEEELQRAKQEVLSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLR
FT                   TKEAFDTIQEQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMG
FT                   KLKLKNTVTIQQEKLLAEKEEMLQKERKESQDAGQSLRAKEQEVCRLQEQLETTVQKLE
FT                   ESKQLLKNNEKLITWLNKELNENQLVRKQDTLGTSATPHSTSNSTIRSGLSPNLNVVDR
FT                   LNYPSCGIGYPVSSALTFQNAFPHVVAAKNTSHPISGPKVHFNLQLTKPSASIDGQPGA
FT                   AVNRPCSNDKENGETLGLESKYLKRREASIPLRGLSQNLLSDSDHQKDGMLGAFQLSSK
FT                   PTVLPSSSSAYFPGQLPSS"
FT   CDS             join(3109148..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135215,3140825..3140923)
FT                   /codon_start=1
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT174963.0
FT                   protein_id=mCP97882.0 isoform=CRA_c"
FT                   /protein_id="EDL12376.1"
FT                   /translation="MSQVLFQQLVPLLVKCKDCEERRGSVRVSIELQSLSNPVHRKDLV
FT                   IRLTDDTDPFFLYNLVISEEDFQSLKLQQGLLVDFLAFPQKFIDLLQQCMQEHAKETPR
FT                   FLLQLLSSATLLENSPVLLNVVETNPFKHLIHLSLKLLPGNDVEIKKFLAGCLKCSKEE
FT                   KLSLTRSLDDVTRQLHITQETLSEKMQELDKLRSEWASHTASLTNKHSQELTAEKEKAL
FT                   QTQVQCQQQHEQQKKELETLHQRNIHQLQSRLSELEAANKELTERKYKGDSTVRELKAK
FT                   LAGVEEELQRAKQEVLSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLR
FT                   TKEAFDTIQEQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMG
FT                   KLKLKNTVTIQQEKLLAEKEEMLQKERKESQDAGQSLRAKEQEVCRLQEQLETTVQKLE
FT                   ESKQLLKNNEKLITWLNKELNENQLVRKQDTLGTSATPHSTSNSTIRSGLSPNLNVVDR
FT                   LNYPSCGIGYPVSSALTFQNAFPHVVAAKNTSHPISGPKVHFNLQLTKPSASIDGQPGA
FT                   AVNRPCSNDKEK"
FT   CDS             join(3109148..3109212,3117396..3117456,3119131..3119210,
FT                   3119599..3119703,3121026..3121197,3122087..3122152,
FT                   3123967..3124086,3127609..3127800,3131962..3132156,
FT                   3132266..3132355,3132430..3132609,3132957..3133038,
FT                   3133765..3133898,3135090..3135230)
FT                   /codon_start=1
FT                   /gene="Sass6"
FT                   /locus_tag="mCG_2348"
FT                   /product="spindle assembly 6 homolog (C. elegans), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2348.2 transcript_id=mCT174962.0
FT                   protein_id=mCP97881.0 isoform=CRA_b"
FT                   /protein_id="EDL12375.1"
FT                   /translation="MSQVLFQQLVPLLVKCKDCEERRGSVRVSIELQSLSNPVHRKDLV
FT                   IRLTDDTDPFFLYNLVISEEDFQSLKLQQGLLVDFLAFPQKFIDLLQQCMQEHAKETPR
FT                   FLLQLLSSATLLENSPVLLNVVETNPFKHLIHLSLKLLPGNDVEIKKFLAGCLKCSKEE
FT                   KLSLTRSLDDVTRQLHITQETLSEKMQELDKLRSEWASHTASLTNKHSQELTAEKEKAL
FT                   QTQVQCQQQHEQQKKELETLHQRNIHQLQSRLSELEAANKELTERKYKGDSTVRELKAK
FT                   LAGVEEELQRAKQEVLSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLR
FT                   TKEAFDTIQEQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMG
FT                   KLKLKNTVTIQQEKLLAEKEEMLQKERKESQDAGQSLRAKEQEVCRLQEQLETTVQKLE
FT                   ESKQLLKNNEKLITWLNKELNENQLVRKQDTLGTSATPHSTSNSTIRSGLSPNLNVVDR
FT                   LNYPSCGIGYPVSSALTFQNAFPHVVAAKNTSHPISGPKVAKC"
FT   assembly_gap    3113314..3113415
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    3138439..3138767
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    3143115..3143251
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            complement(3144996..3176597)
FT                   /gene="Hiat1"
FT                   /locus_tag="mCG_2343"
FT                   /note="gene_id=mCG2343.2"
FT   mRNA            complement(join(3144996..3146307,3147559..3147722,
FT                   3148740..3148837,3150117..3150229,3154425..3154496,
FT                   3155285..3155398,3155748..3155966,3159408..3159522,
FT                   3161825..3161952,3162562..3162624,3165447..3165542,
FT                   3176350..3176597))
FT                   /gene="Hiat1"
FT                   /locus_tag="mCG_2343"
FT                   /product="hippocampus abundant gene transcript 1"
FT                   /note="gene_id=mCG2343.2 transcript_id=mCT1201.2 created on
FT                   26-JUL-2002"
FT   CDS             complement(join(3146101..3146307,3147559..3147722,
FT                   3148740..3148837,3150117..3150229,3154425..3154496,
FT                   3155285..3155398,3155748..3155966,3159408..3159522,
FT                   3161825..3161952,3162562..3162624,3165447..3165542,
FT                   3176350..3176433))
FT                   /codon_start=1
FT                   /gene="Hiat1"
FT                   /locus_tag="mCG_2343"
FT                   /product="hippocampus abundant gene transcript 1"
FT                   /note="gene_id=mCG2343.2 transcript_id=mCT1201.2
FT                   protein_id=mCP23624.2"
FT                   /db_xref="GOA:P70187"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1201609"
FT                   /protein_id="EDL12373.1"
FT                   /translation="MTQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIF
FT                   LEFFAWGLLTAPTLVVLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSF
FT                   LLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLV
FT                   SATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASW
FT                   GAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPES
FT                   VAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAA
FT                   GAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVE
FT                   LKELPITGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRS
FT                   SSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV"
FT   assembly_gap    3152956..3152975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3174774..3174793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3183423..3226314)
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /note="gene_id=mCG2345.2"
FT   mRNA            complement(join(3183423..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208487,3225937..3226314))
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, transcript variant
FT                   mCT1199"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT1199.2 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(3183423..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208487,3209442..3209609,
FT                   3225937..3226314))
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, transcript variant
FT                   mCT174960"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT174960.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(3183423..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208487,3225537..3225603))
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, transcript variant
FT                   mCT174961"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT174961.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(3187588..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208487,3225537..3225554))
FT                   /codon_start=1
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, isoform CRA_b"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT174961.0
FT                   protein_id=mCP97880.0 isoform=CRA_b"
FT                   /protein_id="EDL12372.1"
FT                   /translation="MERVPVTNEEKTMSANLKYLSLGILVFQTTSLVLTMRYSRTLKEE
FT                   GPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSG
FT                   IYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGV
FT                   AFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNI
FT                   QLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNI
FT                   LKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAGNPTKA"
FT   CDS             complement(join(3187588..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208469))
FT                   /codon_start=1
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, isoform CRA_a"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT1199.2
FT                   protein_id=mCP23630.2 isoform=CRA_a"
FT                   /protein_id="EDL12370.1"
FT                   /translation="MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVV
FT                   AEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVA
FT                   LSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQEL
FT                   NSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLM
FT                   GVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIIL
FT                   STIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAGNPTKA"
FT   CDS             complement(join(3187588..3187678,3189139..3189272,
FT                   3191844..3191962,3195084..3195255,3201047..3201169,
FT                   3201256..3201410,3208283..3208469))
FT                   /codon_start=1
FT                   /gene="Slc35a3"
FT                   /locus_tag="mCG_2345"
FT                   /product="solute carrier family 35 (UDP-N-acetylglucosamine
FT                   (UDP-GlcNAc) transporter), member 3, isoform CRA_a"
FT                   /note="gene_id=mCG2345.2 transcript_id=mCT174960.0
FT                   protein_id=mCP97879.0 isoform=CRA_a"
FT                   /protein_id="EDL12371.1"
FT                   /translation="MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVV
FT                   AEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVA
FT                   LSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQEL
FT                   NSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLM
FT                   GVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIIL
FT                   STIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAGNPTKA"
FT   assembly_gap    3196037..3196103
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3217561..3217580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3227879..3227965
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    3229579..3229655
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    3234290..3234309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3236900..3240316
FT                   /estimated_length=3417
FT                   /gap_type="unknown"
FT   assembly_gap    3241745..3241764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3243308..3243327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3246329..3246542
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            complement(3253025..>3313322)
FT                   /locus_tag="mCG_2006"
FT                   /note="gene_id=mCG2006.3"
FT   mRNA            complement(join(3253025..3255390,3256835..3256968,
FT                   3257072..3257159,3260787..3260884,3262374..3262585,
FT                   3263408..3263520,3265028..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..3312612,3313219..3313291))
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, transcript variant mCT1191"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT1191.2 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(3253025..3255390,3256835..3256968,
FT                   3257072..3257159,3260787..3260884,3262374..3262585,
FT                   3263408..3263520,3265028..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..3312612,3312739..3313224))
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, transcript variant mCT174953"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT174953.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(3255273..3255390,3256835..3256968,
FT                   3257072..3257159,3260787..3260884,3262374..3262585,
FT                   3263408..3263520,3265028..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..3312544))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, isoform CRA_a"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT1191.2
FT                   protein_id=mCP23617.2 isoform=CRA_a"
FT                   /protein_id="EDL12367.1"
FT                   /translation="MEHSKQIRILLLNEMEKLEKTLFRLEQGFELQFRLGPTLQGKAVT
FT                   VYTNYPLPGEAFNREKFRSLDWENPTEREDDSDKYCKLHLQQSGSFQYYFLQGNEKSGG
FT                   GYIVVDPILRIGVDNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPL
FT                   QTLGLSRSCYSLADQLELNPDFSRPSKRYTWSDVGQLVEKLKREWNILCITDVVYNHTA
FT                   TNSKWILEHPESAYNLVNSPHLKPAWVLDRALWHFSCDVADGKYREKGVPALIENDQHM
FT                   NCIRKIIWEDIFPRIQLWEFFQVDVHKAVEQFRRLLSQENRRVTKSEPKEHLKIIQDPE
FT                   YRRRGCAVDMDTALATFIPHDNGPAAIEECCNWFRKRLEELNSEKHHLTSCHQEQAVNC
FT                   LLGNVFYERLAGHGPKLGPVTRKYPLVTRYFTFPFGEMALSAEEALIHLPDKACFLMAH
FT                   NGWVMGDDPLRNFAEPGSDVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITA
FT                   THFQGVRLDNCHSTPLHVAEYMLDAARKLQPNLYVVAELFTGSEELDNIFVTRLGISSL
FT                   IREAMSAYNSHEEGRLVYRYGGEPVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHR
FT                   SAYDALPSTTVVSMACCASGSTRGYDELVPHQISVVAEERFYTKWNPGASPADTGDVNV
FT                   HSGIIAARCAINRLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRN
FT                   PKTSFYSKEVPQMCIPGKIEEVVLEARTIERNTKPYKKDENSINGMPNMTVELREHIQL
FT                   HESKIVRQAGVATKGPNEYIQEIEFENLSPGSVIIFRVSLDPHAQVAVGILRNHLTQFS
FT                   SHFKSGSLAVDNADPILKIPFASIASKLTLAELNQVLYRCESEEQEDGGGCYDIPNWSS
FT                   LKYAGLQGLMSVLAEIRPKNDLGHPFCENLRSGDWMIDYVSGRLISRSGSIAEVGKWLQ
FT                   AMFFYLKQIPRYLIPCYFDAILIGAYTTLLDVAWKKMSSFVQNGSTFVKHLSLGSVQMC
FT                   GVGKCPCLPLLSPSLLDVPCRLNEITKEKEQCCASLAAGLPHFSSGLFRCWGRDTFIAL
FT                   RGMLLVTGRYLEARNIILAFASTLRHGLIPNLLGEGTYARYNCRDAVWWWLQCIQDYCR
FT                   TVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPLFEVIQEAMQRHMQGIQFRERNAGPQ
FT                   IDRNMKDEGFNITAGIDEETGFVYGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAV
FT                   EIVGLCKSAVRWLLELSKKNIFPYHEVRVKRHGKVVAVSYDEWNRKIQNNFEKLFHVSE
FT                   DPSDPNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTAEKAWKALE
FT                   IAEKKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNLARGFNYHQGPEWLWPIGYFLRA
FT                   KLYFSKMMGPETAAKTVFLVKNVLSRHYVHLERSPWKGLPELTNENGQYCPFSCETQAW
FT                   SMAVVLETLYDL"
FT   CDS             complement(join(3255273..3255390,3256835..3256968,
FT                   3257072..3257159,3260787..3260884,3262374..3262585,
FT                   3263408..3263520,3265028..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..3312544))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, isoform CRA_a"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT174953.0
FT                   protein_id=mCP97872.0 isoform=CRA_a"
FT                   /protein_id="EDL12369.1"
FT                   /translation="MEHSKQIRILLLNEMEKLEKTLFRLEQGFELQFRLGPTLQGKAVT
FT                   VYTNYPLPGEAFNREKFRSLDWENPTEREDDSDKYCKLHLQQSGSFQYYFLQGNEKSGG
FT                   GYIVVDPILRIGVDNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPL
FT                   QTLGLSRSCYSLADQLELNPDFSRPSKRYTWSDVGQLVEKLKREWNILCITDVVYNHTA
FT                   TNSKWILEHPESAYNLVNSPHLKPAWVLDRALWHFSCDVADGKYREKGVPALIENDQHM
FT                   NCIRKIIWEDIFPRIQLWEFFQVDVHKAVEQFRRLLSQENRRVTKSEPKEHLKIIQDPE
FT                   YRRRGCAVDMDTALATFIPHDNGPAAIEECCNWFRKRLEELNSEKHHLTSCHQEQAVNC
FT                   LLGNVFYERLAGHGPKLGPVTRKYPLVTRYFTFPFGEMALSAEEALIHLPDKACFLMAH
FT                   NGWVMGDDPLRNFAEPGSDVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITA
FT                   THFQGVRLDNCHSTPLHVAEYMLDAARKLQPNLYVVAELFTGSEELDNIFVTRLGISSL
FT                   IREAMSAYNSHEEGRLVYRYGGEPVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHR
FT                   SAYDALPSTTVVSMACCASGSTRGYDELVPHQISVVAEERFYTKWNPGASPADTGDVNV
FT                   HSGIIAARCAINRLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRN
FT                   PKTSFYSKEVPQMCIPGKIEEVVLEARTIERNTKPYKKDENSINGMPNMTVELREHIQL
FT                   HESKIVRQAGVATKGPNEYIQEIEFENLSPGSVIIFRVSLDPHAQVAVGILRNHLTQFS
FT                   SHFKSGSLAVDNADPILKIPFASIASKLTLAELNQVLYRCESEEQEDGGGCYDIPNWSS
FT                   LKYAGLQGLMSVLAEIRPKNDLGHPFCENLRSGDWMIDYVSGRLISRSGSIAEVGKWLQ
FT                   AMFFYLKQIPRYLIPCYFDAILIGAYTTLLDVAWKKMSSFVQNGSTFVKHLSLGSVQMC
FT                   GVGKCPCLPLLSPSLLDVPCRLNEITKEKEQCCASLAAGLPHFSSGLFRCWGRDTFIAL
FT                   RGMLLVTGRYLEARNIILAFASTLRHGLIPNLLGEGTYARYNCRDAVWWWLQCIQDYCR
FT                   TVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPLFEVIQEAMQRHMQGIQFRERNAGPQ
FT                   IDRNMKDEGFNITAGIDEETGFVYGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAV
FT                   EIVGLCKSAVRWLLELSKKNIFPYHEVRVKRHGKVVAVSYDEWNRKIQNNFEKLFHVSE
FT                   DPSDPNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTAEKAWKALE
FT                   IAEKKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNLARGFNYHQGPEWLWPIGYFLRA
FT                   KLYFSKMMGPETAAKTVFLVKNVLSRHYVHLERSPWKGLPELTNENGQYCPFSCETQAW
FT                   SMAVVLETLYDL"
FT   mRNA            complement(join(3264714..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..3312612,3313219..>3313322))
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, transcript variant mCT190582"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT190582.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3265024..3265163,3268373..3268484,
FT                   3268825..3269050,3274120..3274222,3276674..3276849,
FT                   3277716..3277849,3278093..3278229,3281863..3281993,
FT                   3283953..3284087,3284389..3284501,3284590..3284714,
FT                   3286060..3286210,3286326..3286481,3286577..3286678,
FT                   3286922..3287085,3287854..3287977,3289879..3290066,
FT                   3290486..3290625,3291956..3292053,3292145..3292247,
FT                   3292656..3292779,3293698..3293809,3293953..3294134,
FT                   3296431..3296634,3297431..3297597,3299026..3299236,
FT                   3312463..>3312580))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2006"
FT                   /product="mCG2006, isoform CRA_b"
FT                   /note="gene_id=mCG2006.3 transcript_id=mCT190582.0
FT                   protein_id=mCP111548.0 isoform=CRA_b"
FT                   /protein_id="EDL12368.1"
FT                   /translation="FYGKSSNPPEAKMEHSKQIRILLLNEMEKLEKTLFRLEQGFELQF
FT                   RLGPTLQGKAVTVYTNYPLPGEAFNREKFRSLDWENPTEREDDSDKYCKLHLQQSGSFQ
FT                   YYFLQGNEKSGGGYIVVDPILRIGVDNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVAK
FT                   ESGYNMIHFTPLQTLGLSRSCYSLADQLELNPDFSRPSKRYTWSDVGQLVEKLKREWNI
FT                   LCITDVVYNHTATNSKWILEHPESAYNLVNSPHLKPAWVLDRALWHFSCDVADGKYREK
FT                   GVPALIENDQHMNCIRKIIWEDIFPRIQLWEFFQVDVHKAVEQFRRLLSQENRRVTKSE
FT                   PKEHLKIIQDPEYRRRGCAVDMDTALATFIPHDNGPAAIEECCNWFRKRLEELNSEKHH
FT                   LTSCHQEQAVNCLLGNVFYERLAGHGPKLGPVTRKYPLVTRYFTFPFGEMALSAEEALI
FT                   HLPDKACFLMAHNGWVMGDDPLRNFAEPGSDVYLRRELICWGDSVKLRYGNKPEDCPYL
FT                   WAHMKKYTEITATHFQGVRLDNCHSTPLHVAEYMLDAARKLQPNLYVVAELFTGSEELD
FT                   NIFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEPVGSFVQPCLRPLMPAIAHALFMD
FT                   ITHDNECPIVHRSAYDALPSTTVVSMACCASGSTRGYDELVPHQISVVAEERFYTKWNP
FT                   GASPADTGDVNVHSGIIAARCAINRLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQ
FT                   SVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEARTIERNTKPYKKDENSINGMP
FT                   NMTVELREHIQLHESKIVRQAGVATKGPNEYIQEIEFENLSPGSVIIFRVSLDPHAQVA
FT                   VGILRNHLTQFSSHFKSGSLAVDNADPILKIPFASIASKLTLAELNQVLYRCESEEQED
FT                   GGGCYDIPNWSSLKYAGLQGLMSVLAEIRPKNDLGHPFCENLRSGDWMIDYVSGRLISR
FT                   SGSIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLDVAWKKMSSFVQNGSTF
FT                   VKHLSLGSVQMCGVGKCPCLPLLSPSLLDVPCRLNEITKEKEQCCASLAAGLPHFSSGL
FT                   FRCWGRDTFIALRGMLLVTGRYLEARNIILAFASTLRHGLIPNLLGEGTYARYNCRDAV
FT                   WWWLQCIQDYCRTVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPLFEVIQEAMQRHMQ
FT                   GIQFRERNAGPQIDRNMKDEGFNITAGIDEETGFVYGGNRFNCGTWMDKMGESDRARNR
FT                   GIPATPR"
FT   assembly_gap    3288624..3288757
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    3329702..3339842
FT                   /estimated_length=10141
FT                   /gap_type="unknown"
FT   gene            3340768..3341122
FT                   /pseudo
FT                   /locus_tag="mCG_142593"
FT                   /note="gene_id=mCG142593.0"
FT   mRNA            3340768..3341122
FT                   /pseudo
FT                   /locus_tag="mCG_142593"
FT                   /note="gene_id=mCG142593.0 transcript_id=mCT181060.0
FT                   created on 11-MAR-2003"
FT   assembly_gap    3344733..3344919
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    3345573..3348811
FT                   /estimated_length=3239
FT                   /gap_type="unknown"
FT   assembly_gap    3354262..3354281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3359368..>3409777
FT                   /locus_tag="mCG_2344"
FT                   /note="gene_id=mCG2344.1"
FT   mRNA            join(3359368..3359385,3364570..3364658,3388162..3388378,
FT                   3391234..3391370,3391952..3392046,3393251..3393398,
FT                   3395313..3395495,3401446..3401544,3402351..3402498,
FT                   3406001..3406114,3407191..3407306,3409686..>3409777)
FT                   /locus_tag="mCG_2344"
FT                   /product="mCG2344"
FT                   /note="gene_id=mCG2344.1 transcript_id=mCT1202.1 created on
FT                   26-JUL-2002"
FT   assembly_gap    3359895..3361057
FT                   /estimated_length=1163
FT                   /gap_type="unknown"
FT   assembly_gap    3363891..3364192
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    3365683..3365704
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    3367196..3368155
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    3368987..3369178
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    3372882..3374160
FT                   /estimated_length=1279
FT                   /gap_type="unknown"
FT   assembly_gap    3375330..3375349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3376493..3381846
FT                   /estimated_length=5354
FT                   /gap_type="unknown"
FT   assembly_gap    3387110..3387129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3388183..3388378,3391234..3391370,3391952..3392046,
FT                   3393251..3393398,3395313..3395495,3401446..3401544,
FT                   3402351..3402498,3406001..3406114,3407191..3407306,
FT                   3409686..>3409777)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2344"
FT                   /product="mCG2344"
FT                   /note="gene_id=mCG2344.1 transcript_id=mCT1202.1
FT                   protein_id=mCP23625.2"
FT                   /protein_id="EDL12366.1"
FT                   /translation="MAAPQITLSVLVIALLTCSVTAYPNGKVPMSCGGMIPQHNHSPQS
FT                   EPIHQITVSQTTFKPGDQIEVTLSGPPFRGFLLEARDAENLSGPPIGSFTLIDSEESQL
FT                   LTCTDVQGLAVSHTRSSKKTEIKVYWDAPSPAPDHIRFLATVVQKFKIYWVKIPSPVIS
FT                   QPNAPPFTTPKATTQPLTTPPSVSHLTKPFSAFECGNKKFCVRSPLNCDPEKEPACVFL
FT                   SFTRDNQSVMVEMSGPSDGYVSFAFSHDQWMGDDDAYLCIREDQTVDIQPSYLTGRSYP
FT                   VMDSRGTLEDMAWRLADGVIQCSFRRNITLPEAKNRFVLNESYYIFFAEGPSHDGRIFR
FT                   HSQQPLITYEKYNVTDTPKSVGGSRSSPLLKAHGALMFVAWMTTVSIGVLVARFFRSVW
FT                   SKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWV"
FT   assembly_gap    3388430..3388968
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    3391707..3391733
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    3398767..3398786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3410025..3428433
FT                   /estimated_length=18409
FT                   /gap_type="unknown"
FT   gene            complement(<3428457..3470444)
FT                   /locus_tag="mCG_10436"
FT                   /note="gene_id=mCG10436.2"
FT   mRNA            complement(join(<3428457..3428571,3428689..3428722,
FT                   3428863..3428977,3449063..3449187,3454539..3454619,
FT                   3469979..3470444))
FT                   /locus_tag="mCG_10436"
FT                   /product="mCG10436"
FT                   /note="gene_id=mCG10436.2 transcript_id=mCT10492.2 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(<3428457..3428571,3428689..3428722,
FT                   3428863..3428977,3449063..3449187,3454539..3454619,
FT                   3469979..3470023))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10436"
FT                   /product="mCG10436"
FT                   /note="gene_id=mCG10436.2 transcript_id=mCT10492.2
FT                   protein_id=mCP8659.2"
FT                   /protein_id="EDL12365.1"
FT                   /translation="MEEAELVKGRLQAITDKRKIQEEISQKRLKIEEEKLKHQHLKKKA
FT                   LREKWLLDGIGSGKEHEEMRKQNQQDQHQTQVLEQSILRLEKEIQDLEKAELQISANEE
FT                   AILKKLKSIEKTTEDIIRSVKVEKEENPEESIEDIYANIPDLPSSYIPSRLRKERNEGP
FT                   DDEQNRKG"
FT   assembly_gap    3432372..3433997
FT                   /estimated_length=1626
FT                   /gap_type="unknown"
FT   assembly_gap    3450563..3451320
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   gene            3469747..3486051
FT                   /locus_tag="mCG_1045678"
FT                   /note="gene_id=mCG1045678.0"
FT   mRNA            join(3469747..3470080,3471188..3471261,3485118..3486051)
FT                   /locus_tag="mCG_1045678"
FT                   /product="mCG1045678"
FT                   /note="gene_id=mCG1045678.0 transcript_id=mCT163382.0
FT                   created on 10-JAN-2003"
FT   CDS             join(3469983..3470080,3471188..3471261,3485118..3485122)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045678"
FT                   /product="mCG1045678"
FT                   /note="gene_id=mCG1045678.0 transcript_id=mCT163382.0
FT                   protein_id=mCP89726.1"
FT                   /db_xref="GOA:D3Z622"
FT                   /db_xref="MGI:MGI:1921904"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z622"
FT                   /protein_id="EDL12364.1"
FT                   /translation="MAWSLPFTSSASSILEVKDRQTLKEVQSYHKSSHRGHTLSQSPEE
FT                   QDYRFQESEITKA"
FT   assembly_gap    3470478..3470497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3472767..3472786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3480647..3480767
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    3491535..3491554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3500356..3501088)
FT                   /pseudo
FT                   /locus_tag="mCG_1045603"
FT                   /note="gene_id=mCG1045603.1"
FT   mRNA            complement(3500356..3501088)
FT                   /pseudo
FT                   /locus_tag="mCG_1045603"
FT                   /note="gene_id=mCG1045603.1 transcript_id=mCT163307.1
FT                   created on 24-FEB-2003"
FT   assembly_gap    3512843..3514209
FT                   /estimated_length=1367
FT                   /gap_type="unknown"
FT   assembly_gap    3520642..3520661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3530502..3533050
FT                   /estimated_length=2549
FT                   /gap_type="unknown"
FT   assembly_gap    3545925..3547654
FT                   /estimated_length=1730
FT                   /gap_type="unknown"
FT   assembly_gap    3548708..3548953
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    3554042..3555460
FT                   /estimated_length=1419
FT                   /gap_type="unknown"
FT   gene            complement(3555909..3572533)
FT                   /locus_tag="mCG_55565"
FT                   /note="gene_id=mCG55565.2"
FT   mRNA            complement(join(3555909..3556259,3556492..3556733,
FT                   3556868..3557070,3562494..3562600,3563747..3563834,
FT                   3571764..3571993,3572159..3572533))
FT                   /locus_tag="mCG_55565"
FT                   /product="mCG55565"
FT                   /note="gene_id=mCG55565.2 transcript_id=mCT55748.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(3557012..3557070,3562494..3562600,
FT                   3563747..3563834,3571764..3571902))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55565"
FT                   /product="mCG55565"
FT                   /note="gene_id=mCG55565.2 transcript_id=mCT55748.2
FT                   protein_id=mCP30916.2"
FT                   /protein_id="EDL12363.1"
FT                   /translation="MAASFKETSTENRDASSTDPSSAGMNILYLAVLLYSLEPSLFLER
FT                   QDTLGKGPGRNKSSYVFILENPSTSKEATNRLTPHSIRLVKVQQSNAVVSRVWLPLPRL
FT                   TSDVPLKMKLEATLLELILVNMIRMN"
FT   assembly_gap    3557959..3558395
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    3589528..3589548
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(3595363..3596025)
FT                   /pseudo
FT                   /locus_tag="mCG_1045677"
FT                   /note="gene_id=mCG1045677.0"
FT   mRNA            complement(3595363..3596025)
FT                   /pseudo
FT                   /locus_tag="mCG_1045677"
FT                   /note="gene_id=mCG1045677.0 transcript_id=mCT163381.1
FT                   created on 11-MAR-2003"
FT   assembly_gap    3610187..3610206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3616148..3616167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3619038..3619701
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    3620836..3620855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3632526..3633360
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    3634859..3635451
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    3639110..3639129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3640140..3640159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3641231..3641250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3644260..3644416
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3662169..3662624
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    3673361..3673556
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            3677435..3678062
FT                   /pseudo
FT                   /locus_tag="mCG_1045676"
FT                   /note="gene_id=mCG1045676.1"
FT   mRNA            3677435..3678062
FT                   /pseudo
FT                   /locus_tag="mCG_1045676"
FT                   /note="gene_id=mCG1045676.1 transcript_id=mCT163380.1
FT                   created on 11-MAR-2003"
FT   assembly_gap    3688100..3688119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3692073..3692471
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    3703206..3703225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3704945..3704964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3706410..3706429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3713444..3713484
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3719619..3719638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3720925..3721328)
FT                   /locus_tag="mCG_1045602"
FT                   /note="gene_id=mCG1045602.0"
FT   mRNA            complement(join(3720925..3721030,3721160..3721328))
FT                   /locus_tag="mCG_1045602"
FT                   /product="mCG1045602"
FT                   /note="gene_id=mCG1045602.0 transcript_id=mCT163306.1
FT                   created on 24-FEB-2003"
FT   CDS             complement(join(3720929..3721030,3721160..3721312))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045602"
FT                   /product="mCG1045602"
FT                   /note="gene_id=mCG1045602.0 transcript_id=mCT163306.1
FT                   protein_id=mCP89556.1"
FT                   /protein_id="EDL12362.1"
FT                   /translation="MPLTKDCLHPSPEKKRKHKKNHLVRSSNSYFTDVKCPGCYKITTV
FT                   FSHAQTTVILCVGCSTVLCQPTGGKARLTEGCSFRRKQH"
FT   assembly_gap    3743978..3744917
FT                   /estimated_length=940
FT                   /gap_type="unknown"
FT   assembly_gap    3766020..3766095
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    3782426..3782445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3789820..3789839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3811285..3811460
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            complement(3811461..3850548)
FT                   /gene="D3Bwg0562e"
FT                   /locus_tag="mCG_10437"
FT                   /note="gene_id=mCG10437.2"
FT   mRNA            complement(join(3811461..3812797,3815614..3815787,
FT                   3816509..3816566,3818015..3818210,3821472..3821601,
FT                   3825222..3825407,3849695..3850548))
FT                   /gene="D3Bwg0562e"
FT                   /locus_tag="mCG_10437"
FT                   /product="DNA segment, Chr 3, Brigham & Women's Genetics
FT                   0562 expressed"
FT                   /note="gene_id=mCG10437.2 transcript_id=mCT10493.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(3811472..3812797,3815614..3815787,
FT                   3816509..3816566,3818015..3818210,3821472..3821601,
FT                   3825222..3825407,3849695..3849919))
FT                   /codon_start=1
FT                   /gene="D3Bwg0562e"
FT                   /locus_tag="mCG_10437"
FT                   /product="DNA segment, Chr 3, Brigham & Women's Genetics
FT                   0562 expressed"
FT                   /note="gene_id=mCG10437.2 transcript_id=mCT10493.2
FT                   protein_id=mCP8660.2"
FT                   /protein_id="EDL12361.1"
FT                   /translation="MQRAGSSGARGECDISGAGRLRLEQAARLGGRTVHTSPGGGLGAR
FT                   QAAGMSAKERPKGKVIKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSC
FT                   YDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNIN
FT                   AGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVS
FT                   CKENSYIVEDICSGSDLTVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKP
FT                   LLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSEDSMLQ
FT                   HRDALRSLTDLNQDPSRVLSAKNGSSGDGIAHTEGILNRNHRDASSLTNLKRANADVEI
FT                   ITPRSPMGKESMVTFSNTLPRANTPSVEDPVRRNASIHASMDSARSKQLLTQWKSKNES
FT                   RKMSLQVMDTEPEGQSPPRSIEMRSSSEPSRVGVNGDHHVPGNQYLKIQPGTVPGCNNS
FT                   MPGGPRVSIQSRPGSSQLVHIPEETQENISTSPKSSSARAKWLKAAEKTVACNRSNNQP
FT                   RIMQVIAMSKQQGVLQSSPKNAEGSTVTCTGSIRYKTLTDHEPSGIVRVEAHPENNRPI
FT                   IQIPSSTEGEGSGSWKWKAPEKSSLRQTYELNDLNRDSESCESLKDSFGSGDRKRSNID
FT                   SNEHHHHGITTIRVTPVEGSEIGSETLSVSSSRDSTLRRKGNIILIPERSNSPENTRNI
FT                   FYKGNLPHAGL"
FT   assembly_gap    3815118..3815137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3841605..3841624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3851191..3851356
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    3852422..3852450
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3859207..3859226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3861873..3861928
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    3864504..3864734
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    3897124..3897168
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    3906835..3906854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3910592..3910611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3911716..3911735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3919519..3919741
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    3934321..3934340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3938539..3938558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3957418..3957437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3962431..3962450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3965974..3965993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3967338..3967357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3968433..3968452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3970428..3970447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3976948..3978378
FT                   /estimated_length=1431
FT                   /gap_type="unknown"
FT   assembly_gap    3988090..3988109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3993347..3993366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3997081..4002321
FT                   /estimated_length=5241
FT                   /gap_type="unknown"
FT   assembly_gap    4004164..4004183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4005191..4005210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4006228..4006247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4007635..4007654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4009367..4009386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4033624..4033643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4074892..4187468
FT                   /gene="4833424O15Rik"
FT                   /locus_tag="mCG_10439"
FT                   /note="gene_id=mCG10439.2"
FT   mRNA            join(4074892..4075734,4121643..4121775,4125295..4125545,
FT                   4162113..4162289,4171560..4171679,4186183..4187468)
FT                   /gene="4833424O15Rik"
FT                   /locus_tag="mCG_10439"
FT                   /product="RIKEN cDNA 4833424O15, transcript variant
FT                   mCT10495"
FT                   /note="gene_id=mCG10439.2 transcript_id=mCT10495.2 created
FT                   on 25-OCT-2002"
FT   mRNA            join(<4075027..4075734,4121643..4121775,4125295..4125545,
FT                   4162113..4162289,4171560..4171694,4186183..4187465)
FT                   /gene="4833424O15Rik"
FT                   /locus_tag="mCG_10439"
FT                   /product="RIKEN cDNA 4833424O15, transcript variant
FT                   mCT190561"
FT                   /note="gene_id=mCG10439.2 transcript_id=mCT190561.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4075291..4075734,4121643..4121775,4125295..4125545,
FT                   4162113..4162289,4171560..4171694,4186183..4186215)
FT                   /codon_start=1
FT                   /gene="4833424O15Rik"
FT                   /locus_tag="mCG_10439"
FT                   /product="RIKEN cDNA 4833424O15, isoform CRA_b"
FT                   /note="gene_id=mCG10439.2 transcript_id=mCT190561.0
FT                   protein_id=mCP111531.0 isoform=CRA_b"
FT                   /protein_id="EDL12360.1"
FT                   /translation="PPPLHPARASRSPVASSASASAAASLRLAPPRPAAAPAAAPPVAV
FT                   PRRSPEGACGASTARSARLGQEACMPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDT
FT                   FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLAT
FT                   RDFENQEKTILTGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLA
FT                   LCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAATYLTMYITS
FT                   TIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVV
FT                   NNFKGRQPENGHIHRDNVARMPMTNIPRVESPLEKVTSLQNHVTAFAEVT"
FT   CDS             join(4075498..4075734,4121643..4121775,4125295..4125545,
FT                   4162113..4162289,4171560..4171679,4186183..4186215)
FT                   /codon_start=1
FT                   /gene="4833424O15Rik"
FT                   /locus_tag="mCG_10439"
FT                   /product="RIKEN cDNA 4833424O15, isoform CRA_a"
FT                   /note="gene_id=mCG10439.2 transcript_id=mCT10495.2
FT                   protein_id=mCP8656.2 isoform=CRA_a"
FT                   /protein_id="EDL12359.1"
FT                   /translation="MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFC
FT                   HDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTI
FT                   LTGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALG
FT                   CQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLA
FT                   KPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPEN
FT                   GHIHRDNVARMPMTNIPRVESPLEKNHVTAFAEVT"
FT   assembly_gap    4077159..4077178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4080838..4081230
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    4083224..4083385
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    4102353..4102372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4120478..4120497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4122440..4122459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4133585..4133604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4135913..4135932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4178383..4178402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4210019..4210079
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    4216983..4217002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4240323..4240342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4243425..4244157
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   gene            complement(4281194..4346443)
FT                   /locus_tag="mCG_10440"
FT                   /note="gene_id=mCG10440.2"
FT   mRNA            complement(join(4281194..4282073,4300538..4300690,
FT                   4329369..4329455,4332631..4332830,4336870..4337068,
FT                   4338552..4338716,4339660..4339770,4346251..4346443))
FT                   /locus_tag="mCG_10440"
FT                   /product="mCG10440"
FT                   /note="gene_id=mCG10440.2 transcript_id=mCT10496.3 created
FT                   on 05-MAR-2003"
FT   CDS             complement(join(4281996..4282073,4300538..4300690,
FT                   4329369..4329455,4332631..4332830,4336870..4337068,
FT                   4338552..4338716,4339660..4339770,4346251..4346421))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10440"
FT                   /product="mCG10440"
FT                   /note="gene_id=mCG10440.2 transcript_id=mCT10496.3
FT                   protein_id=mCP8657.3"
FT                   /db_xref="GOA:Q5M8N3"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028656"
FT                   /db_xref="MGI:MGI:1923811"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M8N3"
FT                   /protein_id="EDL12358.1"
FT                   /translation="MDMNSFSPMMPTSPLSMINQIKFEDGPDLKDLFITVDAPESHVTT
FT                   IETFITYRIVTKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKG
FT                   MVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDFKVFLTAQAEELSSYKKQGPGLLS
FT                   RMGQTVRAVASSMRGVKNRPEEFMEMNNFIETFSQKINLIDKISQRIYKEERDYFDEMK
FT                   EYGPIHILWSASEEELVDTLKGMAGCIEQCCKATEKRMAGLSEALLPVVHEYVLYSEML
FT                   VGVMKRRDQIQTELDSKVEALTYKKADIDLLTEEIGKLEDKVECANNALKADWERWKQN
FT                   MKNDLRSAFTDTAEQNIRYYEQCLATWESFLTSQTDLPSEEDSEEKL"
FT   assembly_gap    4316169..4316218
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    4316635..4316816
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    4319857..4319940
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    4334800..4334819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4350490..4350509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4368116..4368413
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   gene            complement(4387937..4388375)
FT                   /pseudo
FT                   /locus_tag="mCG_49001"
FT                   /note="gene_id=mCG49001.2"
FT   mRNA            complement(4387937..4388375)
FT                   /pseudo
FT                   /locus_tag="mCG_49001"
FT                   /note="gene_id=mCG49001.2 transcript_id=mCT49184.2 created
FT                   on 24-FEB-2003"
FT   assembly_gap    4406331..4406350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4429913..4429979
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    4449556..4449575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4468512..>4472911
FT                   /locus_tag="mCG_1045915"
FT                   /note="gene_id=mCG1045915.0"
FT   mRNA            join(<4468512..4470217,4472689..>4472911)
FT                   /locus_tag="mCG_1045915"
FT                   /product="mCG1045915"
FT                   /note="gene_id=mCG1045915.0 transcript_id=mCT163619.0
FT                   created on 10-JAN-2003"
FT   CDS             join(<4470168..4470217,4472689..>4472911)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045915"
FT                   /product="mCG1045915"
FT                   /note="gene_id=mCG1045915.0 transcript_id=mCT163619.0
FT                   protein_id=mCP89480.0"
FT                   /protein_id="EDL12357.1"
FT                   /translation="ILNYGKTQKLCVYVVLRYESSILYTGTRFKSGCEMSHESWELSPG
FT                   FLEELRHLSGHLLGILNASYLCHLLLCNTKRLYRENELPNKLIFPH"
FT   assembly_gap    4484913..4487381
FT                   /estimated_length=2469
FT                   /gap_type="unknown"
FT   assembly_gap    4532084..4532103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4553219..4553265
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    4561247..4561266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4568733..4568810
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4599884..4599911
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    4600594..4605430
FT                   /estimated_length=4837
FT                   /gap_type="unknown"
FT   assembly_gap    4666785..4666804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4678408..4678427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4697828..4698390
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    4732928..4733218
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    4745235..4745254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4754293..4754312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4775372..4775591
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    4798967..4798986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4814986..4815005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4816224..4816243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4821828..4821847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4853832..4853851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4863862..4863881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4921621..4921812
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            <4925326..5024945
FT                   /locus_tag="mCG_125342"
FT                   /note="gene_id=mCG125342.1"
FT   mRNA            join(<4925326..4925443,4928266..4928375,4928496..4928890,
FT                   5009061..5009190,5023554..5023610,5024651..5024945)
FT                   /locus_tag="mCG_125342"
FT                   /product="mCG125342, transcript variant mCT126602"
FT                   /note="gene_id=mCG125342.1 transcript_id=mCT126602.1
FT                   created on 25-OCT-2002"
FT   mRNA            join(<4925326..4925443,4928266..4928375,4928496..4928890,
FT                   4953577..4953644,4967884..4968098)
FT                   /locus_tag="mCG_125342"
FT                   /product="mCG125342, transcript variant mCT174950"
FT                   /note="gene_id=mCG125342.1 transcript_id=mCT174950.0
FT                   created on 25-OCT-2002"
FT   CDS             join(<4928369..4928375,4928496..4928749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125342"
FT                   /product="mCG125342, isoform CRA_a"
FT                   /note="gene_id=mCG125342.1 transcript_id=mCT174950.0
FT                   protein_id=mCP97869.0 isoform=CRA_a"
FT                   /protein_id="EDL12354.1"
FT                   /translation="PPELEIEQPFGRSGQEAIEHSFGAFFREIELWIYGPGQAQPSPSQ
FT                   GRAPQQEFFLAAAAVAAAAAAAVTAVAEAEAAAAWPSDSLR"
FT   CDS             join(<4928369..4928375,4928496..4928749)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125342"
FT                   /product="mCG125342, isoform CRA_a"
FT                   /note="gene_id=mCG125342.1 transcript_id=mCT126602.1
FT                   protein_id=mCP89496.1 isoform=CRA_a"
FT                   /protein_id="EDL12355.1"
FT                   /translation="PPELEIEQPFGRSGQEAIEHSFGAFFREIELWIYGPGQAQPSPSQ
FT                   GRAPQQEFFLAAAAVAAAAAAAVTAVAEAEAAAAWPSDSLR"
FT   assembly_gap    4929062..4929461
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   gene            4929661..4930890
FT                   /locus_tag="mCG_147415"
FT                   /note="gene_id=mCG147415.0"
FT   mRNA            4929661..4930890
FT                   /locus_tag="mCG_147415"
FT                   /product="mCG147415"
FT                   /note="gene_id=mCG147415.0 transcript_id=mCT187678.0
FT                   created on 13-JAN-2004"
FT   CDS             4929817..4930122
FT                   /codon_start=1
FT                   /locus_tag="mCG_147415"
FT                   /product="mCG147415"
FT                   /note="gene_id=mCG147415.0 transcript_id=mCT187678.0
FT                   protein_id=mCP109639.0"
FT                   /db_xref="GOA:Q8BQ83"
FT                   /db_xref="MGI:MGI:3642633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQ83"
FT                   /protein_id="EDL12356.1"
FT                   /translation="MLMDHKAMWMGPLLARSKQSLARSLPSRRGIPGASGLSRSLRCSL
FT                   EPENMVHRGGRQGQRLENSTLAVSGPLGCAVCFSYSLEAAGSLGASKVGGESLGRE"
FT   assembly_gap    4950091..4950110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4995530..4995604
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    5050559..5050785
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    5055397..5055532
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            5057216..5930717
FT                   /gene="Dpyd"
FT                   /locus_tag="mCG_141369"
FT                   /note="gene_id=mCG141369.0"
FT   mRNA            join(5057216..5057425,5105966..5106076,5170019..5170101,
FT                   5254440..5254527,5276593..5276754,5292103..5292299,
FT                   5298806..5298887,5305939..5306026,5391408..5391515,
FT                   5393481..5393650,5411389..5411599,5439449..5439633,
FT                   5494272..5494487,5559759..5559923,5630406..5630474,
FT                   5636586..5636669,5689200..5689320,5690027..5690146,
FT                   5761207..5761349,5810036..5810215,5908138..5908281,
FT                   5924932..5925072,5929281..5930717)
FT                   /gene="Dpyd"
FT                   /locus_tag="mCG_141369"
FT                   /product="dihydropyrimidine dehydrogenase"
FT                   /note="gene_id=mCG141369.0 transcript_id=mCT174974.0
FT                   created on 25-OCT-2002"
FT   CDS             join(5057387..5057425,5105966..5106076,5170019..5170101,
FT                   5254440..5254527,5276593..5276754,5292103..5292299,
FT                   5298806..5298887,5305939..5306026,5391408..5391515,
FT                   5393481..5393650,5411389..5411599,5439449..5439633,
FT                   5494272..5494487,5559759..5559923,5630406..5630474,
FT                   5636586..5636669,5689200..5689320,5690027..5690146,
FT                   5761207..5761349,5810036..5810215,5908138..5908281,
FT                   5924932..5925072,5929281..5929451)
FT                   /codon_start=1
FT                   /gene="Dpyd"
FT                   /locus_tag="mCG_141369"
FT                   /product="dihydropyrimidine dehydrogenase"
FT                   /note="gene_id=mCG141369.0 transcript_id=mCT174974.0
FT                   protein_id=mCP97893.0"
FT                   /protein_id="EDL12353.1"
FT                   /translation="MAGVLSRDAPDIESILALNPRVQAHATLRSTAAKKLDKKHWKRNT
FT                   DKNCFTCEKLESNFDDIKHTTLGERGALREAVRCLKCADAPCQKSCPTSLDIKSFITSI
FT                   ANKNYYGAAKLIFSDNPLGLTCGMVCPTSDLCVGGCNLHAAEEGPINIGGLQQFATEVF
FT                   KAMNIPQIRNPSLPPPEHMPEAYSAKIALFGAGPASISCASFLARLGYSNITIFEKQEY
FT                   VGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSTDEMTLSSLKENGYRAAFI
FT                   GIGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKSSKTGMCACHSPLPSIRGAVIVLGA
FT                   GDTAFDCATSALRCGALRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVK
FT                   DGKIVAMQFVRTEQDETGNWVEDEEQTVRLKADVVISAFGSVLEDPKVKEALSPIKFNR
FT                   WGLPEVNPETMQTSEPWVFAGGDVVGMANTTVESVNDGKQASWYIHKHIQAQYGTSVPS
FT                   QPTMPLFYTPVDLVDISVEMAGLRFPNPFGLASATPATSTPMIRRAFEAGWGFALTKTF
FT                   SLDKDIVTNVSPRIIRGTTSGPLYGPGQSSFLNIELISEKTAAYWCHSVTELKADFPDN
FT                   ILIASIMCSYNKSDWMELSKMAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNI
FT                   CRWVRQAVRVPFFAKLTPNVTDIVSIARAAKEGGADGVTATNTVSGLMGLKADGTPWPA
FT                   VGIGRRTTYGGVSGTAIRPIALRAVTAIARALPGFPILATGGIDSAESGLQFLHSGASV
FT                   LQVCSAIQNQDFTVIEDYCTGLKALLYLKSIEELADWDGQSPPIISHQKGKPVPRVAEL
FT                   MGQKLPSFGPYLEQRKKIIAASKIRQKDQNTACSPLQRKHFNSQKPIPAIKDVIGKSLQ
FT                   YLGTFGEMSIMEQVVALIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLPTVSDTCTGC
FT                   TLCLSVCPIMDCIRMVSRATPYQPKRGLPLAVKPVC"
FT   assembly_gap    5058293..5058312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5067155..5068833
FT                   /estimated_length=1679
FT                   /gap_type="unknown"
FT   assembly_gap    5089836..5089855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5190598..5190718
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    5196363..5196552
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    5203109..5203459
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    5209840..5214956
FT                   /estimated_length=5117
FT                   /gap_type="unknown"
FT   assembly_gap    5226436..5226510
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    5270213..5270232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5336229..5337227
FT                   /estimated_length=999
FT                   /gap_type="unknown"
FT   assembly_gap    5346554..5346596
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    5375388..5375407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5388661..5388688
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    5418962..5418981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5421457..5421476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5425958..5426093
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    5506059..5506078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5530851..5530870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5562994..5563013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5567504..5567645
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    5568650..5568669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5569903..5570066
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    5577352..5577371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5579747..5579766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5580348..5580634
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    5676246..5677012
FT                   /estimated_length=767
FT                   /gap_type="unknown"
FT   assembly_gap    5703699..5705282
FT                   /estimated_length=1584
FT                   /gap_type="unknown"
FT   assembly_gap    5706926..5707777
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   assembly_gap    5722571..5722710
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    5731508..5731527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5760459..5760586
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    5808785..5808804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5812394..5812413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5817352..5817371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5829649..5830050
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    5854486..5854505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5856913..5856932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5877926..5878023
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    5909163..5909182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5915796..5915815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5940221..5940631
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    5942138..5942157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5946981..5947062
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5950478..5950497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5961166..5961185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5963916..5964201
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    5965886..5965954
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    5967925..5968000
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    5985183..5985289
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    6004563..6004582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6006598..6008009
FT                   /estimated_length=1412
FT                   /gap_type="unknown"
FT   assembly_gap    6016604..6016742
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    6019306..6019325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6021536..6021738
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    6023360..6023412
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    6049131..6050044
FT                   /estimated_length=914
FT                   /gap_type="unknown"
FT   assembly_gap    6052775..6052856
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    6099740..6099759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6111231..6111250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6123813..6124136
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    6128573..6128624
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    6154995..6155192
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    6157199..6157711
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    6181397..6181416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6205232..6205270
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            6206772..6207166
FT                   /pseudo
FT                   /locus_tag="mCG_1045561"
FT                   /note="gene_id=mCG1045561.1"
FT   mRNA            6206772..6207166
FT                   /pseudo
FT                   /locus_tag="mCG_1045561"
FT                   /note="gene_id=mCG1045561.1 transcript_id=mCT163265.1
FT                   created on 25-NOV-2002"
FT   gene            complement(6216257..>6278794)
FT                   /gene="Ptbp2"
FT                   /locus_tag="mCG_3638"
FT                   /note="gene_id=mCG3638.1"
FT   mRNA            complement(join(6216257..6217718,6217868..6217945,
FT                   6218050..6218266,6221366..6221458,6221884..6221917,
FT                   6223338..6223477,6237584..6237779,6244861..6244971,
FT                   6245059..6245223,6249107..6249250,6250187..6250359,
FT                   6258942..6259017,6278760..>6278794))
FT                   /gene="Ptbp2"
FT                   /locus_tag="mCG_3638"
FT                   /product="polypyrimidine tract binding protein 2,
FT                   transcript variant mCT171294"
FT                   /note="gene_id=mCG3638.1 transcript_id=mCT171294.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(6216257..6217721,6217868..6217945,
FT                   6218050..6218266,6221366..6221458,6221884..6221917,
FT                   6223338..6223477,6237584..6237779,6244861..6244971,
FT                   6245059..6245223,6249107..6249250,6250187..6250359,
FT                   6258942..6259017,6278760..>6278794))
FT                   /gene="Ptbp2"
FT                   /locus_tag="mCG_3638"
FT                   /product="polypyrimidine tract binding protein 2,
FT                   transcript variant mCT3087"
FT                   /note="gene_id=mCG3638.1 transcript_id=mCT3087.1 created on
FT                   26-JUL-2002"
FT   CDS             complement(join(6217589..6217718,6217868..6217945,
FT                   6218050..6218266,6221366..6221458,6221884..6221917,
FT                   6223338..6223477,6237584..6237779,6244861..6244971,
FT                   6245059..6245223,6249107..6249250,6250187..6250359,
FT                   6258942..6259017,6278760..>6278789))
FT                   /codon_start=1
FT                   /gene="Ptbp2"
FT                   /locus_tag="mCG_3638"
FT                   /product="polypyrimidine tract binding protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3638.1 transcript_id=mCT171294.0
FT                   protein_id=mCP94213.0 isoform=CRA_a"
FT                   /protein_id="EDL12351.1"
FT                   /translation="IVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFK
FT                   GEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAA
FT                   ITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGT
FT                   TVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQY
FT                   GDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQP
FT                   ALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVS
FT                   NLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYG
FT                   KIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSN
FT                   IPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENH
FT                   HLRVSFSKSTI"
FT   CDS             complement(join(6217589..6217721,6217868..6217945,
FT                   6218050..6218266,6221366..6221458,6221884..6221917,
FT                   6223338..6223477,6237584..6237779,6244861..6244971,
FT                   6245059..6245223,6249107..6249250,6250187..6250359,
FT                   6258942..6259017,6278760..>6278789))
FT                   /codon_start=1
FT                   /gene="Ptbp2"
FT                   /locus_tag="mCG_3638"
FT                   /product="polypyrimidine tract binding protein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3638.1 transcript_id=mCT3087.1
FT                   protein_id=mCP8658.2 isoform=CRA_b"
FT                   /protein_id="EDL12352.1"
FT                   /translation="IVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFK
FT                   GEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAA
FT                   ITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGT
FT                   TVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQY
FT                   GDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQP
FT                   ALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVS
FT                   NLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYG
FT                   KIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSN
FT                   IPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGEN
FT                   HHLRVSFSKSTI"
FT   assembly_gap    6279627..6280802
FT                   /estimated_length=1176
FT                   /gap_type="unknown"
FT   assembly_gap    6290850..6290869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6293342..6293385
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    6297232..6321575
FT                   /estimated_length=24344
FT                   /gap_type="unknown"
FT   assembly_gap    6331888..6332548
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    6383562..6384327
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    6385365..6385384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6408544..6409209
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    6452046..6452065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6461800..6461878
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6466180..6466575
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    6504580..6504599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6507509..6507877
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    6510532..6510551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6511706..6511725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6516498..6516517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6526149..6526503
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    6565707..6565726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6590214..6590233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6592292..6592311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6604752..6604771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6606577..6607266
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    6641925..6642215
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    6656372..6656391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6662981..6663000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6669604..6669623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6696517..6696536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6712396..6712437
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    6720147..6720300
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    6797666..6797828
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    6799893..6800545
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    6808251..6808609
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    6814266..6814289
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    6818308..6818327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6834313..6834332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6858633..6858706
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    6867684..6868386
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    6900231..6900250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6927422..>7343509)
FT                   /locus_tag="mCG_144624"
FT                   /note="gene_id=mCG144624.0"
FT   mRNA            complement(join(6927422..6928226,6931404..6931602,
FT                   6934250..6934417,6935105..6935382,6935955..6936082,
FT                   6936858..6937749,6937990..6938131,7087922..7087998,
FT                   7093573..7093647,7109315..7109417,7124152..7124204,
FT                   7126829..7126987,7146474..7146569,7146665..7146744,
FT                   7164672..7164788,7168639..7168776,7239438..7239543,
FT                   7264644..7264721,7343288..>7343509))
FT                   /locus_tag="mCG_144624"
FT                   /product="mCG144624"
FT                   /note="gene_id=mCG144624.0 transcript_id=mCT184048.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6936068..6936082,6936858..>6937268))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144624"
FT                   /product="mCG144624"
FT                   /note="gene_id=mCG144624.0 transcript_id=mCT184048.0
FT                   protein_id=mCP106163.0"
FT                   /protein_id="EDL12350.1"
FT                   /translation="DSTSYPSEWLESKIQVITDAPPLLVGLQACTTTLEISLAVPQKTG
FT                   HSTTRRSSNTSLLGIYPEDVPTGNKDTCSTMFIAALFIIPRSWKEPRCPSTEEWIQKMW
FT                   YIYTMEYYSAIKNNEFMKFLGKWMDLEDIILSEPFQS"
FT   assembly_gap    6973174..6973252
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6979701..6979944
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    6986559..6987151
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    6994418..6994565
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    7012401..7012420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7021429..7021448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7070843..7070862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7112917..7114605
FT                   /estimated_length=1689
FT                   /gap_type="unknown"
FT   assembly_gap    7155368..7155387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7177122..7177141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7185067..7185086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7186556..7186604
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    7187800..7187819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7220933..7222674
FT                   /estimated_length=1742
FT                   /gap_type="unknown"
FT   assembly_gap    7224384..7224403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7225292..7226311
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    7240048..7240137
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    7242856..7243125
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    7249774..7249793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7275085..7275104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7278603..7278622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7292307..7292326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7293421..7293440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7299232..7299532
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    7344453..7344574
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    7347600..7347851
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    7350675..7351281
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   assembly_gap    7368611..7370093
FT                   /estimated_length=1483
FT                   /gap_type="unknown"
FT   assembly_gap    7404383..7404511
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    7418662..7419444
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    7424002..7424208
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    7435687..7435848
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    7440065..7440084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7463851..7464487
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    7475407..7475549
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    7476693..7476712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7480061..7480080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7492683..7492702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7494168..7494363
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    7500745..7500764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7513146..7513165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7519241..7521035
FT                   /estimated_length=1795
FT                   /gap_type="unknown"
FT   assembly_gap    7521345..7522510
FT                   /estimated_length=1166
FT                   /gap_type="unknown"
FT   assembly_gap    7531208..7532097
FT                   /estimated_length=890
FT                   /gap_type="unknown"
FT   assembly_gap    7538124..7538143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7563147..7563166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7564396..7564415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7574443..7575460
FT                   /estimated_length=1018
FT                   /gap_type="unknown"
FT   assembly_gap    7587941..7587960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7590742..>7606567)
FT                   /locus_tag="mCG_4676"
FT                   /note="gene_id=mCG4676.2"
FT   mRNA            complement(join(7590742..7590954,7591084..7591199,
FT                   7591298..7591413,7593712..7594199,7606465..7606567))
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, transcript variant mCT171298"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT171298.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(7590762..7591199,7591298..7591413,
FT                   7593712..7594199,7606465..7606567))
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, transcript variant mCT171299"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT171299.0 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(7591085..7591199,7591298..7591413,
FT                   7593712..7594199,7606465..7606549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, isoform CRA_a"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT171298.0
FT                   protein_id=mCP94218.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UYX7"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="MGI:MGI:1920420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYX7"
FT                   /protein_id="EDL12346.1"
FT                   /translation="MVEEVRQELSALAAIFCGPNEWEMLSCSETDGAVFRIHTTAEGLV
FT                   GEDVPLELAFHLPVGYPLCLPGISVTSEHLTRAQCVTAKEKLLGEARKLVSEPMVHELV
FT                   LWIQQNLRLVLSQPETASSHEKCTLPESATGDDGPWMTLLRLDHMRARTKYVKAVEKWA
FT                   SELRLTGRLMFMGKLILILLQGDRSNIKEYLILQKTSKVDVDSSGKKCKEKMISVLSET
FT                   KVQTEHKRFLAFEVKEYSTLEELQKEFGAAGLGELFSECVLGLVK"
FT   CDS             complement(join(7591085..7591199,7591298..7591413,
FT                   7593712..7594199,7606465..7606549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, isoform CRA_a"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT171299.0
FT                   protein_id=mCP94217.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UYX7"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="MGI:MGI:1920420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYX7"
FT                   /protein_id="EDL12347.1"
FT                   /translation="MVEEVRQELSALAAIFCGPNEWEMLSCSETDGAVFRIHTTAEGLV
FT                   GEDVPLELAFHLPVGYPLCLPGISVTSEHLTRAQCVTAKEKLLGEARKLVSEPMVHELV
FT                   LWIQQNLRLVLSQPETASSHEKCTLPESATGDDGPWMTLLRLDHMRARTKYVKAVEKWA
FT                   SELRLTGRLMFMGKLILILLQGDRSNIKEYLILQKTSKVDVDSSGKKCKEKMISVLSET
FT                   KVQTEHKRFLAFEVKEYSTLEELQKEFGAAGLGELFSECVLGLVK"
FT   mRNA            complement(join(<7591175..7591199,7591298..7591413,
FT                   7593712..7594199,7594714..7594920,7606465..>7606567))
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, transcript variant mCT190587"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT190587.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<7591175..7591199,7591298..7591413,
FT                   7593712..7594199,7594714..>7594714))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, isoform CRA_b"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT190587.0
FT                   protein_id=mCP111515.0 isoform=CRA_b"
FT                   /protein_id="EDL12348.1"
FT                   /translation="QTDGAVFRIHTTAEGLVGEDVPLELAFHLPVGYPLCLPGISVTSE
FT                   HLTRAQCVTAKEKLLGEARKLVSEPMVHELVLWIQQNLRLVLSQPETASSHEKCTLPES
FT                   ATGDDGPWMTLLRLDHMRARTKYVKAVEKWASELRLTGRLMFMGKLILILLQGDRSNIK
FT                   EYLILQKTSKVDVDSSGKKCKEKMISVLSETKVQTEHKRFLAFEVKE"
FT   assembly_gap    7595681..7595779
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   mRNA            complement(join(7605484..7606054,7606147..7606291,
FT                   7606465..7606567))
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, transcript variant mCT4004"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT4004.2 created on
FT                   26-JUL-2002"
FT   CDS             complement(join(7605964..7606054,7606147..7606291,
FT                   7606465..7606549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4676"
FT                   /product="mCG4676, isoform CRA_c"
FT                   /note="gene_id=mCG4676.2 transcript_id=mCT4004.2
FT                   protein_id=mCP22899.2 isoform=CRA_c"
FT                   /protein_id="EDL12349.1"
FT                   /translation="MVEEVRQELSALAAIFCGPNEWEMLSCSDGAHCPSRETQLLQIVG
FT                   IPHKHLCITSLTTGRCSWLSATWKAVRKCLLRLLKNGSRFQTSAGRSMETFSSNPGRAP
FT                   TL"
FT   gene            complement(7614925..7615910)
FT                   /pseudo
FT                   /locus_tag="mCG_4681"
FT                   /note="gene_id=mCG4681.1"
FT   mRNA            complement(7614925..7615910)
FT                   /pseudo
FT                   /locus_tag="mCG_4681"
FT                   /note="gene_id=mCG4681.1 transcript_id=mCT4010.2 created on
FT                   25-OCT-2002"
FT   assembly_gap    7620239..7620258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7637153..>7718228)
FT                   /gene="Tmem56"
FT                   /locus_tag="mCG_145943"
FT                   /note="gene_id=mCG145943.0"
FT   mRNA            complement(join(7637153..7637318,7642707..7642862,
FT                   7646670..7646743,7663375..7663469,7663913..7663971,
FT                   7666305..7666394,7670315..7670519,7670942..7671036,
FT                   7682257..7682341,7715467..7715578,7718029..>7718228))
FT                   /gene="Tmem56"
FT                   /locus_tag="mCG_145943"
FT                   /product="transmembrane protein 56"
FT                   /note="gene_id=mCG145943.0 transcript_id=mCT186051.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(7637291..7637318,7642707..7642862,
FT                   7646670..7646743,7663375..7663469,7663913..7663971,
FT                   7666305..7666394,7670315..>7670514))
FT                   /codon_start=1
FT                   /gene="Tmem56"
FT                   /locus_tag="mCG_145943"
FT                   /product="transmembrane protein 56"
FT                   /note="gene_id=mCG145943.0 transcript_id=mCT186051.0
FT                   protein_id=mCP107716.0"
FT                   /protein_id="EDL12345.1"
FT                   /translation="RTMEASTKAAVGSGAMEASTKAVICTVCSSFVVFQILFHFVSYWF
FT                   SARVSSGYNSLSIDKKIEWNSRVVSTCHSLLVGIFGLYLFFFDEATITDPLWGDPTYVN
FT                   INIATASGYLISDLLIILFNWKVIGDKFFIIHHCAALTAYYFVLTTGALAYIANFRLLA
FT                   ELSSPFVNQRWFFEALKYPKFSKANVINGILMTVVFFIVRIISIPPMYFFLYSVYGTEP
FT                   YIRTCILKVNF"
FT   assembly_gap    7643191..7643210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7658023..7658184
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            complement(7685203..7685808)
FT                   /pseudo
FT                   /locus_tag="mCG_51819"
FT                   /note="gene_id=mCG51819.2"
FT   mRNA            complement(7685203..7685808)
FT                   /pseudo
FT                   /locus_tag="mCG_51819"
FT                   /note="gene_id=mCG51819.2 transcript_id=mCT52002.2 created
FT                   on 24-OCT-2002"
FT   assembly_gap    7688493..7688636
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    7700491..7700957
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    7708292..7708311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7711124..7711273
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            7726915..7803452
FT                   /gene="Alg14"
FT                   /locus_tag="mCG_4674"
FT                   /note="gene_id=mCG4674.2"
FT   mRNA            join(7726915..7727127,7734363..7734517,7755952..7756083,
FT                   7800725..7803452)
FT                   /gene="Alg14"
FT                   /locus_tag="mCG_4674"
FT                   /product="asparagine-linked glycosylation 14 homolog
FT                   (yeast), transcript variant mCT4002"
FT                   /note="gene_id=mCG4674.2 transcript_id=mCT4002.2 created on
FT                   26-JUL-2002"
FT   mRNA            join(7726915..7727127,7755952..7756083,7800725..7803452)
FT                   /gene="Alg14"
FT                   /locus_tag="mCG_4674"
FT                   /product="asparagine-linked glycosylation 14 homolog
FT                   (yeast), transcript variant mCT171297"
FT                   /note="gene_id=mCG4674.2 transcript_id=mCT171297.0 created
FT                   on 26-JUL-2002"
FT   CDS             join(7726992..7727127,7734363..7734517,7755952..7756083,
FT                   7800725..7800955)
FT                   /codon_start=1
FT                   /gene="Alg14"
FT                   /locus_tag="mCG_4674"
FT                   /product="asparagine-linked glycosylation 14 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG4674.2 transcript_id=mCT4002.2
FT                   protein_id=mCP22898.0 isoform=CRA_b"
FT                   /protein_id="EDL12344.1"
FT                   /translation="MVSILILAATAAGLVILLFQRLWTVLGPHHVTPRESLRLLIVAGS
FT                   GGHTTEILRLVGSLSNAYSPRHYVIAESDEMSAKKIHSLEELSRAQNDSTTEYPKYHLH
FT                   RIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIKPDLVLCNGPGTCVPICVSALLLGIL
FT                   GVKKVIIVYVESICRVETLSLSGKILRHLSDYFIVQWPTLKEKYPKSVYLGRIV"
FT   CDS             join(7726992..7727127,7755952..7756083,7800725..7800735)
FT                   /codon_start=1
FT                   /gene="Alg14"
FT                   /locus_tag="mCG_4674"
FT                   /product="asparagine-linked glycosylation 14 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG4674.2 transcript_id=mCT171297.0
FT                   protein_id=mCP94216.0 isoform=CRA_a"
FT                   /protein_id="EDL12343.1"
FT                   /translation="MVSILILAATAAGLVILLFQRLWTVLGPHHVTPRESLRLLIVAGS
FT                   VPQVPPSPNSEKPGGSAVLALLCVHYLLLHVVLLPTGSPNKARFGAV"
FT   assembly_gap    7730212..7730231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7735238..7735663
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    7744434..7744657
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    7752859..7752878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7753979..7754152
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    7760894..7761193
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    7765480..7765568
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    7768690..7769667
FT                   /estimated_length=978
FT                   /gap_type="unknown"
FT   assembly_gap    7785076..7785095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7786256..7786275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7795718..7795737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7796954..7796973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7799296..7799315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7808179..7808198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7809427..7809446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7816677..7816900
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   gene            complement(7819673..7820155)
FT                   /pseudo
FT                   /locus_tag="mCG_4680"
FT                   /note="gene_id=mCG4680.1"
FT   mRNA            complement(7819673..7820155)
FT                   /pseudo
FT                   /locus_tag="mCG_4680"
FT                   /note="gene_id=mCG4680.1 transcript_id=mCT4009.2 created on
FT                   24-OCT-2002"
FT   assembly_gap    7829017..7829926
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    7830305..7830324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7831341..7831360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7833280..7834216
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   assembly_gap    7838933..7839895
FT                   /estimated_length=963
FT                   /gap_type="unknown"
FT   assembly_gap    7841933..7842048
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    7848718..7848737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7855760..7855824
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    7859595..7859793
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            <7869225..7911400
FT                   /gene="Cnn3"
FT                   /locus_tag="mCG_126783"
FT                   /note="gene_id=mCG126783.1"
FT   mRNA            join(<7869225..7869539,7904922..7905059,7905422..7905538,
FT                   7908143..7908289,7910277..7911400)
FT                   /gene="Cnn3"
FT                   /locus_tag="mCG_126783"
FT                   /product="calponin 3, acidic"
FT                   /note="gene_id=mCG126783.1 transcript_id=mCT128058.1
FT                   created on 24-OCT-2002"
FT   assembly_gap    7869351..7869393
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   CDS             join(<7869447..7869539,7904922..7905059,7905422..7905538,
FT                   7908143..7908289,7910277..7910621)
FT                   /codon_start=1
FT                   /gene="Cnn3"
FT                   /locus_tag="mCG_126783"
FT                   /product="calponin 3, acidic"
FT                   /note="gene_id=mCG126783.1 transcript_id=mCT128058.1
FT                   protein_id=mCP89197.1 partial"
FT                   /protein_id="EDL12342.1"
FT                   /translation="LTARTLPVVQTAMTHFNKGPSYGLSAEVKNKLENIGNFIKAIQAY
FT                   GMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEG
FT                   KLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGA
FT                   SQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYC
FT                   AAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYPDDYPREYQYGDDQGIDY"
FT   assembly_gap    7871274..7871511
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    7872342..7873177
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   assembly_gap    7876650..7883851
FT                   /estimated_length=7202
FT                   /gap_type="unknown"
FT   assembly_gap    7886114..7886133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7888267..7888645
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    7889461..7893872
FT                   /estimated_length=4412
FT                   /gap_type="unknown"
FT   assembly_gap    7896873..7897367
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    7898654..7899998
FT                   /estimated_length=1345
FT                   /gap_type="unknown"
FT   assembly_gap    7900709..7904241
FT                   /estimated_length=3533
FT                   /gap_type="unknown"
FT   assembly_gap    7907661..7907680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7912724..7985459)
FT                   /gene="Slc44a3"
FT                   /locus_tag="mCG_4684"
FT                   /note="gene_id=mCG4684.2"
FT   mRNA            complement(join(7912724..7913271,7914297..7914533,
FT                   7916602..7916739,7939365..7939451,7943295..7943451,
FT                   7950717..7950882,7962373..7962559,7963191..7963315,
FT                   7965327..7965416,7966662..7966822,7977822..7977915,
FT                   7978662..7978798,7980059..7980201,7984782..7984886,
FT                   7985276..7985459))
FT                   /gene="Slc44a3"
FT                   /locus_tag="mCG_4684"
FT                   /product="solute carrier family 44, member 3"
FT                   /note="gene_id=mCG4684.2 transcript_id=mCT3997.2 created on
FT                   24-OCT-2002"
FT   CDS             complement(join(7913167..7913271,7914297..7914533,
FT                   7916602..7916739,7939365..7939451,7943295..7943451,
FT                   7950717..7950882,7962373..7962559,7963191..7963315,
FT                   7965327..7965416,7966662..7966822,7977822..7977915,
FT                   7978662..7978798,7980059..7980201,7984782..7984886,
FT                   7985276..7985314))
FT                   /codon_start=1
FT                   /gene="Slc44a3"
FT                   /locus_tag="mCG_4684"
FT                   /product="solute carrier family 44, member 3"
FT                   /note="gene_id=mCG4684.2 transcript_id=mCT3997.2
FT                   protein_id=mCP22907.2"
FT                   /db_xref="GOA:Q921V7"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="MGI:MGI:2384860"
FT                   /protein_id="EDL12341.1"
FT                   /translation="MPGTMQCLGAEYLVSAEKTRQREWRPQIYRKCTDTPWLVLFFLFW
FT                   TGLVFIMGYSVVAGAAGRLLFGYDSFGNVCGKKNSPVEGAPLSGQDMTLKKHVFFMNAC
FT                   NLEVKDRGLGPTALCVSSCPEKQLDTLEEVQLFANINGSFLCVYSLNSFNYTQSSSADT
FT                   LCPRLPVPPSKPFPLFNRCIPQTPECYSLFASVLINDADALHRILSGIMAGRDTILGLC
FT                   VFTFALSLAMLFAFRFISTLLIHIIISLVILGLLFVCGVLWWLYYDYTNDLSTELDTEK
FT                   ENMNCMLAFAIISTVVTVLLLALIFTLRKRIKLTVELLHVTNKAISSCPFLLFQPLWTC
FT                   AILIFFWVLWVAVLLSLGTAGTAQVMEGGQVEYKPLSGIRYMWWYHLIGLIWTSEFILA
FT                   CQRMTVAGAMVACYFNRNQNDPPARPILSSLFVLFCYHQGTAVKGSFLLTVTRIPRVIF
FT                   MCIYSTLKEPQRSAWSRGEFRCSHCGLWCLLKYLYHLNQDAYTATAINGTDFCTSAKDA
FT                   HTIIAKNSSHLTSVNCFGNFVIFLGKVLVVCFSIFGGLMAFNYSRALQVWAIPLLLVAF
FT                   FACVVAHSFLSVFETALDILFLCFAVDLETNDGSSEKPYFMDPGFLSVIKRTNNLNNAK
FT                   SQGQKDALPNEEGTELQPIVR"
FT   assembly_gap    7926793..7926900
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    7947443..7947628
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    7976411..7976557
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    7982228..7982488
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   gene            <7984787..7988508
FT                   /locus_tag="mCG_146133"
FT                   /note="gene_id=mCG146133.0"
FT   mRNA            join(<7984787..7985055,7985192..7985829,7986141..7986208,
FT                   7986645..7988508)
FT                   /locus_tag="mCG_146133"
FT                   /product="mCG146133"
FT                   /note="gene_id=mCG146133.0 transcript_id=mCT186236.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<7985025..7985055,7985192..7985583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146133"
FT                   /product="mCG146133"
FT                   /note="gene_id=mCG146133.0 transcript_id=mCT186236.0
FT                   protein_id=mCP107722.0"
FT                   /protein_id="EDL12340.1"
FT                   /translation="NPPGGQVLTRGQRSRKRPVCAGRCPQRPLLSGLKLSLLPGTRRPS
FT                   TAWYPASGIGGGGGRLAHGTEVRRPGQVAQEGRQGEQGSAPPRGPGRWSPRHALSVVAL
FT                   GWEDLLGAGVAPAQHRFPGSAPDHCATPGPVASAWS"
FT   assembly_gap    7985933..7985952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7993114..7993133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7997940..7997959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8007519..8007746
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    8021768..8021787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8029905..8030453
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    8032949..8032968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8037859..8038147
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    8042681..8043577
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    8044714..8044733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8046255..8046274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8048228..8049346
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   assembly_gap    8092281..8092300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8094870..8106461)
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /note="gene_id=mCG4677.2"
FT   mRNA            complement(join(8094870..8096560,8097368..8097622,
FT                   8099419..8099559,8103133..8103409))
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, transcript variant
FT                   mCT174967"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT174967.0 created
FT                   on 05-MAR-2003"
FT   mRNA            complement(join(8097056..8097622,8099419..8099559,
FT                   8106389..8106461))
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, transcript variant
FT                   mCT4005"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT4005.2 created on
FT                   05-MAR-2003"
FT   mRNA            complement(join(8097056..8097622,8099419..8099559,
FT                   8103137..8103293))
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, transcript variant
FT                   mCT180906"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT180906.0 created
FT                   on 05-MAR-2003"
FT   CDS             complement(join(8097542..8097622,8099419..8099559,
FT                   8103133..8103240))
FT                   /codon_start=1
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, isoform CRA_a"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT174967.0
FT                   protein_id=mCP97886.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C983"
FT                   /db_xref="MGI:MGI:2442643"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C983"
FT                   /protein_id="EDL12337.1"
FT                   /translation="MSARVCPLAECVLRARLNHVRVKTASIPIGEDTARCDVLFMSGSL
FT                   RHSAPQKQGILHLPMHWSRVKARTIRPGFLTQDKLMKKMKGKFSDKSSIKDLPHPSAGF
FT                   SGTPP"
FT   CDS             complement(join(8097542..8097622,8099419..8099547))
FT                   /codon_start=1
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, isoform CRA_b"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT4005.2
FT                   protein_id=mCP22910.2 isoform=CRA_b"
FT                   /protein_id="EDL12338.1"
FT                   /translation="MSGSLRHSAPQKQGILHLPMHWSRVKARTIRPGFLTQDKLMKKMK
FT                   GKFSDKSSIKDLPHPSAGFSGTPP"
FT   CDS             complement(join(8097542..8097622,8099419..8099547))
FT                   /codon_start=1
FT                   /gene="A730020M07Rik"
FT                   /locus_tag="mCG_4677"
FT                   /product="RIKEN cDNA A730020M07, isoform CRA_b"
FT                   /note="gene_id=mCG4677.2 transcript_id=mCT180906.0
FT                   protein_id=mCP103828.0 isoform=CRA_b"
FT                   /protein_id="EDL12339.1"
FT                   /translation="MSGSLRHSAPQKQGILHLPMHWSRVKARTIRPGFLTQDKLMKKMK
FT                   GKFSDKSSIKDLPHPSAGFSGTPP"
FT   assembly_gap    8105201..8105323
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            8130770..8143001
FT                   /locus_tag="mCG_1045899"
FT                   /note="gene_id=mCG1045899.1"
FT   mRNA            join(8130770..8131224,8131324..8131430,8133978..8134116,
FT                   8139430..8139617,8141338..8141407,8142836..8143001)
FT                   /locus_tag="mCG_1045899"
FT                   /product="mCG1045899"
FT                   /note="gene_id=mCG1045899.1 transcript_id=mCT163603.1
FT                   created on 28-MAR-2003"
FT   CDS             join(8131326..8131430,8133978..8134116,8139430..8139617,
FT                   8141338..8141407,8142836..8142858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045899"
FT                   /product="mCG1045899"
FT                   /note="gene_id=mCG1045899.1 transcript_id=mCT163603.1
FT                   protein_id=mCP89729.1"
FT                   /protein_id="EDL12336.1"
FT                   /translation="MVSPAASHLGYHGFPTLMDFKLEPVGTLVEYAVTTGHCHTPPVLA
FT                   SLEGSTQPEPTAGAGQAHQGVAPLPVTDTQPLLGGQGKQSCHHSNYHVSSPSDKPRMSR
FT                   NLPGFHVMLSAIPFVNDGLSCSTAEHQGAERGCVTCHKSQKNRNKNKQDRIKPPRLYQR
FT                   GQNEEKFCCCF"
FT   assembly_gap    8140218..8140237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8150520..8150610
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    8154696..8154715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8157107..8157126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8158617..8158636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8184289..8198944
FT                   /gene="F3"
FT                   /locus_tag="mCG_4679"
FT                   /note="gene_id=mCG4679.2"
FT   mRNA            join(8184289..8184544,8185719..8185824,8190064..8190281,
FT                   8195422..8195600,8196277..8196436,8198004..8198944)
FT                   /gene="F3"
FT                   /locus_tag="mCG_4679"
FT                   /product="coagulation factor III, transcript variant
FT                   mCT4008"
FT                   /note="gene_id=mCG4679.2 transcript_id=mCT4008.2 created on
FT                   26-JUL-2002"
FT   mRNA            join(8184289..8184544,8185719..8185824,8190064..8190281,
FT                   8195422..8195600,8198004..8198944)
FT                   /gene="F3"
FT                   /locus_tag="mCG_4679"
FT                   /product="coagulation factor III, transcript variant
FT                   mCT171300"
FT                   /note="gene_id=mCG4679.2 transcript_id=mCT171300.0 created
FT                   on 26-JUL-2002"
FT   CDS             join(8184457..8184544,8185719..8185824,8190064..8190281,
FT                   8195422..8195600,8198004..8198288)
FT                   /codon_start=1
FT                   /gene="F3"
FT                   /locus_tag="mCG_4679"
FT                   /product="coagulation factor III, isoform CRA_b"
FT                   /note="gene_id=mCG4679.2 transcript_id=mCT171300.0
FT                   protein_id=mCP94219.0 isoform=CRA_b"
FT                   /protein_id="EDL12335.1"
FT                   /translation="MAILVRPRLLAALAPTFLGCLLLQVTAGAGIPEKAFNLTWISTDF
FT                   KTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSV
FT                   PRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSL
FT                   TLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKHSSLWEQWCSWPPSLSSSCPYLCA
FT                   SAERTERDRKGRTPRRAWHRGKAEAANAHTACTALLRRALMGTVQHGAWSLPILAQRGC
FT                   LHGLLLQLTL"
FT   CDS             join(8184457..8184544,8185719..8185824,8190064..8190281,
FT                   8195422..8195600,8196277..8196436,8198004..8198137)
FT                   /codon_start=1
FT                   /gene="F3"
FT                   /locus_tag="mCG_4679"
FT                   /product="coagulation factor III, isoform CRA_a"
FT                   /note="gene_id=mCG4679.2 transcript_id=mCT4008.2
FT                   protein_id=mCP22911.2 isoform=CRA_a"
FT                   /protein_id="EDL12334.1"
FT                   /translation="MAILVRPRLLAALAPTFLGCLLLQVTAGAGIPEKAFNLTWISTDF
FT                   KTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSV
FT                   PRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSL
FT                   TLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQ
FT                   AMIFSRKTNQNSPGSSTVCTEQWKSFLGETLIIVGAVVLLATIFIILLSISLCKRRKNR
FT                   AGQKGKNTPSRLA"
FT   assembly_gap    8191767..8191786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8193071..8193090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8194940..8194959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8198975..8199361
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    8201145..8201205
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    8204824..8204843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8207319..8210531
FT                   /estimated_length=3213
FT                   /gap_type="unknown"
FT   assembly_gap    8212716..8213815
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   assembly_gap    8215863..8215882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217533..8220536
FT                   /estimated_length=3004
FT                   /gap_type="unknown"
FT   gene            <8222180..8241909
FT                   /locus_tag="mCG_144623"
FT                   /note="gene_id=mCG144623.0"
FT   mRNA            join(<8222180..8222793,8225404..8226740,8240257..8241909)
FT                   /locus_tag="mCG_144623"
FT                   /product="mCG144623"
FT                   /note="gene_id=mCG144623.0 transcript_id=mCT184047.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    8222798..8222817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8224038..8224057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8225144..8225163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<8226728..8226740,8240257..8240492)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144623"
FT                   /product="mCG144623"
FT                   /note="gene_id=mCG144623.0 transcript_id=mCT184047.0
FT                   protein_id=mCP106161.0"
FT                   /protein_id="EDL12333.1"
FT                   /translation="AEPQFFKKSPTSKYTKKNTPMNILMAYIYMHIYIYTHTHIHVCIY
FT                   MYTHTHTHTYIYIYTHLRISLWLTYTYTEENPAPTNG"
FT   assembly_gap    8227157..8227176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8228915..8228934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8230308..8230327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8232597..8232616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8233793..8238958
FT                   /estimated_length=5166
FT                   /gap_type="unknown"
FT   assembly_gap    8240233..8240252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8242173..8305147)
FT                   /gene="Abcd3"
FT                   /locus_tag="mCG_126778"
FT                   /note="gene_id=mCG126778.1"
FT   mRNA            complement(join(8242173..8243572,8244678..8244734,
FT                   8250398..8250502,8253840..8253959,8254385..8254474,
FT                   8254572..8254637,8256362..8256439,8259665..8259728,
FT                   8261260..8261332,8261413..8261504,8263221..8263312,
FT                   8263407..8263504,8263592..8263661,8267057..8267126,
FT                   8269615..8269757,8271987..8272043,8274070..8274193,
FT                   8274532..8274629,8276061..8276130,8281803..8281891,
FT                   8282873..8282971,8286566..8286602,8304949..8305147))
FT                   /gene="Abcd3"
FT                   /locus_tag="mCG_126778"
FT                   /product="ATP-binding cassette, sub-family D (ALD), member
FT                   3, transcript variant mCT128053"
FT                   /note="gene_id=mCG126778.1 transcript_id=mCT128053.1
FT                   created on 29-JUL-2002"
FT   mRNA            complement(join(8242173..8243572,8244678..8244734,
FT                   8250398..8250502,8253840..8253959,8256014..8256103,
FT                   8256199..8256264,8256362..8256439,8259665..8259728,
FT                   8261260..8261332,8261413..8261504,8263221..8263312,
FT                   8263407..8263504,8263592..8263661,8267057..8267126,
FT                   8269615..8269757,8271987..8272043,8274070..8274193,
FT                   8274532..8274629,8276061..8276130,8281803..8281891,
FT                   8282873..8282971,8286566..8286602,8304949..>8305136))
FT                   /gene="Abcd3"
FT                   /locus_tag="mCG_126778"
FT                   /product="ATP-binding cassette, sub-family D (ALD), member
FT                   3, transcript variant mCT190585"
FT                   /note="gene_id=mCG126778.1 transcript_id=mCT190585.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(8243495..8243572,8244678..8244734,
FT                   8250398..8250502,8253840..8253959,8256014..8256103,
FT                   8256199..8256264,8256362..8256439,8259665..8259728,
FT                   8261260..8261332,8261413..8261504,8263221..8263312,
FT                   8263407..8263504,8263592..8263661,8267057..8267126,
FT                   8269615..8269757,8271987..8272043,8274070..8274193,
FT                   8274532..8274629,8276061..8276130,8281803..8281891,
FT                   8282873..8282971,8286566..8286602,8304949..>8305136))
FT                   /codon_start=1
FT                   /gene="Abcd3"
FT                   /locus_tag="mCG_126778"
FT                   /product="ATP-binding cassette, sub-family D (ALD), member
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG126778.1 transcript_id=mCT190585.0
FT                   protein_id=mCP111544.0 isoform=CRA_b"
FT                   /protein_id="EDL12332.1"
FT                   /translation="SFPRGSCTEVVAGASPIPRLARPAGAMAAFSKYLTARNTSLAGAA
FT                   FLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFLSRLSQILKIMVPRT
FT                   FCKETGYLLLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSKDFKRYLFNFIAAMPLIS
FT                   LVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKF
FT                   CNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVSGLFLTRLRRPIGKMT
FT                   IMEQKYEGEYRYVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLVEHLHNFIFFRFSMG
FT                   FIDSIIAKYVATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQSGRMLLRMSQALGR
FT                   IVLAGREMTRLAGFTARITELMQVLKDLNHGRYERTMVSQQEKGIEGAQASPLVPGAGE
FT                   IINTDNIIKFDHVPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKSSLFRVLGELWP
FT                   LFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGKEDQKKGGISDQVLKEYLDNVQ
FT                   LGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEDYI
FT                   YSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKKITEDTVEFGS"
FT   CDS             complement(join(8243495..8243572,8244678..8244734,
FT                   8250398..8250502,8253840..8253959,8254385..8254474,
FT                   8254572..8254637,8256362..8256439,8259665..8259728,
FT                   8261260..8261332,8261413..8261504,8263221..8263312,
FT                   8263407..8263504,8263592..8263661,8267057..8267126,
FT                   8269615..8269757,8271987..8272043,8274070..8274193,
FT                   8274532..8274629,8276061..8276130,8281803..8281891,
FT                   8282873..8282971,8286566..8286602,8304949..8305058))
FT                   /codon_start=1
FT                   /gene="Abcd3"
FT                   /locus_tag="mCG_126778"
FT                   /product="ATP-binding cassette, sub-family D (ALD), member
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG126778.1 transcript_id=mCT128053.1
FT                   protein_id=mCP89528.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005283"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1349216"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VT3"
FT                   /protein_id="EDL12331.1"
FT                   /translation="MAAFSKYLTARNTSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPL
FT                   QNNEKEGKKERAVVDKVFLSRLSQILKIMVPRTFCKETGYLLLIAVMLVSRTYCDVWMI
FT                   QNGTLIESGIIGRSSKDFKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLY
FT                   EEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLT
FT                   SAIGAQGPASMMAYLLVSGLFLTRLRRPIGKMTIMEQKYEGEYRYVNSRLITNSEEIAF
FT                   YNGNKREKQTIHSVFRKLVEHLHNFIFFRFSMGFIDSIIAKYVATVVGYLVVSRPFLDL
FT                   AHPRHLHSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLK
FT                   DLNHGRYERTMVSQQEKGIEGAQASPLVPGAGEIINTDNIIKFDHVPLATPNGDILIQD
FT                   LSFEVRSGANVLICGPNGCGKSSLFRVLGELWPLFGGRLTKPERGKLFYVPQRPYMTLG
FT                   TLRDQVIYPDGKEDQKKRGVSDQVLKEYLDNVQLGHILEREGGWDSVQDWMDVLSGGEK
FT                   QRMAMARLFYHKPQFAILDECTSAVSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEY
FT                   YLHMDGRGNYEFKKITEDTVEFGS"
FT   assembly_gap    8248650..8248669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8250216..8250235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8252803..8252822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8254710..8254729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8255908..8255972
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    8257299..8257318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8261039..8261058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8262559..8262578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8264135..8264154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8264907..8265352
FT                   /pseudo
FT                   /locus_tag="mCG_142261"
FT                   /note="gene_id=mCG142261.0"
FT   mRNA            join(8264907..8264980,8265068..8265165,8265261..8265352)
FT                   /pseudo
FT                   /locus_tag="mCG_142261"
FT                   /note="gene_id=mCG142261.0 transcript_id=mCT179656.0
FT                   created on 04-FEB-2003"
FT   assembly_gap    8266066..8266085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8283286..8283305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8284090..8284157
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    8305211..8305230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8319691..8319746
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    8326339..8326593
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    8337184..8337203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8340634..8341303
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    8343100..8345427
FT                   /estimated_length=2328
FT                   /gap_type="unknown"
FT   assembly_gap    8347204..8347506
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    8355705..8356998
FT                   /estimated_length=1294
FT                   /gap_type="unknown"
FT   assembly_gap    8360637..8361375
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    8368291..8368647
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    8370717..8371504
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    8380298..8380653
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    8383729..8383748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8387245..8387523
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    8412957..8412976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8414425..8414444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8419869..8419888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8432398..8432891
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    8435625..8435644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8437677..8438748
FT                   /estimated_length=1072
FT                   /gap_type="unknown"
FT   gene            8459260..8508210
FT                   /gene="Arhgap29"
FT                   /locus_tag="mCG_9520"
FT                   /note="gene_id=mCG9520.2"
FT   mRNA            join(8459260..8459387,8465309..8465545,8473246..8473380,
FT                   8479920..8480016,8480343..8480415,8481722..8481770,
FT                   8482398..8482535,8483275..8483339,8483747..8483857,
FT                   8483946..8484026,8484155..8484343,8484993..8485130,
FT                   8493955..8494115,8494622..8494761,8495658..8495762,
FT                   8497062..8497160,8498183..8498322,8498951..8499139,
FT                   8499361..8499498,8501233..8501465,8502657..8502987,
FT                   8503472..8503580,8505558..8508210)
FT                   /gene="Arhgap29"
FT                   /locus_tag="mCG_9520"
FT                   /product="Rho GTPase activating protein 29"
FT                   /note="gene_id=mCG9520.2 transcript_id=mCT9547.2 created on
FT                   07-AUG-2002"
FT   CDS             join(8465341..8465545,8473246..8473380,8479920..8480016,
FT                   8480343..8480415,8481722..8481770,8482398..8482535,
FT                   8483275..8483339,8483747..8483857,8483946..8484026,
FT                   8484155..8484343,8484993..8485130,8493955..8494115,
FT                   8494622..8494761,8495658..8495762,8497062..8497160,
FT                   8498183..8498322,8498951..8499139,8499361..8499498,
FT                   8501233..8501465,8502657..8502987,8503472..8503580,
FT                   8505558..8506432)
FT                   /codon_start=1
FT                   /gene="Arhgap29"
FT                   /locus_tag="mCG_9520"
FT                   /product="Rho GTPase activating protein 29"
FT                   /note="gene_id=mCG9520.2 transcript_id=mCT9547.2
FT                   protein_id=mCP22890.2"
FT                   /protein_id="EDL12330.1"
FT                   /translation="MIAHKQKKAKKKRVWASGQPSAAITTSEMGLKSVSSSSSFDPEYI
FT                   KELVNDVRKFSHMLLYLKEAILSDCFKEVIHIRLDELLRVLKSILSKHQNLSSVDLQSA
FT                   AEVLTAKVKAVNFTEVNEENKNDIFREVFSSIETLAFTFGNILTNFLMGDVGSDSILRL
FT                   PISRESKSFENISVDSVDLPHEKGNFSPIELDNLLLKNTDSIELALSYAKTWSKYTKNI
FT                   VSWVEKKLNLELESTRNIVKLAEATRSSIGIQEFMPLQSLFTNALLSDIHSSHLLQQTI
FT                   AALQANKFVQPLLGRKNEMEKQRKEIKDLWKQQQNKLLETETALKKAKLLCMQRQDEYE
FT                   KAKSSMFRAEEEQLSSSVGLAKNLNKQLEKRRRLEEEALQKVEEANEHYKVCVTNVEER
FT                   RNDLENTKREILTQLRTLVFQCDLTLKAVTVNLFHMQQLQAASLANSLQSLCDSAKLYD
FT                   PGQEYSEFVKATSSSELEEKVDGNVNKQMTNSPQTSGYEPADSLEDVARLPDSCHKLEE
FT                   DRCSNSADMTGPSFVRSWKFGMFSDSESTGGSSESRSLDSESISPGDFHRKLPRTPSSG
FT                   TMSSADDLDEREPPSPSEAGPNSLGAFKKTLMSKAALTHKFRKLRSPTKCRDCDGIVMF
FT                   PGVECEECLLVCHRKCLENLVIICGHQKLQGKMHIFGAEFIQVAKKEPDGIPFVLKICA
FT                   SEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLP
FT                   EPFILFRLYKEFIDLAKEIQHVNEEQEAKKDSPEDKKHPHVSIEVNRILLKSKDLLRQL
FT                   PASHFNSLHYLIAHLRRVVDHAEENKMNSKNLGVIFGPTLIRPRPTTAPVTISSLAEYS
FT                   NQARLVEFLITYSQKIFDGSLQPQAVVISNTGAVAPQVDQGYLPKPLLSPDERDTDHSM
FT                   KPLFFSSKEDIRSSDCESKSFELTTSFEESERRQNALGKCDAPLLDNKVHLLFDQELES
FT                   ASQKMEDVCKSPKLLLLKSNRAANSVQRHTPRTKMRPVSLPVDRLLLLASSPTERSSRD
FT                   VGNVDSDKFGKNPAFEGLHRKDNSNTTRSKVNGFDQQNVQKSWDTQYVRNNFTAKTTMI
FT                   VPSAYPEKGLTVNTGNNRDHPGGKAHAEPARAAGDVSERRSSDSCPATAVRAPRTLQPQ
FT                   HWTTFYKPPNPTFSVRGTEEKTALPSIAVPPVLVHAPQIHVTKSDPDSEATLACPVQTS
FT                   GQPKESSEEPALPEGTPTCQRPRLKRMQQFEDLEDEIPQFV"
FT   assembly_gap    8511181..8511200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8511795..8512071
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   gene            8514924..8524134
FT                   /locus_tag="mCG_1050976"
FT                   /note="gene_id=mCG1050976.0"
FT   mRNA            join(8514924..8517297,8523137..8523265,8524091..8524134)
FT                   /locus_tag="mCG_1050976"
FT                   /product="mCG1050976"
FT                   /note="gene_id=mCG1050976.0 transcript_id=mCT194765.0
FT                   created on 27-JAN-2005"
FT   CDS             8516163..8516369
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050976"
FT                   /product="mCG1050976"
FT                   /note="gene_id=mCG1050976.0 transcript_id=mCT194765.0
FT                   protein_id=mCP115794.0"
FT                   /protein_id="EDL12329.1"
FT                   /translation="MIMTPSDTRVILYCASILYDVHTMTKLWTYFSNQIPVIKGHACIF
FT                   FSSISFEIFSICWPDWVQTLGLK"
FT   assembly_gap    8520619..8520638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8521838..8522071
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            <8535609..8672244
FT                   /gene="Abca4"
FT                   /locus_tag="mCG_9528"
FT                   /note="gene_id=mCG9528.1"
FT   mRNA            join(<8535609..8535761,8543985..8544078,8545275..8545416,
FT                   8546401..8546540,8553659..8553786,8560050..8560247,
FT                   8573057..8573146,8576002..8576242,8577706..8577799,
FT                   8578687..8578803,8579422..8579619,8594776..8594981,
FT                   8595535..8595711,8597408..8597630,8602633..8602854,
FT                   8604537..8604741,8608866..8608931,8612279..8612368,
FT                   8613915..8614089,8615843..8615974,8618666..8618805,
FT                   8619367..8619504,8620670..8620863,8621861..8621945,
FT                   8625069..8625274,8625598..8625646,8627543..8627805,
FT                   8629304..8629428,8629893..8629991,8630772..8630958,
FT                   8634039..8634133,8635748..8635780,8639547..8639652,
FT                   8639780..8639854,8640079..8640248,8641224..8641401,
FT                   8647345..8647460,8648406..8648553,8649932..8650055,
FT                   8650411..8650540,8654396..8654516,8654956..8655018,
FT                   8655883..8655989,8658743..8658884,8661617..8661751,
FT                   8662466..8662569,8665955..8666204,8668250..8668336,
FT                   8671987..8672244)
FT                   /gene="Abca4"
FT                   /locus_tag="mCG_9528"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   4"
FT                   /note="gene_id=mCG9528.1 transcript_id=mCT9555.2 created on
FT                   26-JUL-2002"
FT   assembly_gap    8554359..8554378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8564953..8564972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8566193..8566225
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    8568626..8568645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8569680..8569699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8577335..8577705
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   CDS             join(<8577707..8577799,8578687..8578803,8579422..8579619,
FT                   8594776..8594981,8595535..8595711,8597408..8597630,
FT                   8602633..8602854,8604537..8604741,8608866..8608931,
FT                   8612279..8612368,8613915..8614089,8615843..8615974,
FT                   8618666..8618805,8619367..8619504,8620670..8620863,
FT                   8621861..8621945,8625069..8625274,8625598..8625646,
FT                   8627543..8627805,8629304..8629428,8629893..8629991,
FT                   8630772..8630958,8634039..8634133,8635748..8635780,
FT                   8639547..8639652,8639780..8639854,8640079..8640248,
FT                   8641224..8641401,8647345..8647460,8648406..8648553,
FT                   8649932..8650055,8650411..8650540,8654396..8654516,
FT                   8654956..8655018,8655883..8655989,8658743..8658884,
FT                   8661617..8661751,8662466..8662569,8665955..8666204,
FT                   8668250..8668336,8671987..8672106)
FT                   /codon_start=1
FT                   /gene="Abca4"
FT                   /locus_tag="mCG_9528"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   4"
FT                   /note="gene_id=mCG9528.1 transcript_id=mCT9555.2
FT                   protein_id=mCP22896.2"
FT                   /protein_id="EDL12328.1"
FT                   /translation="TKIAWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKL
FT                   VKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGP
FT                   QEKQADDMTSFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEEN
FT                   RFWAGVVFPGMYPWASSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYI
FT                   WGGFAYLQDMVEQGIVKSQMQAEPPIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAW
FT                   IYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHG
FT                   RILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFA
FT                   WQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSM
FT                   KMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEP
FT                   LTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQI
FT                   TAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHH
FT                   LTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAF
FT                   VGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHMDEADLLGDRIAIISQ
FT                   GRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDE
FT                   ITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEET
FT                   LADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQ
FT                   YAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKD
FT                   FVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLA
FT                   DVLLNRPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHLFQKQKWTAAHPSPSCKC
FT                   STREKLTMLPECPEGAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSK
FT                   FWVNEQRYGGISIGGKLPAIPISGEALVGFLSGLGQMMNVSGGPVTREASKEMLDFLKH
FT                   LETTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQ
FT                   LSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLT
FT                   NFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLF
FT                   EVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLRFNAMLRKLLIVFPHFCLGRG
FT                   LIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLT
FT                   RWIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYSGSSSPAVDRLCVGV
FT                   RPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFD
FT                   AIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQILGLSLYADRLAGTYSGGNKRKLS
FT                   TAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHRFGDGYIVTMK
FT                   IKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQFQVPSSSLARIFQLLISHKDSL
FT                   LIEEYSVTQTTLDQVFVNFAKQQTETYDLPLHPRAAGASWQAKLEEKSGRLQTQEPLPT
FT                   GSEQLANGSNPTAAEDKHTRSPQ"
FT   assembly_gap    8599514..8599612
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    8605353..8605394
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    8611394..8611434
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    8613330..8613349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8617925..8618339
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    8627975..8627994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8660797..8661544
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    8662587..8664760
FT                   /estimated_length=2174
FT                   /gap_type="unknown"
FT   assembly_gap    8665155..8665517
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    8670796..8671098
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    8672245..8672954
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    8674594..8674766
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            complement(8675926..>8676957)
FT                   /locus_tag="mCG_126682"
FT                   /note="gene_id=mCG126682.1"
FT   mRNA            complement(8675926..>8676957)
FT                   /locus_tag="mCG_126682"
FT                   /product="mCG126682"
FT                   /note="gene_id=mCG126682.1 transcript_id=mCT127955.1
FT                   created on 24-OCT-2002"
FT   CDS             complement(8676427..>8676957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126682"
FT                   /product="mCG126682"
FT                   /note="gene_id=mCG126682.1 transcript_id=mCT127955.1
FT                   protein_id=mCP89438.1"
FT                   /protein_id="EDL12327.1"
FT                   /translation="GSQNSGCTIMTFCPNMEEFSGFSKYIAYMESQGAHLAGPAKVIST
FT                   TEWKGRRSYEDVPAMAIPAALQQVVSGKASVFTQYHKRTKGMTVGEYRELANSEKHLDF
FT                   EDLERKYWKNRLFGSPIYGADVSGSLFDENTHLWNVGHLGSLLDVLKQDRGIVIEGVNT
FT                   PYLYFGKWKTTFA"
FT   assembly_gap    8677591..8678421
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    8680598..8681209
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    8682249..8683316
FT                   /estimated_length=1068
FT                   /gap_type="unknown"
FT   assembly_gap    8684899..8684966
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    8687166..8687277
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    8688529..8688548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8689643..8690510
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   gene            complement(<8705091..>8712697)
FT                   /locus_tag="mCG_57372"
FT                   /note="gene_id=mCG57372.2"
FT   mRNA            complement(join(<8705091..8705233,8711229..8711329,
FT                   8712469..>8712697))
FT                   /locus_tag="mCG_57372"
FT                   /product="mCG57372"
FT                   /note="gene_id=mCG57372.2 transcript_id=mCT57555.2 created
FT                   on 29-JAN-2003"
FT   CDS             complement(join(8705091..8705233,8711229..8711329,
FT                   8712469..>8712695))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57372"
FT                   /product="mCG57372"
FT                   /note="gene_id=mCG57372.2 transcript_id=mCT57555.2
FT                   protein_id=mCP42650.2"
FT                   /protein_id="EDL12326.1"
FT                   /translation="SVIIGCKAAGAAMIIAVDINKDKFAKAGAVGVTYCVDPRDLEKPI
FT                   EEFLLDMLNGGTDFCFEVTGNTETVVCDHWKICVIIGSIGSWSPINISGQLFFSECTLK
FT                   ASVLGGWKPKEEIPKLVSDYMAQKFNLDPLVTHTLTLSEVHEAVQLMKSGQR"
FT   assembly_gap    8705856..8705875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8707124..8707143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8708911..8708930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8712698..8712717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8715990..8716009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8718382..8724368
FT                   /estimated_length=5987
FT                   /gap_type="unknown"
FT   assembly_gap    8725785..8725804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8729306..8730200
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   gene            <8739203..8753638
FT                   /gene="Gclm"
FT                   /locus_tag="mCG_9526"
FT                   /note="gene_id=mCG9526.2"
FT   mRNA            join(<8739203..8739270,8742866..8742950,8745527..8745586,
FT                   8746259..8746461,8748453..8748567,8749897..8753638)
FT                   /gene="Gclm"
FT                   /locus_tag="mCG_9526"
FT                   /product="glutamate-cysteine ligase , modifier subunit"
FT                   /note="gene_id=mCG9526.2 transcript_id=mCT9553.2 created on
FT                   07-JUN-2002"
FT   CDS             join(<8739205..8739270,8742866..8742950,8745527..8745586,
FT                   8746259..8746461,8748453..8748567,8749897..8750066)
FT                   /codon_start=1
FT                   /gene="Gclm"
FT                   /locus_tag="mCG_9526"
FT                   /product="glutamate-cysteine ligase , modifier subunit"
FT                   /note="gene_id=mCG9526.2 transcript_id=mCT9553.2
FT                   protein_id=mCP22893.0"
FT                   /protein_id="EDL12325.1"
FT                   /translation="LRDCIQKTLNEWSSQISPDLVREFPDVLECTMSHAVEKINPDERE
FT                   EMKVSAKLFIVGSNSSSSTRSAVDMACSVLGVAQLDSVIMASPPIEDGVNLSLEHLQPY
FT                   WEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAK
FT                   QFDIQLLTHNDPKELLSEASFQEALQESIPDIEAQDWVPLWLLRYSVIVKSRGIIKSKG
FT                   YILQAKRRGS"
FT   gene            8740347..8741082
FT                   /pseudo
FT                   /locus_tag="mCG_126676"
FT                   /note="gene_id=mCG126676.0"
FT   mRNA            8740347..8741082
FT                   /pseudo
FT                   /locus_tag="mCG_126676"
FT                   /note="gene_id=mCG126676.0 transcript_id=mCT127949.0
FT                   created on 30-MAY-2003"
FT   assembly_gap    8757705..8757862
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            8758208..8769069
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /note="gene_id=mCG9524.2"
FT   mRNA            join(8758208..8758280,8759000..8760612,8762548..8762686,
FT                   8764530..8764625,8766132..8766296,8768194..8768303,
FT                   8768857..8769069)
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, transcript variant mCT9551"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT9551.2 created on
FT                   24-OCT-2002"
FT   mRNA            join(8758208..8758280,8759000..8759996,8766178..8766296,
FT                   8768194..8768303,8768857..8769069)
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, transcript variant mCT174977"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT174977.0 created
FT                   on 24-OCT-2002"
FT   mRNA            join(8758208..8758280,8759000..8759224,8759388..8760612,
FT                   8762548..8762686,8764530..8764625,8766132..8766296,
FT                   8768194..8768303,8768857..8769069)
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, transcript variant mCT174976"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT174976.0 created
FT                   on 24-OCT-2002"
FT   CDS             join(8758221..8758280,8759000..8760612,8762548..8762686,
FT                   8764530..8764625,8766132..8766296,8768194..8768303,
FT                   8768857..8768950)
FT                   /codon_start=1
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT9551.2
FT                   protein_id=mCP22901.2 isoform=CRA_b"
FT                   /protein_id="EDL12323.1"
FT                   /translation="MVVTRSGLSRTRLQESSQQKRSAPRRIGTHLESTKESGSDGSTAE
FT                   SQPAEKQHSRSSSRTTGPAEIIVLISDDEASETESHTSGVTSVLEDQEPIVRVTRKRQI
FT                   VIASTSKSTVRKRQKVAPQHASADEVVVSEAESHVSGVSMVVPSTERSSRNKANSQRDS
FT                   SQESQSGTVSDAELSCSGISSLEILPRTTARNVKKKLQFPAEKNDTKITPGNKKQIVGM
FT                   SVCSEDSDATQLSARPLSQRNMPNVSDSETYNSDFDDSSPRNSGKKLTAQNHQNLHIQE
FT                   EKRANVVSLTEVRKENCKSLDEEDLKITEEKVINEKDSQRSLSEAQDTSLQQSVSQNHS
FT                   STPNKKPTFQLSSPDRKALMKSLEHKFAVVNVERWNDKRGGSGKKSDLAQLGGGGGGGD
FT                   DNEPTGAGISDDKSSQSGVPLECDTKPCKSELSMTQDTTDSPVLLFLSSDESQQSDSSE
FT                   NERDTLCSVENNGQKEASAEDLEDAACDSALFVIDKTPGLSADKNFYLEDKAPSEVAIE
FT                   EEKEEEEKEEENSEEDSSDSDENKDESSDEEDLLSNTKSKLLKLTSSSIDPGLNIKQLG
FT                   GLYINFNVDKLQPHKETLTQIKEKKKNELLQKAVITPDFEKKHCVPPYSESKHRLQKQR
FT                   RKERQKTAGNGWFGMKAPELTDELKNDLRALKMRAGMDPKRFYKKNDRDGFPKYFQVGT
FT                   IVDNPADFYHSRIPKKQRKKTIVEELLADSEFRRFNRRKYSEIMAEKAANAEGKKFKKK
FT                   KKFRN"
FT   CDS             join(8758221..8758280,8759000..8759996,8766178..8766296,
FT                   8768194..8768303,8768857..8768950)
FT                   /codon_start=1
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT174977.0
FT                   protein_id=mCP97896.0 isoform=CRA_a"
FT                   /protein_id="EDL12322.1"
FT                   /translation="MVVTRSGLSRTRLQESSQQKRSAPRRIGTHLESTKESGSDGSTAE
FT                   SQPAEKQHSRSSSRTTGPAEIIVLISDDEASETESHTSGVTSVLEDQEPIVRVTRKRQI
FT                   VIASTSKSTVRKRQKVAPQHASADEVVVSEAESHVSGVSMVVPSTERSSRNKANSQRDS
FT                   SQESQSGTVSDAELSCSGISSLEILPRTTARNVKKKLQFPAEKNDTKITPGNKKQIVGM
FT                   SVCSEDSDATQLSARPLSQRNMPNVSDSETYNSDFDDSSPRNSGKKLTAQNHQNLHIQE
FT                   EKRANVVSLTEVRKENCKSLDEEDLKITEEKVINEKDSQRSLSEAQDTSLQQSVSQNHS
FT                   STPNKKPTFQLSTPELTDELKNDLRALKMRAGMDPKRFYKKNDRDGFPKYFQVGTIVDN
FT                   PADFYHSRIPKKQRKKTIVEELLADSEFRRFNRRKYSEIMAEKAANAEGKKFKKKKKFR
FT                   N"
FT   CDS             join(8759603..8760612,8762548..8762686,8764530..8764625,
FT                   8766132..8766296,8768194..8768303,8768857..8768950)
FT                   /codon_start=1
FT                   /gene="Dnttip2"
FT                   /locus_tag="mCG_9524"
FT                   /product="deoxynucleotidyltransferase, terminal,
FT                   interacting protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG9524.2 transcript_id=mCT174976.0
FT                   protein_id=mCP97895.0 isoform=CRA_c"
FT                   /protein_id="EDL12324.1"
FT                   /translation="MSVCSEDSDATQLSARPLSQRNMPNVSDSETYNSDFDDSSPRNSG
FT                   KKLTAQNHQNLHIQEEKRANVVSLTEVRKENCKSLDEEDLKITEEKVINEKDSQRSLSE
FT                   AQDTSLQQSVSQNHSSTPNKKPTFQLSSPDRKALMKSLEHKFAVVNVERWNDKRGGSGK
FT                   KSDLAQLGGGGGGGDDNEPTGAGISDDKSSQSGVPLECDTKPCKSELSMTQDTTDSPVL
FT                   LFLSSDESQQSDSSENERDTLCSVENNGQKEASAEDLEDAACDSALFVIDKTPGLSADK
FT                   NFYLEDKAPSEVAIEEEKEEEEKEEENSEEDSSDSDENKDESSDEEDLLSNTKSKLLKL
FT                   TSSSIDPGLNIKQLGGLYINFNVDKLQPHKETLTQIKEKKKNELLQKAVITPDFEKKHC
FT                   VPPYSESKHRLQKQRRKERQKTAGNGWFGMKAPELTDELKNDLRALKMRAGMDPKRFYK
FT                   KNDRDGFPKYFQVGTIVDNPADFYHSRIPKKQRKKTIVEELLADSEFRRFNRRKYSEIM
FT                   AEKAANAEGKKFKKKKKFRN"
FT   assembly_gap    8781871..8781890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8787674..8788497
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    8789509..8789908
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    8791502..8791521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8793256..8793275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8794394..8796524
FT                   /estimated_length=2131
FT                   /gap_type="unknown"
FT   assembly_gap    8798792..8798956
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    8830926..8830945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8839645..8839664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8852986..8853092
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8864650..8864997
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    8879634..8879653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8884419..8884758
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    8890566..8890585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8900771..8900880
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            8906692..9017837
FT                   /gene="Bcar3"
FT                   /locus_tag="mCG_9523"
FT                   /note="gene_id=mCG9523.2"
FT   mRNA            join(8906692..8907118,8913362..8913671,8942938..8942977,
FT                   8992580..8992708,8995779..8996224,8998872..8998975,
FT                   9000004..9000656,9006920..9007035,9010826..9010997,
FT                   9012581..9012692,9012944..9013156,9017239..9017837)
FT                   /gene="Bcar3"
FT                   /locus_tag="mCG_9523"
FT                   /product="breast cancer anti-estrogen resistance 3"
FT                   /note="gene_id=mCG9523.2 transcript_id=mCT9550.2 created on
FT                   26-JUL-2002"
FT   CDS             join(8913373..8913671,8942938..8942977,8992580..8992708,
FT                   8995779..8996224,8998872..8998975,9000004..9000656,
FT                   9006920..9007035,9010826..9010997,9012581..9012692,
FT                   9012944..9013156,9017239..9017417)
FT                   /codon_start=1
FT                   /gene="Bcar3"
FT                   /locus_tag="mCG_9523"
FT                   /product="breast cancer anti-estrogen resistance 3"
FT                   /note="gene_id=mCG9523.2 transcript_id=mCT9550.2
FT                   protein_id=mCP22891.2"
FT                   /protein_id="EDL12321.1"
FT                   /translation="MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAERRTDAYQDV
FT                   SIHGTLPRKKKGPPSIRSCDNAGHSKSPRQSSPLTQDIIQENPLQDRKGENFIFRDPYL
FT                   LDPTLEYVKFSKERHIMDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQ
FT                   RDGDFLVRDSLSSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIP
FT                   GLVRCYVGNRRPISQQSGAIIFQPINRTVPLWCLEERYGTSPGRGREGSLAEGRPDVVK
FT                   RLSLTTGSSIQAREHSLPRGNLLRNKEKSGSQPACLDHVQDRKALTLKAHQSESHLPIG
FT                   CKLPPQSPSMDTSPCPSSPVFRTGSEPTLSPALVRRFSSDARTGEALRGSDSQLCPKPP
FT                   PKPCKVPFLKTPPSPSPWLTSEANYCELNPAFAVGCDRGAKLPMQAHDSHEMLLTAKQN
FT                   GPSGPRNSGINYMILDGDDQARHWDPLAVQTDEGQEDKTKFVPPLMETVSSFRPNDFES
FT                   KLLPPENKPLETAMLKHAKELFTNHDARVIAQHMLSVDCKVARILEVSEDRKRSMGVSS
FT                   GLELITLPHGRQLRLDIIERHNTMAIGIAVDILGCTGTLENRAGTLNKIIQVAVELKDA
FT                   MGDLYAFSAIMKALEMPQITRLEKTWTALRHHYTQTAILYEKQLKPFSKILHEGRESTY
FT                   VPASNVSVPLLMPLVTLMERQAVTFEGTDMWENNDESCEILLNHLATARFMAEASESYR
FT                   MNAERILADFQPDEEMTEILRTEFQMRLLWGSKGAEVNQNERYDKFNQILTALSRKLEP
FT                   PSGKQAEL"
FT   assembly_gap    8922681..8922700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8924540..8925333
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    8926498..8926517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8928292..8928397
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    8929793..8929812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8930890..8931379
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    8935397..8936182
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    8948016..8948035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8954551..8954744
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    8984402..8984421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9026384..9077733)
FT                   /gene="Fnbp1l"
FT                   /locus_tag="mCG_9518"
FT                   /note="gene_id=mCG9518.2"
FT   mRNA            complement(join(9026384..9029942,9032173..9032321,
FT                   9033929..9034023,9034572..9034704,9036785..9036894,
FT                   9044040..9044198,9045532..9045735,9046500..9046646,
FT                   9048313..9048441,9051315..9051419,9056232..9056294,
FT                   9057074..9057221,9077618..9077733))
FT                   /gene="Fnbp1l"
FT                   /locus_tag="mCG_9518"
FT                   /product="formin binding protein 1-like, transcript variant
FT                   mCT9542"
FT                   /note="gene_id=mCG9518.2 transcript_id=mCT9542.2 created on
FT                   24-OCT-2002"
FT   mRNA            complement(join(9026384..9029942,9032173..9032321,
FT                   9033929..9034023,9034572..9034704,9036785..9036894,
FT                   9045532..9045735,9046500..9046646,9048313..9048441,
FT                   9051315..9051419,9056232..9056294,9057074..9057221,
FT                   9077304..9077360,9077618..9077733))
FT                   /gene="Fnbp1l"
FT                   /locus_tag="mCG_9518"
FT                   /product="formin binding protein 1-like, transcript variant
FT                   mCT174975"
FT                   /note="gene_id=mCG9518.2 transcript_id=mCT174975.0 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(9029764..9029942,9032173..9032321,
FT                   9033929..9034023,9034572..9034704,9036785..9036894,
FT                   9045532..9045735,9046500..9046646,9048313..9048441,
FT                   9051315..9051419,9056232..9056294,9057074..9057139))
FT                   /codon_start=1
FT                   /gene="Fnbp1l"
FT                   /locus_tag="mCG_9518"
FT                   /product="formin binding protein 1-like, isoform CRA_a"
FT                   /note="gene_id=mCG9518.2 transcript_id=mCT174975.0
FT                   protein_id=mCP97894.0 isoform=CRA_a"
FT                   /protein_id="EDL12319.1"
FT                   /translation="MAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSK
FT                   KKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQLQNF
FT                   NGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAA
FT                   KSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISAAKQESGKMDSKST
FT                   VGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELNRGLQKEADQKEALNKM
FT                   KDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGIRGDRRHSSD
FT                   INHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAIGHCKAIYPF
FT                   DGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTTYIDVTLEKSSKGAVTY
FT                   I"
FT   CDS             complement(join(9029764..9029942,9032173..9032321,
FT                   9033929..9034023,9034572..9034704,9036785..9036894,
FT                   9044040..9044198,9045532..9045735,9046500..9046646,
FT                   9048313..9048441,9051315..9051419,9056232..9056294,
FT                   9057074..9057139))
FT                   /codon_start=1
FT                   /gene="Fnbp1l"
FT                   /locus_tag="mCG_9518"
FT                   /product="formin binding protein 1-like, isoform CRA_b"
FT                   /note="gene_id=mCG9518.2 transcript_id=mCT9542.2
FT                   protein_id=mCP22888.2 isoform=CRA_b"
FT                   /protein_id="EDL12320.1"
FT                   /translation="MAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSK
FT                   KKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQLQNF
FT                   NGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAA
FT                   KSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISAAKQESGKMDSKST
FT                   VGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTLSIEPVHYCMNEIKTGKPR
FT                   IPSFRSLKRGGPALEDFSHLPPEQRRKKLQQRIDELNRGLQKEADQKEALNKMKDVYEK
FT                   NPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGIRGDRRHSSDINHLVT
FT                   QGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAIGHCKAIYPFDGHNEG
FT                   TLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTTYIDVTLEKSSKGAVTYI"
FT   assembly_gap    9046181..9046200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9099029..9099048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9108103..9109997
FT                   /estimated_length=1895
FT                   /gap_type="unknown"
FT   assembly_gap    9116077..9117189
FT                   /estimated_length=1113
FT                   /gap_type="unknown"
FT   assembly_gap    9120319..9120338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9121568..9123705
FT                   /estimated_length=2138
FT                   /gap_type="unknown"
FT   assembly_gap    9124747..9124766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9127269..9127937
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    9129758..9129777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9134079..9134244
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    9137022..9137876
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    9142174..9143473
FT                   /estimated_length=1300
FT                   /gap_type="unknown"
FT   assembly_gap    9167602..9167621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9173254..9173273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9178607..9179396
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   assembly_gap    9186225..9186244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9193779..9194163
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    9201188..9201690
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    9203039..9203251
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    9207278..9207297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9208232..9208251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9209324..9209343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9222813..9352785
FT                   /gene="Pde5a"
FT                   /locus_tag="mCG_9522"
FT                   /note="gene_id=mCG9522.2"
FT   mRNA            join(9222813..9222993,9241391..9241979,9254373..9254462,
FT                   9268348..9268419,9270997..9271086,9273676..9273813,
FT                   9276320..9276387,9288958..9289066,9289932..9290019,
FT                   9297740..9297915,9299257..9299316,9315195..9315341,
FT                   9320209..9320334,9322067..9322161,9332145..9332232,
FT                   9336174..9336274,9337597..9337674,9339668..9339731,
FT                   9348282..9348356,9349170..9349253,9351827..9352785)
FT                   /gene="Pde5a"
FT                   /locus_tag="mCG_9522"
FT                   /product="phosphodiesterase 5A, cGMP-specific"
FT                   /note="gene_id=mCG9522.2 transcript_id=mCT9549.2 created on
FT                   24-OCT-2002"
FT   CDS             join(9222872..9222993,9241391..9241979,9254373..9254462,
FT                   9268348..9268419,9270997..9271086,9273676..9273813,
FT                   9276320..9276387,9288958..9289066,9289932..9290019,
FT                   9297740..9297915,9299257..9299316,9315195..9315341,
FT                   9320209..9320334,9322067..9322161,9332145..9332232,
FT                   9336174..9336274,9337597..9337674,9339668..9339731,
FT                   9348282..9348356,9349170..9349253,9351827..9351964)
FT                   /codon_start=1
FT                   /gene="Pde5a"
FT                   /locus_tag="mCG_9522"
FT                   /product="phosphodiesterase 5A, cGMP-specific"
FT                   /note="gene_id=mCG9522.2 transcript_id=mCT9549.2
FT                   protein_id=mCP22900.2"
FT                   /db_xref="GOA:Q8CG03"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:2651499"
FT                   /db_xref="PDB:2K31"
FT                   /protein_id="EDL12317.1"
FT                   /translation="MERAGPNSVRSQQQRDPDWVEAWLDDHRDFTFSYFIRKATRDMVN
FT                   AWFSERVHNIPVCKEGIRAHTESCSCSLQQSPHADNTTPGAPARKISASEFDRPLRPIV
FT                   VKDSEGTVSFLSDSGKKEQMPLTPPRFDSDEGDQCSRLLELVKDISSHLDVTALCHKIF
FT                   LHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGH
FT                   VAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGN
FT                   GGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVI
FT                   LKKIAATIISFMQVQKCTIFIVDEDCPDSFSRVFHMECEEVGKPSDPLTREQDANKINY
FT                   MYAQYVKNTMEPLNIPDVTKDKRFPWTNENMGHVNTPCIGSLLCTPIKNGKKNKVIGVC
FT                   QLVNKMEENTGKIKAFNQNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLS
FT                   YHASAAEEETRELQALSAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQ
FT                   NFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLETLA
FT                   LLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGL
FT                   SIDEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFSFEDPLQKELFLAMLMTAC
FT                   DLSAITKPWPIQQRIAELVAAEFFDQGDRERKELNMEPADLMNREKKNKIPSMQVGFID
FT                   AICLQLYEALTHVSEDCLPLLDGCRKNRQKWQALAEQQEKMLLNGESSQGKRD"
FT   assembly_gap    9233162..9233541
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    9248839..9248858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9264630..9264649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9270437..9270456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9289789..>9296689)
FT                   /locus_tag="mCG_145944"
FT                   /note="gene_id=mCG145944.0"
FT   mRNA            complement(join(9289789..9289986,9293042..9293750,
FT                   9294451..9294554,9296545..>9296689))
FT                   /locus_tag="mCG_145944"
FT                   /product="mCG145944"
FT                   /note="gene_id=mCG145944.0 transcript_id=mCT186052.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(9294454..9294554,9296545..>9296689))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145944"
FT                   /product="mCG145944"
FT                   /note="gene_id=mCG145944.0 transcript_id=mCT186052.0
FT                   protein_id=mCP107717.0"
FT                   /protein_id="EDL12318.1"
FT                   /translation="HLPGACIAVWCAPACLPGDAYISFKQRPPQPRSSDPGQALLLVFT
FT                   VTLDNQKNQLLKKPLTRGTECYVCEPMVSHRGHCHP"
FT   assembly_gap    9300179..9302017
FT                   /estimated_length=1839
FT                   /gap_type="unknown"
FT   assembly_gap    9313792..9313943
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    9319591..9319697
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    9329731..9330419
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    9331679..9331698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9332649..9332725
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    9352789..9352953
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            <9358532..9359326
FT                   /locus_tag="mCG_1045560"
FT                   /note="gene_id=mCG1045560.1"
FT   mRNA            <9358532..9359326
FT                   /locus_tag="mCG_1045560"
FT                   /product="mCG1045560"
FT                   /note="gene_id=mCG1045560.1 transcript_id=mCT163264.1
FT                   created on 29-OCT-2002"
FT   CDS             <9358716..9359024
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045560"
FT                   /product="mCG1045560"
FT                   /note="gene_id=mCG1045560.1 transcript_id=mCT163264.1
FT                   protein_id=mCP89318.1"
FT                   /protein_id="EDL12316.1"
FT                   /translation="SGPTLCGGDRAAAAGAAAAGWLQSIAEKDNNLVPIGKPASEHYND
FT                   EEEEDDEDDEDSEDDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWII"
FT   gene            complement(<9361381..9421535)
FT                   /locus_tag="mCG_147408"
FT                   /note="gene_id=mCG147408.0"
FT   mRNA            complement(join(<9361381..9361598,9361617..9362052,
FT                   9368037..9368098,9386371..9386538,9387252..9387397,
FT                   9414090..9414266,9417149..9417275,9421479..9421535))
FT                   /locus_tag="mCG_147408"
FT                   /product="mCG147408"
FT                   /note="gene_id=mCG147408.0 transcript_id=mCT187671.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<9361381..9361598,9361617..9362052,
FT                   9368037..9368083))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147408"
FT                   /product="mCG147408"
FT                   /note="gene_id=mCG147408.0 transcript_id=mCT187671.0
FT                   protein_id=mCP109633.0"
FT                   /protein_id="EDL12314.1"
FT                   /translation="MEGLPVSLWNTFFPARSSLQGMWTKAVTPQADVLMGYVTGEARGQ
FT                   GHPFRDEESSIFQYCHKVPPCELEILSDLCLLTLASCSGNCVFTFATMNNELVCFLWKL
FT                   EGLACRSLSLNTFFFLSHARDITGLRFLLCAFKLSTTIIFKLLLCELNNLHTHTHTHTH
FT                   AAYHIKTHVALGVVIHNCESKHLGGRRTERKEERSTNFHPNSAQMKTILSLVYRVSSRT
FT                   ARATEKPCLEKP"
FT   assembly_gap    9380101..9381292
FT                   /estimated_length=1192
FT                   /gap_type="unknown"
FT   assembly_gap    9382954..9383000
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    9390808..9391023
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            9392313..9396746
FT                   /gene="Fabp2"
FT                   /locus_tag="mCG_21052"
FT                   /note="gene_id=mCG21052.2"
FT   mRNA            join(9392313..9392720,9393978..9394150,9395942..9396049,
FT                   9396472..9396746)
FT                   /gene="Fabp2"
FT                   /locus_tag="mCG_21052"
FT                   /product="fatty acid binding protein 2, intestinal"
FT                   /note="gene_id=mCG21052.2 transcript_id=mCT19718.2 created
FT                   on 26-JUL-2002"
FT   CDS             join(9392654..9392720,9393978..9394150,9395942..9396049,
FT                   9396472..9396522)
FT                   /codon_start=1
FT                   /gene="Fabp2"
FT                   /locus_tag="mCG_21052"
FT                   /product="fatty acid binding protein 2, intestinal"
FT                   /note="gene_id=mCG21052.2 transcript_id=mCT19718.2
FT                   protein_id=mCP19187.1"
FT                   /db_xref="GOA:Q53YP5"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:95478"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YP5"
FT                   /protein_id="EDL12315.1"
FT                   /translation="MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDG
FT                   NKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELI
FT                   AVREVSGNELIQTYTYEGVEAKRFFKKE"
FT   assembly_gap    9402425..9402444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9404100..9404119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9408184..9408203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9421227..9421246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9421810..9423689
FT                   /gene="1810037I17Rik"
FT                   /locus_tag="mCG_1045669"
FT                   /note="gene_id=mCG1045669.1"
FT   mRNA            join(9421810..9422072,9422896..9423154,9423246..9423689)
FT                   /gene="1810037I17Rik"
FT                   /locus_tag="mCG_1045669"
FT                   /product="RIKEN cDNA 1810037I17"
FT                   /note="gene_id=mCG1045669.1 transcript_id=mCT163373.1
FT                   created on 26-NOV-2002"
FT   CDS             join(9421876..9422072,9422896)
FT                   /codon_start=1
FT                   /gene="1810037I17Rik"
FT                   /locus_tag="mCG_1045669"
FT                   /product="RIKEN cDNA 1810037I17"
FT                   /note="gene_id=mCG1045669.1 transcript_id=mCT163373.1
FT                   protein_id=mCP89389.1"
FT                   /protein_id="EDL12313.1"
FT                   /translation="MEVSQAASGTDGVRERRGSFEAGRRNQDEAPQSGMNGLPKHSYWL
FT                   DLWLFILFDLALFVFVYLLP"
FT   gene            complement(9428778..>9482422)
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /note="gene_id=mCG21049.3"
FT   mRNA            complement(join(9428778..9431876,9433270..9433366,
FT                   9444638..9444714,9446401..9447133,9448448..9448591,
FT                   9449826..9449975,9450449..9450611,9454996..9455145,
FT                   9455883..9456029,9459046..9459128,9459210..9459323,
FT                   9460762..9460896,9462134..9462226,9466462..9467122,
FT                   9482194..>9482422))
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, transcript
FT                   variant mCT163372"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT163372.2 created
FT                   on 19-MAY-2003"
FT   mRNA            complement(join(9428778..9431876,9433270..9433366,
FT                   9444638..9444714,9446401..9447133,9448448..9448591,
FT                   9449826..9449975,9450449..9451823))
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, transcript
FT                   variant mCT19716"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT19716.2 created
FT                   on 19-MAY-2003"
FT   CDS             complement(join(9431003..9431876,9433270..9433366,
FT                   9444638..9444714,9446401..9447133,9448448..9448591,
FT                   9449826..9449975,9450449..9450611,9454996..9455145,
FT                   9455883..9456029,9459046..9459128,9459210..>9459213))
FT                   /codon_start=1
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, isoform CRA_b"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT163372.2
FT                   protein_id=mCP89387.2 isoform=CRA_b"
FT                   /protein_id="EDL12310.1"
FT                   /translation="AVCVPELWRFLRPSALYRTREVHFYNSPVSNCGQKIKIRRVLMNC
FT                   PEIVTIGLVWDSEHSDLTEDVVRSLATHLYLPGLFYRVTDENATDSELHLVGMICYTSR
FT                   HYCAFAFHTKSSKWVFFDDAHVKEMGTRWKDVVSKCIRCHLQPLLLFYANPDGTAVSTE
FT                   DALRQVVHWSHYRSGEENMGCGKPIIYKPDNSKENGFGGQTKQKENHKFQTDISSLNRS
FT                   QMQTSGRRAPVKLSHDQREKIKDISRECALKAIEQKNALSSQRKDLEKGQRKDTGRHRD
FT                   LVDEVLASFKSGSPPASDGFRQQGNPHLYHSQGKGPCKHDRATHESYTSGKVISSSKSQ
FT                   NLLVPGEKTTGKAKSDSGTGYETDSSQDSRDKGGSYSSKTKSRHRGWKPMRETLNVDSV
FT                   FSESEKRQHSPRRKSDIGSRPRCSKDQSFNNWPKANPKQKGLMTIYEDEMKQEAGSRSS
FT                   LETNGKGAEKNLSAAESRGPGTSWQMQRTESGYESSDHVSNGSASLDSPGVEGSGAVMD
FT                   VGGGKAFSEHIKMNSHNMDSMEYISHHCKDHPEGFRKELQDLEADDKIHELHPESHVQI
FT                   KSHLIKRSQIGETNDKLFPSASPQTLAREHVYQTNEHKVERPDRSKCSERHNTENSEGT
FT                   GLPFHVDESSVAGKRVDSNETVSPSSLPSSVRTAGLKPETGPLMFWSQQNITEQGYSDN
FT                   SLSRELTLLSACNADSCQMPKLHCHRSPPPLPPKKYSTASAPRLERVGLSPDVGVTEAF
FT                   NTNPSSLPKHSLSPASGPSLEGSPCMTQERDKETIQVKQLAANSYPSSCSTNSFQPDQD
FT                   STSVCPNETISLTTYFSVDSCMTDTYRLKYHQRPKLYFPESSGHHSNNSLSQTEQVEGS
FT                   IT"
FT   CDS             complement(join(9431003..9431876,9433270..9433366,
FT                   9444638..9444714,9446401..9447133,9448448..9448591,
FT                   9449826..9449975,9450449..9450629))
FT                   /codon_start=1
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, isoform CRA_c"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT19716.2
FT                   protein_id=mCP19288.2 isoform=CRA_c"
FT                   /protein_id="EDL12311.1"
FT                   /translation="MIFLLKMGTRWKDVVSKCIRCHLQPLLLFYANPDGTAVSTEDALR
FT                   QVVHWSHYRSGEENMGCGKPIIYKPDNSKENGFGGQTKQKENHKFQTDISSLNRSQMQT
FT                   SGRRAPVKLSHDQREKIKDISRECALKAIEQKNALSSQRKDLEKGQRKDTGRHRDLVDE
FT                   VLASFKSGSPPASDGFRQQGNPHLYHSQGKGPCKHDRATHESYTSGKVISSSKSQNLLV
FT                   PGEKTTGKAKSDSGTGYETDSSQDSRDKGGSYSSKTKSRHRGWKPMRETLNVDSVFSES
FT                   EKRQHSPRRKSDIGSRPRCSKDQSFNNWPKANPKQKGLMTIYEDEMKQEAGSRSSLETN
FT                   GKGAEKNLSAAESRGPGTSWQMQRTESGYESSDHVSNGSASLDSPGVEGSGAVMDVGGG
FT                   KAFSEHIKMNSHNMDSMEYISHHCKDHPEGFRKELQDLEADDKIHELHPESHVQIKSHL
FT                   IKRSQIGETNDKLFPSASPQTLAREHVYQTNEHKVERPDRSKCSERHNTENSEGTGLPF
FT                   HVDESSVAGKRVDSNETVSPSSLPSSVRTAGLKPETGPLMFWSQQNITEQGYSDNSLSR
FT                   ELTLLSACNADSCQMPKLHCHRSPPPLPPKKYSTASAPRLERVGLSPDVGVTEAFNTNP
FT                   SSLPKHSLSPASGPSLEGSPCMTQERDKETIQVKQLAANSYPSSCSTNSFQPDQDSTSV
FT                   CPNETISLTTYFSVDSCMTDTYRLKYHQRPKLYFPESSGHHSNNSLSQTEQVEGSIT"
FT   assembly_gap    9448925..9449015
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    9452760..9453651
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   mRNA            complement(join(9454507..9456029,9459046..9459128,
FT                   9459210..9459323,9460762..9460896,9462134..9462226,
FT                   9466462..9467122,9482194..9482422))
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, transcript
FT                   variant mCT163371"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT163371.2 created
FT                   on 19-MAY-2003"
FT   mRNA            complement(join(9454507..9456029,9459046..9459128,
FT                   9459210..9459323,9460762..9460896,9462134..9462226,
FT                   9466462..9467122,9480598..9480622,9482194..9482422))
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, transcript
FT                   variant mCT171597"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT171597.1 created
FT                   on 19-MAY-2003"
FT   CDS             complement(join(9456029,9459046..9459128,9459210..9459323,
FT                   9460762..9460896,9462134..9462226,9466462..9466605))
FT                   /codon_start=1
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, isoform CRA_a"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT171597.1
FT                   protein_id=mCP94516.1 isoform=CRA_a"
FT                   /protein_id="EDL12309.1"
FT                   /translation="MAWVKFLRKPSGNLGKAYQAGSLLSLAPTVGLLNEPGQNSCFLNS
FT                   AVQVLWQLDIFRRSLRALTGHICQGDACIFCALKTIFAQFQHSREKALPSDNIRHALAE
FT                   SFKDEQRFQLGLMDDAAECFENILARIHFHLVPNRDADMCTSKSCVTHQKFAMTLYEQC
FT                   VCRSCGASSDPLPFTELVRYISTTAL"
FT   CDS             complement(join(9456029,9459046..9459128,9459210..9459323,
FT                   9460762..9460896,9462134..9462226,9466462..9466605))
FT                   /codon_start=1
FT                   /gene="Usp53"
FT                   /locus_tag="mCG_21049"
FT                   /product="ubiquitin specific peptidase 53, isoform CRA_a"
FT                   /note="gene_id=mCG21049.3 transcript_id=mCT163371.2
FT                   protein_id=mCP89376.2 isoform=CRA_a"
FT                   /protein_id="EDL12312.1"
FT                   /translation="MAWVKFLRKPSGNLGKAYQAGSLLSLAPTVGLLNEPGQNSCFLNS
FT                   AVQVLWQLDIFRRSLRALTGHICQGDACIFCALKTIFAQFQHSREKALPSDNIRHALAE
FT                   SFKDEQRFQLGLMDDAAECFENILARIHFHLVPNRDADMCTSKSCVTHQKFAMTLYEQC
FT                   VCRSCGASSDPLPFTELVRYISTTAL"
FT   assembly_gap    9456408..9456427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9457372..9457391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9491735..9491876
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    9504036..9504269
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            complement(9504833..9533117)
FT                   /gene="Myoz2"
FT                   /locus_tag="mCG_21050"
FT                   /note="gene_id=mCG21050.1"
FT   mRNA            complement(join(9504833..9505242,9511785..9511968,
FT                   9514733..9514862,9532360..9532448,9532988..9533117))
FT                   /gene="Myoz2"
FT                   /locus_tag="mCG_21050"
FT                   /product="myozenin 2, transcript variant mCT171292"
FT                   /note="gene_id=mCG21050.1 transcript_id=mCT171292.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(9504833..9505242,9511785..9511968,
FT                   9514733..9514862,9524254..9524423,9532360..9532448,
FT                   9532988..9533117))
FT                   /gene="Myoz2"
FT                   /locus_tag="mCG_21050"
FT                   /product="myozenin 2, transcript variant mCT19713"
FT                   /note="gene_id=mCG21050.1 transcript_id=mCT19713.1 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(9505008..9505242,9511785..9511968,
FT                   9514733..9514862,9524254..9524423,9532360..9532435))
FT                   /codon_start=1
FT                   /gene="Myoz2"
FT                   /locus_tag="mCG_21050"
FT                   /product="myozenin 2, isoform CRA_b"
FT                   /note="gene_id=mCG21050.1 transcript_id=mCT19713.1
FT                   protein_id=mCP19181.2 isoform=CRA_b"
FT                   /protein_id="EDL12308.1"
FT                   /translation="MLSHSAMVKQRKQQASAITKEIHGHDVDGMDLGKKVSIPRDIMIE
FT                   ELSHFSNRGARLFKMRQRRSDKYTFENFQYESRAQINHNIAMQNGRVDGSNLEGGSQQG
FT                   PSTPPNTPDPRSPPNPENIAPGYSGPLKEIPPERFNTTAVPKYYRSPWEQAIGSDPELL
FT                   EALYPKLFKPEGKAELRDYRSFNRVATPFGGFEKASKMVKFKVPDFELLLLTDPRFLAF
FT                   ANPLSGRRCFNRAPKGWVSENIPVVITTEPTEDATVPESDDL"
FT   CDS             complement(join(9505008..9505242,9511785..9511968,
FT                   9514733..9514862,9532360..9532368))
FT                   /codon_start=1
FT                   /gene="Myoz2"
FT                   /locus_tag="mCG_21050"
FT                   /product="myozenin 2, isoform CRA_a"
FT                   /note="gene_id=mCG21050.1 transcript_id=mCT171292.0
FT                   protein_id=mCP94211.0 isoform=CRA_a"
FT                   /protein_id="EDL12307.1"
FT                   /translation="MDMHNIAMQNGRVDGSNLEGGSQQGPSTPPNTPDPRSPPNPENIA
FT                   PGYSGPLKEIPPERFNTTAVPKYYRSPWEQAIGSDPELLEALYPKLFKPEGKAELRDYR
FT                   SFNRVATPFGGFEKASKMVKFKVPDFELLLLTDPRFLAFANPLSGRRCFNRAPKGWVSE
FT                   NIPVVITTEPTEDATVPESDDL"
FT   assembly_gap    9505368..9505387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9506413..9508772
FT                   /estimated_length=2360
FT                   /gap_type="unknown"
FT   assembly_gap    9529716..9530038
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   gene            complement(9541505..9541930)
FT                   /pseudo
FT                   /locus_tag="mCG_51098"
FT                   /note="gene_id=mCG51098.1"
FT   mRNA            complement(9541505..9541930)
FT                   /pseudo
FT                   /locus_tag="mCG_51098"
FT                   /note="gene_id=mCG51098.1 transcript_id=mCT51281.1 created
FT                   on 26-NOV-2002"
FT   assembly_gap    9553959..9553978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9570698..9570717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9583574..9583805
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    9592143..9592417
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    9594361..9594711
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    9598788..9598807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9603983..9604118
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(<9610487..>9612760)
FT                   /locus_tag="mCG_21054"
FT                   /note="gene_id=mCG21054.2"
FT   mRNA            complement(<9610487..>9612760)
FT                   /locus_tag="mCG_21054"
FT                   /product="mCG21054"
FT                   /note="gene_id=mCG21054.2 transcript_id=mCT19720.2 created
FT                   on 25-JUL-2002"
FT   CDS             complement(9610487..9612760)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21054"
FT                   /product="mCG21054"
FT                   /note="gene_id=mCG21054.2 transcript_id=mCT19720.2
FT                   protein_id=mCP19232.2"
FT                   /protein_id="EDL12306.1"
FT                   /translation="MIPCSHQFSTICVLSPGLRRSESLSEKQVKEAKSKCKSIALLLTD
FT                   APNPNSKGVLMFKKRRRRARKYTLVSYGTGELEREEEEEEDQEAGDKDEISEVAFLGTS
FT                   ESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKRLNRGDKMEMLPDTTGKGALMFAKRRE
FT                   RMEQFTAQNEEEKTGGMAGGGPDALQTDGLRTMTSYQRKEESVRMQSSVSESSFQMGRS
FT                   LASVPQQNGFSGVSETAGAQRMFPMNRTAKPFLGSMNQPAAPFSPTRSVTSPISDFPAP
FT                   PPYSAVSPPPEAFSRGVSSPVAGPAQPPPWPQPAPWSQPAFYDSSEQIASRDERIAVPA
FT                   KRTGILQEAKRRGTTKPMFTFKETKVSPNPELLSLLQNAEGKRGTGGDSGPEEDYLSLG
FT                   AEACNFMQSSAKQKTPPPVAPKPAVKSPSSSQPVAPVSPVWSPGVAPAQRPAFSTSNPP
FT                   NPPQVTAVSSIKIAQPAAPPARPASALNLAGPFKGPQAVVVSHNYTPKPSAPTPLVNAA
FT                   PAGAGGPSNELPGMSGKGAQLFAKRQSRMEKYVVDSDTVQAHTVRAQSPTPSLPASWKY
FT                   SSNVRAPPPVAYNPIHSPSYPLAAIKSQPPGAQASKTSKKKGKKPLNTLDVMKHQPYQL
FT                   NASLFTFQPPDSKDGLPQKSTVKVSSAPAMKQALPPRQANVGSPTNAQASSVYSVPAYT
FT                   SQPNFFAAEATSPVSASPVPVSVPTSPKQESTSTSYFVAPRPKFSAKKSGVTVQVWKPS
FT                   VVEE"
FT   assembly_gap    9623588..9623636
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    9631230..9631249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9632372..9632391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9633725..9633744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9643016..9643640
FT                   /pseudo
FT                   /locus_tag="mCG_50301"
FT                   /note="gene_id=mCG50301.2"
FT   mRNA            9643016..9643640
FT                   /pseudo
FT                   /locus_tag="mCG_50301"
FT                   /note="gene_id=mCG50301.2 transcript_id=mCT50484.2 created
FT                   on 11-MAR-2003"
FT   assembly_gap    9666874..9666893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9678226..9678546
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    9706525..9707356
FT                   /estimated_length=832
FT                   /gap_type="unknown"
FT   assembly_gap    9708609..9709252
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   assembly_gap    9718396..9718846
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    9720583..9720602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9722108..9729875
FT                   /estimated_length=7768
FT                   /gap_type="unknown"
FT   assembly_gap    9759571..9759590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9764824..9874611
FT                   /gene="Sec24d"
FT                   /locus_tag="mCG_125647"
FT                   /note="gene_id=mCG125647.1"
FT   mRNA            join(9764824..9764872,9766923..9767082,9776336..9776459,
FT                   9787630..9787778,9790881..9791156,9791452..9791585,
FT                   9807075..9807186,9813040..9813167,9835079..9835217,
FT                   9838324..9838439,9841857..9841972,9852071..9852262,
FT                   9852854..9852947,9858931..9859047,9859722..9859892,
FT                   9862421..9862517,9862607..9862752,9863978..9864116,
FT                   9864754..9864872,9867855..9868034,9869838..9870029,
FT                   9871652..9871741,9873797..9874611)
FT                   /gene="Sec24d"
FT                   /locus_tag="mCG_125647"
FT                   /product="SEC24 related gene family, member D (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG125647.1 transcript_id=mCT126910.1
FT                   created on 24-OCT-2002"
FT   CDS             join(9766965..9767082,9776336..9776459,9787630..9787778,
FT                   9790881..9791156,9791452..9791585,9807075..9807186,
FT                   9813040..9813167,9835079..9835217,9838324..9838439,
FT                   9841857..9841972,9852071..9852262,9852854..9852947,
FT                   9858931..9859047,9859722..9859892,9862421..9862517,
FT                   9862607..9862752,9863978..9864116,9864754..9864872,
FT                   9867855..9868034,9869838..9870029,9871652..9871741,
FT                   9873797..9873937)
FT                   /codon_start=1
FT                   /gene="Sec24d"
FT                   /locus_tag="mCG_125647"
FT                   /product="SEC24 related gene family, member D (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG125647.1 transcript_id=mCT126910.1
FT                   protein_id=mCP89150.1"
FT                   /protein_id="EDL12305.1"
FT                   /translation="MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHASSPPGVMKPL
FT                   GPSAAPSGMLPPGPLPPGPPQFGPNGAHTPGHPPQRFPGPPPVNSVAPSYASGQPLPQS
FT                   SYPGPGSTSSVTQLGSQFSSMQINSYGVGATPQSQGPPGPQSAGAFQGPPQPAQPSILQ
FT                   PGHQVPPPPPTALNGPGASPMSPPTHRQDGLPGSAPLNAQYQPPPPPGQTLGPGYPPQQ
FT                   ATNYGPQMGGAQMSYPGGFPGGPAQMAGPAPQLQRKLDPDSIPSPIQVIENDRATRGGQ
FT                   VYTTNTRGQVPPLVTTECVIQDQGHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPF
FT                   ADIPPNETPLYLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNEVPPFYF
FT                   QHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRSHHSISNIWTTLEGGWTTMRSQSCRW
FT                   GPMNMSLRWITAEEEHEETSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVP
FT                   LLDGFLVNYEESQSVIHNLLDQIPEMFADSNENETVFAPVIQAGMEALKAAECPGKLFI
FT                   FHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTAVYESLAKDCVANSCSVTLFLFP
FT                   SQFVDVASLGLVPLLTGGTLYKYNVFQIHSDSQRFLTDLRNDIEKKIGFDAIMRVRTST
FT                   GFRATDFFGGIFMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDVGALIQCAVLYTTISG
FT                   QRRLRIHNLALNCSTQLADLYKSCETDALINFFAKSAFKAVLNQPLKAIREILVNQTAH
FT                   MLACYRKHCASPSAASQLILPDSMKVLPVYMNSLLKNCVLLSRSEISPDERAYQRQLVM
FT                   TMGVADSQLFFYPLLLPIHTLDVKSAALPPAVRCSESRLSEEGIFLLANGLNMFLWFGV
FT                   GSPPELIQGIFNVPSFAHINTDMTSLPEVGSPHSQQLRMIMNNIQQKKPYSMKLIVVKQ
FT                   REQREMAFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN"
FT   assembly_gap    9773234..9773489
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    9775009..9775418
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    9788598..9788734
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    9792946..9798243
FT                   /estimated_length=5298
FT                   /gap_type="unknown"
FT   assembly_gap    9802194..9802213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9810297..9810378
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    9811381..9811400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9828482..9828501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9830837..9830859
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9837694..9837713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9839102..9839121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9841029..9841048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9846006..9846025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9849309..9849328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9850582..9850601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9877229..9894866)
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /note="gene_id=mCG21047.2"
FT   mRNA            complement(join(9877229..9878623,9880219..9880429,
FT                   9881501..9881617,9883689..9883830,9885089..9885179,
FT                   9889149..9889236,9889579..9889659,9891684..9891771,
FT                   9892525..9892613,9894696..9894866))
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, transcript variant
FT                   mCT174957"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174957.0 created
FT                   on 23-OCT-2002"
FT   mRNA            complement(join(9877229..9878623,9880219..9880429,
FT                   9881501..9881617,9882914..9883006,9883689..9883830,
FT                   9885089..9885179,9889149..9889236,9889579..9889659,
FT                   9891684..9891771,9892525..9892613,9894696..9894866))
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, transcript variant
FT                   mCT19714"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT19714.2 created
FT                   on 23-OCT-2002"
FT   mRNA            complement(join(9877229..9878623,9880219..9880429,
FT                   9883689..9883830,9885089..9885179,9889149..9889236,
FT                   9889579..9889659,9891684..9891771,9892525..9892613,
FT                   9894446..9894628))
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, transcript variant
FT                   mCT174959"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174959.0 created
FT                   on 23-OCT-2002"
FT   mRNA            complement(join(9877229..9878623,9880219..9880429,
FT                   9881501..9881617,9882914..9883006,9883689..9883830,
FT                   9885089..9885179,9889149..9889236,9889579..9889659,
FT                   9891684..9891771,9892525..9892613,9894446..9894628))
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, transcript variant
FT                   mCT174958"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174958.0 created
FT                   on 23-OCT-2002"
FT   CDS             complement(join(9878319..9878623,9880219..9880429,
FT                   9881501..9881617,9883689..9883830,9885089..9885179,
FT                   9889149..9889236,9889579..9889659,9891684..9891771,
FT                   9892525..9892613,9894696..9894761))
FT                   /codon_start=1
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, isoform CRA_a"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174957.0
FT                   protein_id=mCP97878.0 isoform=CRA_a"
FT                   /protein_id="EDL12301.1"
FT                   /translation="MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIA
FT                   ETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSS
FT                   TFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKS
FT                   NTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDCLRKWGY
FT                   RRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDID
FT                   LIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNA
FT                   ETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERN
FT                   RSNFRGERGGFRGGRGGTHRGGFTPR"
FT   CDS             complement(join(9878319..9878623,9880219..9880429,
FT                   9881501..9881617,9882914..9883006,9883689..9883830,
FT                   9885089..9885179,9889149..9889236,9889579..9889659,
FT                   9891684..9891771,9892525..9892613,9894696..9894761))
FT                   /codon_start=1
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, isoform CRA_c"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT19714.2
FT                   protein_id=mCP19278.2 isoform=CRA_c"
FT                   /protein_id="EDL12303.1"
FT                   /translation="MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIA
FT                   ETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSS
FT                   TFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKS
FT                   NTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEID
FT                   EIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVF
FT                   QRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLG
FT                   RRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKS
FT                   PPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR"
FT   CDS             complement(join(9878319..9878623,9880219..9880429,
FT                   9883689..9883830,9885089..9885179,9889149..9889236,
FT                   9889579..9889647))
FT                   /codon_start=1
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, isoform CRA_b"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174959.0
FT                   protein_id=mCP97877.0 isoform=CRA_b"
FT                   /protein_id="EDL12302.1"
FT                   /translation="MQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRP
FT                   QNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVI
FT                   LLEPPLEEYYRETGITANEKCWTWDDEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEE
FT                   PEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASY
FT                   FSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRG
FT                   ERGGFRGGRGGTHRGGFTPR"
FT   CDS             complement(join(9878319..9878623,9880219..9880429,
FT                   9881501..9881617,9882914..9883006,9883689..9883830,
FT                   9885089..9885179,9889149..9889236,9889579..9889647))
FT                   /codon_start=1
FT                   /gene="G430022H21Rik"
FT                   /locus_tag="mCG_21047"
FT                   /product="RIKEN cDNA G430022H21, isoform CRA_d"
FT                   /note="gene_id=mCG21047.2 transcript_id=mCT174958.0
FT                   protein_id=mCP97876.0 isoform=CRA_d"
FT                   /protein_id="EDL12304.1"
FT                   /translation="MQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRP
FT                   QNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVI
FT                   LLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCL
FT                   RKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHA
FT                   NVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTN
FT                   SNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGR
FT                   GRERNRSNFRGERGGFRGGRGGTHRGGFTPR"
FT   gene            9917646..9917999
FT                   /pseudo
FT                   /locus_tag="mCG_63815"
FT                   /note="gene_id=mCG63815.2"
FT   mRNA            9917646..9917999
FT                   /pseudo
FT                   /locus_tag="mCG_63815"
FT                   /note="gene_id=mCG63815.2 transcript_id=mCT63998.2 created
FT                   on 03-MAR-2003"
FT   assembly_gap    9924242..9924414
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    9927666..9927685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9928966..9928985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9932478..9933251
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    9934451..9934470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9935793..9936101
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    9937221..9944997
FT                   /estimated_length=7777
FT                   /gap_type="unknown"
FT   assembly_gap    9946104..9946123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9952203..9952226
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            9965189..10022698
FT                   /gene="Prss12"
FT                   /locus_tag="mCG_21048"
FT                   /note="gene_id=mCG21048.1"
FT   mRNA            join(9965189..9965912,9983056..9983206,9994020..9994198,
FT                   9995608..9995749,9998717..9998913,10001466..10001607,
FT                   10003002..10003207,10005601..10005679,10007606..10007728,
FT                   10021383..10021663,10022324..10022698)
FT                   /gene="Prss12"
FT                   /locus_tag="mCG_21048"
FT                   /product="protease, serine, 12 neurotrypsin (motopsin)"
FT                   /note="gene_id=mCG21048.1 transcript_id=mCT19715.1 created
FT                   on 25-JUL-2002"
FT   CDS             join(9965435..9965912,9983056..9983206,9994020..9994198,
FT                   9995608..9995749,9998717..9998913,10001466..10001607,
FT                   10003002..10003207,10005601..10005679,10007606..10007728,
FT                   10021383..10021663,10022324..10022631)
FT                   /codon_start=1
FT                   /gene="Prss12"
FT                   /locus_tag="mCG_21048"
FT                   /product="protease, serine, 12 neurotrypsin (motopsin)"
FT                   /note="gene_id=mCG21048.1 transcript_id=mCT19715.1
FT                   protein_id=mCP19269.1"
FT                   /protein_id="EDL12300.1"
FT                   /translation="MALARCVLAVILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYL
FT                   PSSRRPPRTPRFPLPLRIPAAQRPQVLSTGHTPPTIPRRCGAGESWGNATNLGVPCLHW
FT                   DEVPPFLERSPPASWAELRGQPHNFCRSPDGSGRPWCFYRNAQGKVDWGYCDCGQGPAL
FT                   PVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFG
FT                   EGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKST
FT                   HEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVS
FT                   CSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRV
FT                   EVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGN
FT                   EKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRI
FT                   IGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAV
FT                   RVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPA
FT                   CLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLC
FT                   AGNLQEDNRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVP
FT                   WIKSVTSL"
FT   assembly_gap    9986625..9986644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9987828..9988249
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    9989753..9989772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9990924..9990943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10006840..10007006
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   gene            complement(10023658..10024434)
FT                   /locus_tag="mCG_64318"
FT                   /note="gene_id=mCG64318.2"
FT   mRNA            complement(join(10023658..10023765,10023922..10023967,
FT                   10024217..10024434))
FT                   /locus_tag="mCG_64318"
FT                   /product="mCG64318, transcript variant mCT64501"
FT                   /note="gene_id=mCG64318.2 transcript_id=mCT64501.2 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(10023658..10023967,10024217..10024434))
FT                   /locus_tag="mCG_64318"
FT                   /product="mCG64318, transcript variant mCT176305"
FT                   /note="gene_id=mCG64318.2 transcript_id=mCT176305.0 created
FT                   on 27-NOV-2002"
FT   CDS             complement(10024297..10024404)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64318"
FT                   /product="mCG64318, isoform CRA_a"
FT                   /note="gene_id=mCG64318.2 transcript_id=mCT176305.0
FT                   protein_id=mCP99227.0 isoform=CRA_a"
FT                   /protein_id="EDL12298.1"
FT                   /translation="MVGMISWALFVSGRDAGDTRWLWCWPKAINSARAP"
FT   CDS             complement(10024297..10024404)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64318"
FT                   /product="mCG64318, isoform CRA_a"
FT                   /note="gene_id=mCG64318.2 transcript_id=mCT64501.2
FT                   protein_id=mCP39701.2 isoform=CRA_a"
FT                   /protein_id="EDL12299.1"
FT                   /translation="MVGMISWALFVSGRDAGDTRWLWCWPKAINSARAP"
FT   gene            complement(10025669..>10026658)
FT                   /locus_tag="mCG_49495"
FT                   /note="gene_id=mCG49495.2"
FT   mRNA            complement(10025669..>10026658)
FT                   /locus_tag="mCG_49495"
FT                   /product="mCG49495"
FT                   /note="gene_id=mCG49495.2 transcript_id=mCT49678.2 created
FT                   on 27-NOV-2002"
FT   CDS             complement(10026047..>10026658)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49495"
FT                   /product="mCG49495"
FT                   /note="gene_id=mCG49495.2 transcript_id=mCT49678.2
FT                   protein_id=mCP39618.1"
FT                   /protein_id="EDL12297.1"
FT                   /translation="TVLLVAYKNVVEGRRSAWMVISSIEKKTDTSNKKLQLTKDCQEKV
FT                   ELELRSICITVLELLGKYLIANAINPESKVFYLKMNGDYFQDLAEVACGDDGKQMIENS
FT                   QRAYQEAFDISKKEMQPTHPIRLGLALNLPVFYSVILNNPELAYTLAKTAFDEAITELG
FT                   TLNKDSYKDSTLIMQLLRDNLTLWTSDSAEECDAAEGAEN"
FT   assembly_gap    10028041..10028926
FT                   /estimated_length=886
FT                   /gap_type="unknown"
FT   assembly_gap    10035453..10035472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10036729..10036748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10040304..10040808
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    10042434..10042453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10047056..10195216)
FT                   /locus_tag="mCG_21053"
FT                   /note="gene_id=mCG21053.2"
FT   mRNA            complement(join(10047056..10047427,10049581..10049683,
FT                   10073434..10073543,10075907..10076077,10079542..10079716,
FT                   10084448..10084571,10087852..10087948,10090625..10090807,
FT                   10125554..10125682,10130958..10131143,10150522..10150676,
FT                   10156772..10156859,10194082..10195216))
FT                   /locus_tag="mCG_21053"
FT                   /product="mCG21053, transcript variant mCT19719"
FT                   /note="gene_id=mCG21053.2 transcript_id=mCT19719.2 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(10047056..10047427,10049581..10049683,
FT                   10073434..10073543,10075907..10076077,10079542..10079716,
FT                   10084448..10084571,10087852..10087948,10089554..10089736,
FT                   10125554..10125682,10130958..10131143,10143183..10143297,
FT                   10143399..10143550))
FT                   /locus_tag="mCG_21053"
FT                   /product="mCG21053, transcript variant mCT171293"
FT                   /note="gene_id=mCG21053.2 transcript_id=mCT171293.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(10047308..10047427,10049581..10049683,
FT                   10073434..10073543,10075907..10076077,10079542..10079716,
FT                   10084448..10084571,10087852..10087948,10090625..10090807,
FT                   10125554..10125682,10130958..10131143,10150522..10150676,
FT                   10156772..10156859,10194082..10195062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21053"
FT                   /product="mCG21053, isoform CRA_a"
FT                   /note="gene_id=mCG21053.2 transcript_id=mCT19719.2
FT                   protein_id=mCP19202.2 isoform=CRA_a"
FT                   /protein_id="EDL12295.1"
FT                   /translation="MSFIMKPHRHFQRTLILLATFCMVSIIISAYYLYSGYKQESEVSG
FT                   RASEVDCGDLQHIPSRLMEVRRTMISDASRTDPTVLVFVESQYSSLGQDIIMMLESIRF
FT                   HYHTEIAPGKGDLPALTDNVKGKYVLIIYENILKYINMDSWNRSLLDKYCIEYGVGIIG
FT                   FHKTSEKNLQSFQFRGFPFSISGNLAVKDCCINPHSPLLRVTKSSKLDRGSLPGTDWTV
FT                   FQINHSTYQPVIFAKVKTPENLSPPISKHAFYATIIHDLGLHDGIQRVLFGNNLNFWLH
FT                   KLIFIDAISFLSGKRLTLSLDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRTQI
FT                   TNFTFNLGFSGKFYHTGTEEEDEGDDCLLGSVEEFWWFPHMWSHMQPHLFHNESSLIEQ
FT                   MILNKKFALEHGIPTDMGYAVSPHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPA
FT                   RYRRGFIHKNIMVLPRQTCGLFTHTIFYKEYPGGPRELDKSIHGGELFFTVVLNPISIF
FT                   MTHLSNYGNDRLGLYTFVNLANFVQTWTNLRLQTLPPAQLAHKYFELFPDQKDPLWQNP
FT                   CDDKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALCLFLIMHPSILSNSPSPKSFEEVQ
FT                   FFNRNNYHRGIDWYMDFFPVPSNVTTDFLFEKSANYFHSEDAPKRAASLVPKAKIITIL
FT                   IDPSDRAYSWYQHQRSHEDPAALKFSFYEVISAGPNAPWELRTLQKRCLVPGWYANHIE
FT                   RWLVYFPPFQLLIIDGQQLRTTPATVMDEVQKFLGVSPHYNYSEALTFDSHKGFWCQLL
FT                   EEGKTKCLGKSKGRKYPPMDSDSRAFLSSYYRDHNVELSKLLHRLGQPLPSWLRQELQK
FT                   VR"
FT   CDS             complement(join(10047308..10047427,10049581..10049683,
FT                   10073434..10073543,10075907..10076077,10079542..10079716,
FT                   10084448..10084571,10087852..10087948,10089554..10089736,
FT                   10125554..10125682,10130958..10131122))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21053"
FT                   /product="mCG21053, isoform CRA_b"
FT                   /note="gene_id=mCG21053.2 transcript_id=mCT171293.0
FT                   protein_id=mCP94212.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3YXE5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR021930"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1932544"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXE5"
FT                   /protein_id="EDL12296.1"
FT                   /translation="MGYAVSPHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARY
FT                   RRGFIHKNIMVLPRQTCGLFTHTIFYKEYPGGPRELDKSIHGGELFFTVVLNPISIFMT
FT                   HLSNYGNDRLGLYTFVNLANFVQTWTNLRLQTLPPAQLAHKYFELFPDQKDPLWQNPCD
FT                   DKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALCLFLIMHPSILSNSPSPKSFEEVQFF
FT                   NRNNYHRGIDWYMDFFPVPSNVTTDFLFEKSANYFHSEDAPKRAASLVPKAKIITILID
FT                   PSDRAYSWYQHQRSHEDPAALKFSFYEVISAGPNAPWELRTLQKRCLVPGWYANHIERW
FT                   LVYFPPFQLLIIDGQQLRTTPATVMDEVQKFLGVSPHYNYSEALTFDSHKGFWCQLLEE
FT                   GKTKCLGKSKGRKYPPMDSDSRAFLSSYYRDHNVELSKLLHRLGQPLPSWLRQELQKVR
FT                   "
FT   assembly_gap    10051637..10051656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10059193..10059212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10061053..10061764
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    10062980..10062999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10064657..10064676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10066462..10070105
FT                   /estimated_length=3644
FT                   /gap_type="unknown"
FT   assembly_gap    10075072..10075280
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    10080917..10080936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10090487..10090506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10097517..10101905
FT                   /estimated_length=4389
FT                   /gap_type="unknown"
FT   assembly_gap    10107144..10107263
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    10147561..10147580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10166938..10167218
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    10179534..10179553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10180690..10181101
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    10188546..10188971
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    10243694..10243713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10249608..10249627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10258020..10258039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10260235..10260999
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    10264520..10264583
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    10274077..10274096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10278873..10279476
FT                   /pseudo
FT                   /locus_tag="mCG_142559"
FT                   /note="gene_id=mCG142559.0"
FT   mRNA            10278873..10279476
FT                   /pseudo
FT                   /locus_tag="mCG_142559"
FT                   /note="gene_id=mCG142559.0 transcript_id=mCT180896.0
FT                   created on 03-MAR-2003"
FT   assembly_gap    10296716..10296735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10298857..10298876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10333614..10333633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10339448..10339467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10342577..10342852
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    10362475..10362494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10377994..10378098
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    10381585..10381656
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10382814..10382968
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    10384807..10384952
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    10387204..10387291
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    10395952..10395971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10412700..10413232
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    10422905..10422924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10423986..10424005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10437959..10437978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10438477..10441102
FT                   /estimated_length=2626
FT                   /gap_type="unknown"
FT   assembly_gap    10443044..10444318
FT                   /estimated_length=1275
FT                   /gap_type="unknown"
FT   assembly_gap    10448013..10448154
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    10451293..10454430
FT                   /estimated_length=3138
FT                   /gap_type="unknown"
FT   assembly_gap    10455901..10455920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10457526..10480341
FT                   /estimated_length=22816
FT                   /gap_type="unknown"
FT   assembly_gap    10487064..10487083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10488423..10488531
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    10494882..10495126
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    10514345..10514364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10518526..10518545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10528714..10528760
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    10529093..10530871
FT                   /estimated_length=1779
FT                   /gap_type="unknown"
FT   assembly_gap    10555633..10555652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10560662..10560681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10567253..10567272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10569626..10569645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10574222..10574241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10581257..10581503
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    10603794..10603813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10605118..10613082
FT                   /estimated_length=7965
FT                   /gap_type="unknown"
FT   assembly_gap    10614548..10614567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10616776..10619918
FT                   /estimated_length=3143
FT                   /gap_type="unknown"
FT   assembly_gap    10620986..10621594
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    10626378..10627929
FT                   /estimated_length=1552
FT                   /gap_type="unknown"
FT   assembly_gap    10631399..10631418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10632481..10632500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10672493..10672512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10680397..10681550
FT                   /estimated_length=1154
FT                   /gap_type="unknown"
FT   assembly_gap    10684305..10684324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10697356..10697375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10705789..10706246
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    10716908..10716961
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    10732695..10732714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10736158..10736177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10742128..10742147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10743308..10743327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10744968..10744987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10746285..10746304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10753002..10753295
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    10755268..10755287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10756290..10756309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10779208..10779564
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    10784062..10784081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10785821..>10786249
FT                   /locus_tag="mCG_1045594"
FT                   /note="gene_id=mCG1045594.1"
FT   mRNA            <10785821..>10786249
FT                   /locus_tag="mCG_1045594"
FT                   /product="mCG1045594"
FT                   /note="gene_id=mCG1045594.1 transcript_id=mCT163298.1
FT                   created on 27-NOV-2002"
FT   CDS             <10785821..10786249
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045594"
FT                   /product="mCG1045594"
FT                   /note="gene_id=mCG1045594.1 transcript_id=mCT163298.1
FT                   protein_id=mCP89482.1"
FT                   /protein_id="EDL12294.1"
FT                   /translation="GKCHGLRTARKLCSHRRDQKWHDKQFKKAHLGIAPKAIPFGGASR
FT                   AKGIVLEKVGVGGKQPNSAIRNCARVQLVKNSKKITAFMLSDGCLNFIEENDELLVAGF
FT                   GQKGHAVGDNPGVCFEVVKLANVSRLALYKGKMERPRS"
FT   assembly_gap    10814157..10814176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10815554..10815573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10815836..10817617
FT                   /gene="Tram1l1"
FT                   /locus_tag="mCG_62570"
FT                   /note="gene_id=mCG62570.1"
FT   mRNA            10815836..10817617
FT                   /gene="Tram1l1"
FT                   /locus_tag="mCG_62570"
FT                   /product="translocation associated membrane protein 1-like
FT                   1"
FT                   /note="gene_id=mCG62570.1 transcript_id=mCT62753.1 created
FT                   on 29-OCT-2002"
FT   CDS             10815961..10817052
FT                   /codon_start=1
FT                   /gene="Tram1l1"
FT                   /locus_tag="mCG_62570"
FT                   /product="translocation associated membrane protein 1-like
FT                   1"
FT                   /note="gene_id=mCG62570.1 transcript_id=mCT62753.1
FT                   protein_id=mCP39644.0"
FT                   /protein_id="EDL12293.1"
FT                   /translation="MGLRKKNARNPPVLSHEFMVQNHADMVSCVGMFFVLGLMFEGTSE
FT                   MSIAFLTLQHGVVVPAEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKL
FT                   SRRLQLTKGKQNKLNEAGQLSVFYIVSGIWGMIILASENCLSDPTLLWKSQPHNMMTFQ
FT                   MKFFYISQLAYWFHSFPELYFQKVRKQDIPGQLIYIGLHLFHIGGAYLLYLNHLGLLLL
FT                   MLHYAVELLSSVCSLLYFGDERYQKGLSLWPIVFISGRLVTLIVSVVTVGLHLAGTNRN
FT                   GNALSGNVNVLAAKIAVLSSSCSIQVYITWTLTTVWLQRWLEDANLHVCGRKRRSRARK
FT                   GTENGVENPNRIDSPPKKKEKAP"
FT   assembly_gap    10826017..10828105
FT                   /estimated_length=2089
FT                   /gap_type="unknown"
FT   assembly_gap    10837149..10837438
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    10838935..10838954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10840011..10840030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10854509..10855006
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    10858564..10858706
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    10871094..10871385
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            10880751..10881874
FT                   /locus_tag="mCG_124913"
FT                   /note="gene_id=mCG124913.0"
FT   mRNA            10880751..10881874
FT                   /locus_tag="mCG_124913"
FT                   /product="mCG124913"
FT                   /note="gene_id=mCG124913.0 transcript_id=mCT126165.0
FT                   created on 23-OCT-2002"
FT   CDS             10880897..10881229
FT                   /codon_start=1
FT                   /locus_tag="mCG_124913"
FT                   /product="mCG124913"
FT                   /note="gene_id=mCG124913.0 transcript_id=mCT126165.0
FT                   protein_id=mCP89181.1"
FT                   /protein_id="EDL12292.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENG
FT                   EQEADNEVDEEEEEGGEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQ
FT                   KTEEDD"
FT   assembly_gap    10881875..10881894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10887796..10888036
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   gene            complement(10897583..10925133)
FT                   /locus_tag="mCG_6275"
FT                   /note="gene_id=mCG6275.2"
FT   mRNA            complement(join(10897583..10898006,10902892..10903081,
FT                   10906591..10906700,10908622..10908780,10911391..10911566,
FT                   10912569..10912827,10913317..10913506,10915735..10915844,
FT                   10918239..10918400,10920391..10920486,10925077..10925133))
FT                   /locus_tag="mCG_6275"
FT                   /product="mCG6275, transcript variant mCT5846"
FT                   /note="gene_id=mCG6275.2 transcript_id=mCT5846.2 created on
FT                   23-OCT-2002"
FT   mRNA            complement(join(10897583..10898006,10902892..10903081,
FT                   10906591..10906700,10908622..10908780,10911391..10911566,
FT                   10912569..10912827,10913317..10913506,10915735..10915844,
FT                   10918239..10918400,10918771..10918949,10920391..10920486,
FT                   10925077..10925133))
FT                   /locus_tag="mCG_6275"
FT                   /product="mCG6275, transcript variant mCT174973"
FT                   /note="gene_id=mCG6275.2 transcript_id=mCT174973.0 created
FT                   on 23-OCT-2002"
FT   CDS             complement(join(10897983..10898006,10902892..10903081,
FT                   10906591..10906700,10908622..10908780,10911391..10911566,
FT                   10912569..10912827,10913317..10913506,10915735..10915844,
FT                   10918239..10918400,10918771..10918949,10920391..10920466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6275"
FT                   /product="mCG6275, isoform CRA_a"
FT                   /note="gene_id=mCG6275.2 transcript_id=mCT174973.0
FT                   protein_id=mCP97892.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EHI3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:1919074"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHI3"
FT                   /protein_id="EDL12290.1"
FT                   /translation="MIMSNHQGTSGPHESENFVDVLNLPDAEKKTVNKKQPFITQVFHK
FT                   ASVPHQDQVCTSLPVTKRGILFGNDLSVVCDDGNLPKAILDMLSILNEKGAITEGIFRI
FT                   SGNMSACHALKERLDYGKKVNLKKECVLAVASVLKEFLHNIQGSVLTSRLYDIWLDVLD
FT                   QENEEEKLAAVQSLLQRLPYPNVSLLRELFRMLHNIERNSAVNKMTAYSLSVCMAPCIL
FT                   CLPRSCNSGLANDISNEISLVKFLIENSLKIFGESTVLRYDASSVSCPDVEKASGPLNN
FT                   ITNFDEMKDKEYQDNHCQSGMTCPTGNNSVPMSPTAPLHNEGTIASEKPVKRSFIKPMI
FT                   TCGSTTSHDNVCITPSPSAPNKGHLFGKSLTIICKDGNLPAPVLDMLSIIDAKGPDTER
FT                   IFRTLANKPYLTLREKLDSAEEMNLREESVYIVASVLKEFIRNIPGSLLCSNLYGKWLA
FT                   VLDQEFHDQKISAIQSLLIQMPLPNVLLLRHLLSVLHKIKGRSSITHMTAYALSVRIAP
FT                   SMLWNPSLSNSGFGNDISQKKRLQKET"
FT   CDS             complement(join(10897983..10898006,10902892..10903081,
FT                   10906591..10906700,10908622..10908780,10911391..10911566,
FT                   10912569..10912827,10913317..10913506,10915735..10915844,
FT                   10918239..10918400,10920391..10920429))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6275"
FT                   /product="mCG6275, isoform CRA_b"
FT                   /note="gene_id=mCG6275.2 transcript_id=mCT5846.2
FT                   protein_id=mCP19243.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9DAP3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:1919074"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAP3"
FT                   /protein_id="EDL12291.1"
FT                   /translation="MSQKTSWMFSTCQDMLSILNEKGAITEGIFRISGNMSACHALKER
FT                   LDYGKKVNLKKECVLAVASVLKEFLHNIQGSVLTSRLYDIWLDVLDQENEEEKLAAVQS
FT                   LLQRLPYPNVSLLRELFRMLHNIERNSAVNKMTAYSLSVCMAPCILCLPRSCNSGLAND
FT                   ISNEISLVKFLIENSLKIFGESTVLRYDASSVSCPDVEKASGPLNNITNFDEMKDKEYQ
FT                   DNHCQSGMTCPTGNNSVPMSPTAPLHNEGTIASEKPVKRSFIKPMITCGSTTSHDNVCI
FT                   TPSPSAPNKGHLFGKSLTIICKDGNLPAPVLDMLSIIDAKGPDTERIFRTLANKPYLTL
FT                   REKLDSAEEMNLREESVYIVASVLKEFIRNIPGSLLCSNLYGKWLAVLDQEFHDQKISA
FT                   IQSLLIQMPLPNVLLLRHLLSVLHKIKGRSSITHMTAYALSVRIAPSMLWNPSLSNSGF
FT                   GNDISQKKRLQKET"
FT   assembly_gap    10903947..10903966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10905891..10905910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10922776..10922795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10925494..10925513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10927705..10927724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10930642..10930661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10931932..10931951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10932970..10932989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10934125..10934144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10951761..10951780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10959692..10959711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10985252..10985271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10992094..10992113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11010018..11013651
FT                   /estimated_length=3634
FT                   /gap_type="unknown"
FT   assembly_gap    11022224..11022332
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    11066379..11066427
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            complement(11071182..11091709)
FT                   /locus_tag="mCG_54601"
FT                   /note="gene_id=mCG54601.2"
FT   mRNA            complement(join(11071182..11071489,11089037..11089186,
FT                   11090397..11090581,11091593..11091709))
FT                   /locus_tag="mCG_54601"
FT                   /product="mCG54601, transcript variant mCT54784"
FT                   /note="gene_id=mCG54601.2 transcript_id=mCT54784.2 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(11071489,11089037..11089186,
FT                   11090397..11090545))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54601"
FT                   /product="mCG54601, isoform CRA_b"
FT                   /note="gene_id=mCG54601.2 transcript_id=mCT54784.2
FT                   protein_id=mCP39661.2 isoform=CRA_b"
FT                   /db_xref="GOA:J3QNW2"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1923637"
FT                   /db_xref="UniProtKB/TrEMBL:J3QNW2"
FT                   /protein_id="EDL12289.1"
FT                   /translation="METLGEKETLLDDKPRNMLFQGSVALRRGWRRKKYHFSLFTDVLV
FT                   VSKNVHTKKFKIKDIIPLRYLWISDSADLLGGDSRMACKSIILFWPMEKLVATF"
FT   assembly_gap    11072871..11072890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11073982..11074001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11075475..11080312
FT                   /estimated_length=4838
FT                   /gap_type="unknown"
FT   assembly_gap    11081437..11082145
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11083867..11083950,11085122..11085216,
FT                   11085980..11086021,11089037..11089186,11090397..11090581,
FT                   11091593..11091709))
FT                   /locus_tag="mCG_54601"
FT                   /product="mCG54601, transcript variant mCT178435"
FT                   /note="gene_id=mCG54601.2 transcript_id=mCT178435.0 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(11085186..11085216,11085980..11086021,
FT                   11089037..11089186,11090397..11090545))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54601"
FT                   /product="mCG54601, isoform CRA_a"
FT                   /note="gene_id=mCG54601.2 transcript_id=mCT178435.0
FT                   protein_id=mCP101357.0 isoform=CRA_a"
FT                   /db_xref="GOA:J3QMC0"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1923637"
FT                   /db_xref="UniProtKB/TrEMBL:J3QMC0"
FT                   /protein_id="EDL12288.1"
FT                   /translation="METLGEKETLLDDKPRNMLFQGSVALRRGWRRKKYHFSLFTDVLV
FT                   VSKNVHTKKFKIKDIIPLRYLWISDSADLLGGDSRMACKSIILFWPMEKLVATFCTKEE
FT                   KKWWYFFLQRSITNAKKRG"
FT   gene            complement(11099126..11099763)
FT                   /pseudo
FT                   /locus_tag="mCG_49424"
FT                   /note="gene_id=mCG49424.2"
FT   mRNA            complement(11099126..11099763)
FT                   /pseudo
FT                   /locus_tag="mCG_49424"
FT                   /note="gene_id=mCG49424.2 transcript_id=mCT49607.2 created
FT                   on 23-OCT-2002"
FT   assembly_gap    11126789..11127198
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    11141622..11141737
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    11142756..11143417
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    11151947..11151966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11153582..11153601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11155150..11155169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11156809..11156828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11160162..11160975
FT                   /estimated_length=814
FT                   /gap_type="unknown"
FT   assembly_gap    11162472..11162491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11225014..11225033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11226245..11226264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11230670..11230689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11232328..11232347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11233473..11233492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11235975..11235994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11239125..11239144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11243863..11244150
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    11265649..11265668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11268835..11268854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11278450..11278469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11286893..11286912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11296383..11296557
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    11303569..11303588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11304822..11304841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11346440..11350727
FT                   /estimated_length=4288
FT                   /gap_type="unknown"
FT   assembly_gap    11351917..11351936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11354230..11356265
FT                   /estimated_length=2036
FT                   /gap_type="unknown"
FT   assembly_gap    11358651..11358670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11371159..11371178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11372390..11372409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11392920..11392939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11419098..11419117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11420220..11420239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11425373..11425714
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    11428046..11428151
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    11443548..11443567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11452111..11452130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11467823..11467975
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    11484274..11484293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11490636..11490655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11492556..11493662
FT                   /estimated_length=1107
FT                   /gap_type="unknown"
FT   assembly_gap    11494267..11494709
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    11496360..11496728
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    11505909..11506358
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    11514859..11514901
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    11518825..11521485
FT                   /estimated_length=2661
FT                   /gap_type="unknown"
FT   assembly_gap    11526016..11526035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11533541..11534014
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    11556641..11556660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11558660..11558679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11560163..11561179)
FT                   /pseudo
FT                   /locus_tag="mCG_21423"
FT                   /note="gene_id=mCG21423.1"
FT   mRNA            complement(11560163..11561179)
FT                   /pseudo
FT                   /locus_tag="mCG_21423"
FT                   /note="gene_id=mCG21423.1 transcript_id=mCT21794.2 created
FT                   on 23-OCT-2002"
FT   assembly_gap    11645945..11646326
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    11671470..11671489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11679615..11679634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11695671..11696412
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    11718804..11720808
FT                   /estimated_length=2005
FT                   /gap_type="unknown"
FT   assembly_gap    11722639..11722658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11723949..11723968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11728807..11728826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11732893..11732912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11734147..11734166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11745652..11745671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11749481..11753493
FT                   /estimated_length=4013
FT                   /gap_type="unknown"
FT   assembly_gap    11786935..11786954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11789976..11790286
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    11815313..11815332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11819450..11819569
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    11831998..11832461
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    11858317..11858480
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    11860509..11861154
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    11881230..11881249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11902403..11906034
FT                   /estimated_length=3632
FT                   /gap_type="unknown"
FT   assembly_gap    11934968..11937280
FT                   /estimated_length=2313
FT                   /gap_type="unknown"
FT   assembly_gap    11939834..11939853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11942968..11949258
FT                   /estimated_length=6291
FT                   /gap_type="unknown"
FT   assembly_gap    11950300..11950319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11952333..11953770
FT                   /estimated_length=1438
FT                   /gap_type="unknown"
FT   assembly_gap    11957042..11957781
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    11959021..11959040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11961468..11961487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11962760..11964150
FT                   /estimated_length=1391
FT                   /gap_type="unknown"
FT   gene            <11964151..12253205
FT                   /locus_tag="mCG_21420"
FT                   /note="gene_id=mCG21420.2"
FT   mRNA            join(<11964151..11964465,12088438..12088525,
FT                   12101534..12101688,12137406..12137591,12139444..12139572,
FT                   12211489..12211671,12226215..12226311,12236405..12236528,
FT                   12238372..12238546,12241593..12241763,12242829..12242938,
FT                   12250528..12250630,12253077..12253205)
FT                   /locus_tag="mCG_21420"
FT                   /product="mCG21420"
FT                   /note="gene_id=mCG21420.2 transcript_id=mCT21795.2 created
FT                   on 25-JUL-2002"
FT   CDS             join(<11964151..11964465,12088438..12088525,
FT                   12101534..12101688,12137406..12137591,12139444..12139572,
FT                   12211489..12211671,12226215..12226311,12236405..12236528,
FT                   12238372..12238546,12241593..12241763,12242829..12242938,
FT                   12250528..12250630,12253077..12253196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21420"
FT                   /product="mCG21420"
FT                   /note="gene_id=mCG21420.2 transcript_id=mCT21795.2
FT                   protein_id=mCP19292.2"
FT                   /protein_id="EDL12287.1"
FT                   /translation="IFQYNHSTYQPVLLTELQSEKSLSFLSSQTLYATIIQDLGLHDGI
FT                   QRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLSLDRYILVDIDDIFVGKEGTRMNVKDV
FT                   KALLETQNLLRTQVANFTFNLGFSGKFYHTGTEEEDEGDDLLLRSVDEFWWFPHMWSHM
FT                   QPHLFHNESSLVEQMILNKEFALEHGIPINLGYAVAPHHSGVYPVHIQLYAAWKKVWGI
FT                   QVTSTEEYPHLKPARYRKGFIHNSIMVLPRQTCGLFTHTIFYKEYPGGPQELDKSIKGG
FT                   ELFLTILLNPISIFMTHLSNYGNDRLGLYTFVNLANFVHSWTNLKLQTLPPVQLAHKYF
FT                   ELFPEQKDPLWQNPCDDKRHKDIWSREKTCDHLPKFLVIGPQKTGTTALYLFLLMHPSI
FT                   ISNLPSPKTFEEVQFFNGNNYHKGIEWYMDFFPTPSNITSDFLFEKSANYFHSEEAPKR
FT                   AASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALRFNFYEVITTGHWAPPDLKTLQ
FT                   RRCLVPGWYAVHIERWLAYFSTSQLLIIDGQQLRSDPATVMDEVQKFLGVTPHYNYSEA
FT                   LTFDPQKGFWCQLLEGGKTKCLGKSKGRKYPPMDSESRTFLSSYYRDHNVELSKLLHRL
FT                   GQPLPSWLRQELQKVR"
FT   assembly_gap    11974894..11975001
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    11978878..11981037
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   assembly_gap    11982198..11982217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11984060..11984079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11985500..11985519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12002754..12002773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12004849..12004868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12018252..12018271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12035801..12035820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12079853..12079872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12098555..12098574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12101066..12101085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12127981..12128000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12159433..12159452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12216554..12216573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12247732..12247751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12283652..12283696
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    12285317..12285336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12286816..12286835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12297203..12297591
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    12304408..12304427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12305914..12305933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12333350..12333369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12338453..12338537
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    12348464..12348483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12369658..12369677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12381896..12381915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12395719..12395738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12400636..12494283)
FT                   /gene="Ugt8a"
FT                   /locus_tag="mCG_21421"
FT                   /note="gene_id=mCG21421.2"
FT   mRNA            complement(join(12400636..12402702,12406710..12406929,
FT                   12409227..12409303,12412777..12412919,12452644..12453467,
FT                   12494191..12494283))
FT                   /gene="Ugt8a"
FT                   /locus_tag="mCG_21421"
FT                   /product="UDP galactosyltransferase 8A"
FT                   /note="gene_id=mCG21421.2 transcript_id=mCT21796.2 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(12402339..12402702,12406710..12406929,
FT                   12409227..12409303,12412777..12412919,12452644..12453465))
FT                   /codon_start=1
FT                   /gene="Ugt8a"
FT                   /locus_tag="mCG_21421"
FT                   /product="UDP galactosyltransferase 8A"
FT                   /note="gene_id=mCG21421.2 transcript_id=mCT21796.2
FT                   protein_id=mCP19283.2"
FT                   /protein_id="EDL12286.1"
FT                   /translation="MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASAL
FT                   HERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELV
FT                   DILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLW
FT                   YPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRIGVSFLVLPKYERIMQKY
FT                   NLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVS
FT                   GAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEW
FT                   LPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILL
FT                   EWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGAR
FT                   HLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIYRKIKSLWSKNEHSTVNG
FT                   HYQNGIRNGKYKGNGHIKHEKKVK"
FT   assembly_gap    12410609..12410628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12412488..12412507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12413684..12413703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12415875..12415894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12417178..12417197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12428907..12428926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12432122..12432141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12433179..12433198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12434203..12434222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12435740..12435759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12436806..12436825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12438416..12438435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12445634..12446035
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    12448013..12449003
FT                   /estimated_length=991
FT                   /gap_type="unknown"
FT   assembly_gap    12459355..12460005
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    12476074..12477119
FT                   /estimated_length=1046
FT                   /gap_type="unknown"
FT   assembly_gap    12480806..12480825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12526505..12526974
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    12542923..12542987
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    12545295..12546108
FT                   /estimated_length=814
FT                   /gap_type="unknown"
FT   assembly_gap    12559912..12559931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12561388..12561407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12565722..12565741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12567699..12576000
FT                   /estimated_length=8302
FT                   /gap_type="unknown"
FT   assembly_gap    12577410..12577429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12584490..12584514
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    12585696..12585715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12590502..12592982
FT                   /estimated_length=2481
FT                   /gap_type="unknown"
FT   assembly_gap    12600703..12600722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12602222..12602241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12604471..12604490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12613401..12613420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12641337..12641356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12643508..12643527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12650437..12650456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12651192..12651358
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    12653973..12657379
FT                   /estimated_length=3407
FT                   /gap_type="unknown"
FT   assembly_gap    12659209..12659228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12660841..12660860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12663062..12669804
FT                   /estimated_length=6743
FT                   /gap_type="unknown"
FT   assembly_gap    12673173..12673192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12675479..12675498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12676898..12678897
FT                   /estimated_length=2000
FT                   /gap_type="unknown"
FT   assembly_gap    12680253..12680272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12683608..12683627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12689807..12689826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12692388..12692407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12694363..12694382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12695826..12695845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12697127..12697146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12699862..12699881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12701105..12701124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12737587..12739574
FT                   /estimated_length=1988
FT                   /gap_type="unknown"
FT   assembly_gap    12753453..12753697
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   gene            12759596..12761619
FT                   /locus_tag="mCG_147405"
FT                   /note="gene_id=mCG147405.0"
FT   mRNA            join(12759596..12759726,12760243..12761619)
FT                   /locus_tag="mCG_147405"
FT                   /product="mCG147405"
FT                   /note="gene_id=mCG147405.0 transcript_id=mCT187668.0
FT                   created on 13-JAN-2004"
FT   CDS             12761193..12761366
FT                   /codon_start=1
FT                   /locus_tag="mCG_147405"
FT                   /product="mCG147405"
FT                   /note="gene_id=mCG147405.0 transcript_id=mCT187668.0
FT                   protein_id=mCP109630.0"
FT                   /protein_id="EDL12285.1"
FT                   /translation="MPSCWIHFAFCFFFHKQNLSQISFHKYRLLSSLNYSVHESLPCFN
FT                   LKQALVLPEAKL"
FT   assembly_gap    12764860..12764879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12767786..12767805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12778482..12781452
FT                   /estimated_length=2971
FT                   /gap_type="unknown"
FT   assembly_gap    12791432..12791451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12792797..12797803
FT                   /estimated_length=5007
FT                   /gap_type="unknown"
FT   assembly_gap    12806245..12806264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12812240..12813318
FT                   /pseudo
FT                   /locus_tag="mCG_1045556"
FT                   /note="gene_id=mCG1045556.0"
FT   mRNA            12812240..12813318
FT                   /pseudo
FT                   /locus_tag="mCG_1045556"
FT                   /note="gene_id=mCG1045556.0 transcript_id=mCT163260.1
FT                   created on 15-NOV-2002"
FT   assembly_gap    12814404..12814642
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    12881354..12881373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12894871..12981034
FT                   /gene="Arsj"
FT                   /locus_tag="mCG_4767"
FT                   /note="gene_id=mCG4767.2"
FT   mRNA            join(<12894871..12895184,12978663..12981034)
FT                   /gene="Arsj"
FT                   /locus_tag="mCG_4767"
FT                   /product="arylsulfatase J"
FT                   /note="gene_id=mCG4767.2 transcript_id=mCT3965.2 created on
FT                   23-OCT-2002"
FT   CDS             join(12894871..12895184,12978663..12980067)
FT                   /codon_start=1
FT                   /gene="Arsj"
FT                   /locus_tag="mCG_4767"
FT                   /product="arylsulfatase J"
FT                   /note="gene_id=mCG4767.2 transcript_id=mCT3965.2
FT                   protein_id=mCP19280.1"
FT                   /protein_id="EDL12284.1"
FT                   /translation="MGALAGFSVLSLLTYGYLCWGQDLEEEGSLKAQVDERPEAGTAGT
FT                   SQPHLIFILADDQGFRDVGYHGSEIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFITG
FT                   KYQIHTGLQHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKDCMPTKR
FT                   GFDTFFGSLLGSGDYYTHYKCDSPGVCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQIL
FT                   ATHDPTKPLFLYVAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAIHNVTL
FT                   ALKRYGFYNNSIIIYSSDNGGQPTAGGSNWPLRGSKGTYWEGGIRAVGFVHSPLLKNKG
FT                   TVCKELVHITDWYPTLISLAEGQIDEDIQLDGYDIWETISEGLRSPRVDILHNIDPIYT
FT                   KAKNGSWAAGYGIWNTAIQSAIRVQHWKLLTGNPGYSDWVPPQAFSNLGPNRWHNERIT
FT                   LSTGKSIWLFNITADPYERVDLSSRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPR
FT                   LNGGVWGPWYKEENKKKKSNKTKAKKMQKKKSKARMRKQLAAHSSIKCHPSVATG"
FT   assembly_gap    12903530..12908551
FT                   /estimated_length=5022
FT                   /gap_type="unknown"
FT   assembly_gap    12912038..12912057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12913459..12913478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12915075..12915094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12917427..12918658
FT                   /estimated_length=1232
FT                   /gap_type="unknown"
FT   assembly_gap    12929470..12929489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12934933..12934952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12981672..12987439)
FT                   /locus_tag="mCG_147428"
FT                   /note="gene_id=mCG147428.0"
FT   mRNA            complement(join(12981672..12984834,12986546..12987439))
FT                   /locus_tag="mCG_147428"
FT                   /product="mCG147428"
FT                   /note="gene_id=mCG147428.0 transcript_id=mCT187691.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12983951..12984142)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147428"
FT                   /product="mCG147428"
FT                   /note="gene_id=mCG147428.0 transcript_id=mCT187691.0
FT                   protein_id=mCP109652.0"
FT                   /protein_id="EDL12283.1"
FT                   /translation="MVPSWCLGLQALATQRTRLPLRIHYPTQHSEVQDHCGGMDKKGPH
FT                   KLIYFNALFLGDGFLRKD"
FT   assembly_gap    12984947..12984966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12990093..12990423
FT                   /locus_tag="mCG_1045593"
FT                   /note="gene_id=mCG1045593.1"
FT   mRNA            12990093..12990423
FT                   /locus_tag="mCG_1045593"
FT                   /product="mCG1045593"
FT                   /note="gene_id=mCG1045593.1 transcript_id=mCT163297.1
FT                   created on 27-NOV-2002"
FT   CDS             12990118..12990297
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045593"
FT                   /product="mCG1045593"
FT                   /note="gene_id=mCG1045593.1 transcript_id=mCT163297.1
FT                   protein_id=mCP89475.1"
FT                   /protein_id="EDL12282.1"
FT                   /translation="MDTSCVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRN
FT                   VKGPVREGDVLTLL"
FT   assembly_gap    13000870..13000889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13040594..13040686
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    13048513..13048532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13060339..13061395
FT                   /estimated_length=1057
FT                   /gap_type="unknown"
FT   assembly_gap    13065602..13065621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13067579..13067598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13070260..13070279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13079612..13079631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13083968..13083987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13141627..13141675
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            <13141682..13394297
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /note="gene_id=mCG4768.2"
FT   mRNA            join(<13141682..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13328042..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13392006..13394297)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT3966"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT3966.2 created on
FT                   06-JAN-2003"
FT   mRNA            join(13141682..13142226,13143786..13143880,
FT                   13232084..13232816)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT178428"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT178428.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(<13141725..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13328042..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13365349..13368084)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190594"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190594.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<13141731..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13327598..13327652,13328042..13328145,
FT                   13331639..13331722,13344661..13344755,13346127..13346249,
FT                   13346993..13347076,13347529..13347571,13351013..13351050,
FT                   13359922..13361159)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190592"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190592.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<13141757..13142120,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13327554..13327652,13328042..13328145,
FT                   13331639..13331722,13344661..13344755,13346127..13346249,
FT                   13346993..13347076,13347529..13347571,13351013..13351050,
FT                   13359922..13359970,13383932..13384007,13387507..13387601,
FT                   13389380..13389608,13390732..13390820,13392006..13393071)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190595"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190595.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<13142052..13142226,13143786..13143880,
FT                   13232084..13232143,13315023..13315088,13318301..13318373,
FT                   13328042..13328145,13331639..13331722,13344661..13344755,
FT                   13346127..13346249,13346993..13347076,13347529..13347571,
FT                   13351013..13351050,13359922..13359970,13383932..13384007,
FT                   13387507..13387601,13389380..13389608,13392006..13392367)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190590"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190590.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<13142064..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13319292..13319364,13328042..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13355130..13355189,
FT                   13357482..13357523,13359922..13359970,13383932..13384007,
FT                   13387507..13387601,13389380..13389608,13392006..13393037)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190591"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190591.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<13142065..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13328042..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13390732..13390820,13392006..13394154)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190596"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190596.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<13142090..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13318373,13328042..13328145,13331639..13331684)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_e"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190594.0
FT                   protein_id=mCP111520.0 isoform=CRA_e"
FT                   /protein_id="EDL12276.1"
FT                   /translation="QRGGASPGKPGLFACRPSHCPDPAMASTTTCTRFTDEYQLFEELG
FT                   KGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSI
FT                   SEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKP
FT                   ENLLLASKSKGAAVKLADFGLSHRSSRRPAGMVWFCWHTWVSFSRSPA"
FT   mRNA            join(<13142121..13142226,13143786..13143880,
FT                   13232084..13232143,13276849..13276903,13315023..13315088,
FT                   13318301..13319364,13328042..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13390732..13390820,13392006..13392913)
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, transcript variant mCT190593"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190593.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(13142162..13142226,13143786..13143880,
FT                   13232084..13232208)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_g"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT178428.0
FT                   protein_id=mCP101350.0 isoform=CRA_g"
FT                   /protein_id="EDL12280.1"
FT                   /translation="MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKII
FT                   NTKKLSARDHQKLEREARICRLLKHPNIGEEIFSDILNNISYVFCMELQ"
FT   assembly_gap    13146368..13146387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13152064..13152762
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    13203170..13203189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13204559..13205360
FT                   /estimated_length=802
FT                   /gap_type="unknown"
FT   assembly_gap    13207175..13207194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13233051..13233109
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    13254954..13254973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13286501..13286921
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   gene            13286922..13288474
FT                   /locus_tag="mCG_147406"
FT                   /note="gene_id=mCG147406.0"
FT   mRNA            13286922..13288474
FT                   /locus_tag="mCG_147406"
FT                   /product="mCG147406"
FT                   /note="gene_id=mCG147406.0 transcript_id=mCT187669.0
FT                   created on 13-JAN-2004"
FT   CDS             13287008..13287253
FT                   /codon_start=1
FT                   /locus_tag="mCG_147406"
FT                   /product="mCG147406"
FT                   /note="gene_id=mCG147406.0 transcript_id=mCT187669.0
FT                   protein_id=mCP109631.0"
FT                   /protein_id="EDL12281.1"
FT                   /translation="MHVAVVEHLLNLHSVLNSIPSTHTHTHTHTHTHTHTHTHIHKHSP
FT                   LCYDPPLIIDFYIMKYAVYYILLNEKVENQILTNYI"
FT   assembly_gap    13296738..13296757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13323952..13324098
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    13327964..13327983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13355130..13355189,
FT                   13357482..13357523,13359922..13359970,13383932..13384007,
FT                   13387507..13387601,13389380..13389608,13392006..13392009)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_b"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190591.0
FT                   protein_id=mCP111517.0 isoform=CRA_b"
FT                   /protein_id="EDL12273.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDGNKESTESSNTTIEDE
FT                   DVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFE
FT                   NALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRD
FT                   GKWQNVHFHRSGSPTVPIN"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13392006..13392009)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_a"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190590.0
FT                   protein_id=mCP111516.0 isoform=CRA_a"
FT                   /protein_id="EDL12272.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
FT                   GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRL
FT                   TQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13390732..13390798)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_d"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190593.0
FT                   protein_id=mCP111519.0 isoform=CRA_d"
FT                   /protein_id="EDL12275.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
FT                   GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRL
FT                   TQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGT
FT                   SLWQNI"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13390732..13390798)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_d"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190595.0
FT                   protein_id=mCP111521.0 isoform=CRA_d"
FT                   /protein_id="EDL12277.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
FT                   GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRL
FT                   TQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGT
FT                   SLWQNI"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13390732..13390798)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_d"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190596.0
FT                   protein_id=mCP111522.0 isoform=CRA_d"
FT                   /protein_id="EDL12278.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
FT                   GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRL
FT                   TQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGT
FT                   SLWQNI"
FT   CDS             join(<13328088..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13360098)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_c"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT190592.0
FT                   protein_id=mCP111518.0 isoform=CRA_c"
FT                   /protein_id="EDL12274.1"
FT                   /translation="SWQTSGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMW
FT                   ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP
FT                   AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSA
FT                   AKSLLKKPDGVKESTESSNTTIEDEDVKGRLEAKSGKALIHRATSITAKLVHFKLGRRF
FT                   IPKEILFCFVL"
FT   CDS             join(<13328103..13328145,13331639..13331722,
FT                   13344661..13344755,13346127..13346249,13346993..13347076,
FT                   13347529..13347571,13351013..13351050,13359922..13359970,
FT                   13383932..13384007,13387507..13387601,13389380..13389608,
FT                   13392006..13392009)
FT                   /codon_start=1
FT                   /gene="Camk2d"
FT                   /locus_tag="mCG_4768"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   delta, isoform CRA_f"
FT                   /note="gene_id=mCG4768.2 transcript_id=mCT3966.2
FT                   protein_id=mCP19192.2 isoform=CRA_f"
FT                   /protein_id="EDL12279.1"
FT                   /translation="GLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVI
FT                   LYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRIT
FT                   ASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLL
FT                   KKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAF
FT                   EPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMD
FT                   GSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN"
FT   assembly_gap    13335170..13335189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13336724..13336743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13387320..13387339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13404111..13408147
FT                   /estimated_length=4037
FT                   /gap_type="unknown"
FT   assembly_gap    13409591..13409610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13410672..13410691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13457930..13457949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13463265..13463965
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    13465952..13466343
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    13467192..13468985
FT                   /estimated_length=1794
FT                   /gap_type="unknown"
FT   assembly_gap    13472827..13472846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13474826..13476451
FT                   /estimated_length=1626
FT                   /gap_type="unknown"
FT   assembly_gap    13477466..13477505
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            complement(13488739..>13976262)
FT                   /gene="Ank2"
FT                   /locus_tag="mCG_126687"
FT                   /note="gene_id=mCG126687.1"
FT   mRNA            complement(join(13488739..13489327,13489439..13489522,
FT                   13492361..13492649,13493949..13494201,13496044..13496187,
FT                   13497162..13497293,13499488..13499562,13501024..13507221,
FT                   13510151..13510172,13511909..13511941,13512597..13512719,
FT                   13514402..13514527,13515288..13515516,13516673..13516769,
FT                   13518322..13518526,13519081..13519292,13521682..13521836,
FT                   13522814..13522912,13524369..13524593,13535467..13535570,
FT                   13536260..13536362,13541223..13541367,13547546..13547618,
FT                   13557233..13557331,13558323..13558421,13562125..13562223,
FT                   13563393..13563491,13570297..13570494,13572117..13572215,
FT                   13572680..13572778,13576258..13576455,13582722..13582820,
FT                   13587641..13587739,13587897..13587995,13590537..13590734,
FT                   13597189..13597287,13605161..13605259,13606633..13606731,
FT                   13610685..13610708,13611138..13611323,13615422..13615520,
FT                   13643026..13643123,13645411..13645510,13673167..13673268,
FT                   13812520..13812618,13906609..13906669,13976048..13976262))
FT                   /gene="Ank2"
FT                   /locus_tag="mCG_126687"
FT                   /product="ankyrin 2, brain, transcript variant mCT127960"
FT                   /note="gene_id=mCG126687.1 transcript_id=mCT127960.1
FT                   created on 25-NOV-2002"
FT   CDS             complement(join(13489097..13489327,13489439..13489522,
FT                   13492361..13492649,13493949..13494201,13496044..13496187,
FT                   13497162..13497293,13499488..13499562,13501024..13507221,
FT                   13510151..13510172,13511909..13511941,13512597..13512719,
FT                   13514402..13514527,13515288..13515516,13516673..13516769,
FT                   13518322..13518526,13519081..13519292,13521682..13521836,
FT                   13522814..13522912,13524369..13524593,13535467..13535570,
FT                   13536260..13536362,13541223..13541367,13547546..13547618,
FT                   13557233..13557331,13558323..13558421,13562125..13562223,
FT                   13563393..13563491,13570297..13570494,13572117..13572215,
FT                   13572680..13572778,13576258..13576455,13582722..13582820,
FT                   13587641..13587739,13587897..13587995,13590537..13590734,
FT                   13597189..13597287,13605161..13605259,13606633..13606731,
FT                   13610685..13610708,13611138..13611323,13615422..13615520,
FT                   13643026..13643123,13645411..13645510,13673167..13673268,
FT                   13812520..13812618,13906609..13906629))
FT                   /codon_start=1
FT                   /gene="Ank2"
FT                   /locus_tag="mCG_126687"
FT                   /product="ankyrin 2, brain, isoform CRA_b"
FT                   /note="gene_id=mCG126687.1 transcript_id=mCT127960.1
FT                   protein_id=mCP89526.1 isoform=CRA_b"
FT                   /protein_id="EDL12269.1"
FT                   /translation="MTTMLQKSQNKCESQTTCNEVTQSSCIQRKDPNGVHPDDQSDSNA
FT                   SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDS
FT                   ATKEGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLE
FT                   NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAAL
FT                   LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP
FT                   LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLAR
FT                   TKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK
FT                   RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNI
FT                   VLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS
FT                   RLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGF
FT                   TPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPH
FT                   ATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLL
FT                   DKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNV
FT                   KMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAI
FT                   AKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTVTGDGG
FT                   EYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRD
FT                   SAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDAR
FT                   GGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPS
FT                   GAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELV
FT                   VLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVV
FT                   SRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNK
FT                   ATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQ
FT                   WEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFV
FT                   VFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLV
FT                   PLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLN
FT                   ITLPIYAKESESDQEPEEEIGMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSEVS
FT                   EMKQDLIKMTAILTTDVSDKAGSLKVKELAKAGEEEPGEPFEIVERVKEDLEKVNAILR
FT                   SGTCMRDEGRARSSQSERELEEEWVIVSDEEIQEAKQHAPVEIDEHPCIEVRVDRETKA
FT                   KVEKDSTGLVNYLTDDLNSYTSPHEKKPHTAPEKSGETSQASAVGKSSESNKGKATSAE
FT                   EKQSAQKQLKPGLAIKKPVRRKLKEKQKQKEESSQSSEEKTELKKGSSEESVDEDRGLV
FT                   PEPLPTAKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPVRVKGKEDVPKRTTP
FT                   RTHPAVSPSSKSSTSSKAERHSSLSSSAKPERHTPVSPSSKNEKHSPVSPSAKTERHSP
FT                   VFSGKPEKHSPGSPSTKNERHSPVSSLKTERHTPGSPSGKTDKRPPVPSSGRTEKHPPV
FT                   SPGKTEKRLPGSPSIRTPEKPAPGSATGKHEKHLPVSPGKTEKQPPISPTSKTERIEET
FT                   MSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQDKSKSRVEKEKGHTVTQRETQRIE
FT                   SQTAKRGQRFQVSAATESRRFRSTTITVGLRMEDPVRERFERTPIIKTPEVVPSVAAEE
FT                   SHRGSEKIVDEQGDMDFQISPDRKTSTDFSEVIKQELEDNDKYQQFRLTEDTEKAQVHL
FT                   DQVITSPFNTAFPLDYMKDEFLPALSLQSGALGGSSESLKQEVIAGSPCGSLMEGTPQI
FT                   SSEESYKHEGLAETPETSPESLSFSPKKSEEQIGEAKETTKVGTPTDIHSEKELPITND
FT                   ITDSSQKQGAGVTRGSEPSTEHSQKEVTQDPPKDVCSKQDGCPESQSVSLASEVFTEKG
FT                   SCGESQLPLVSSACKTQSESETQESLTPSEVTKPFPPSDASVKTAEGTEPKPQGAIRSP
FT                   QGLELPLPNRDSEVLSPMADESLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPC
FT                   RDSLESSPVEPKMKAGILPSHFPLPTAIAKTDLVAEVASMRSRLLRDPDGSAEDDSLEQ
FT                   TSLMESSGKSPLSPDTPSSEEVSYEVTPKPSDSSTPKPAVIHECAEEDDSENGEKKRFT
FT                   PEEEMFKMVTKIKTFDELEQEAKQKRDYKKEPRQDGSSSASDPDADYSAEVNDEKQMAG
FT                   TEGEGEVPVLVTSENRKVSSSSSESEPELTQLSKGADSGLLTEPVIRVQPPSPLPSSID
FT                   SNSSPEEATQFQPIVPKQYTFKMNEEIQEEPATSEDKDCKSHLAEDSQTHSADAADGSD
FT                   GDLNRETTQPETCDGHGCETVSPSNSATPVSLGVQSPEHKDVDKPLAIDKDSLAHQDTC
FT                   ENDREEREFDPSGVESTQADLPNESSSLSSRCAIPEGNESAKEIASPSSPVKVEVTITD
FT                   QALESMPEDCPIQDSSTTMQTERFAMDVPVSELAETDENSDPQIISPYENVPSSSFFSA
FT                   EPSKIQTDTCHSTVVHSPEVYSVIIRSSPEDVVVTNSSNRTVSGEESHCESHDLETESE
FT                   QKSALWAAQSDAPPLAVAPTASDAASVTGEQASKVIITKTDADADSWSEIREDDAAFEA
FT                   RVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGA
FT                   IDMTKRPYADESLHFFQIGQESNEEAISEDLKEGATGAEPPQTETTSESLELSEPKEAM
FT                   DDEGELLPDDVSEEIEDLPASDANIDSQVIISASTETPTKEAVSTAVEEPPTTQRSDSL
FT                   STVKQTPRPAVPGPVGQLDFSPVTRSVYSGRDDESPESSPEEQKSVIEIPTAPVDNVPS
FT                   AESKPQIPIRTLPTLVPAPPSAEDESAFSDDFPSSLDEDSKEGGAKPKSKIPVKAPTQR
FT                   TEWQPSPTDIPLQKTAVPQGQETLSRAPDGRSKSESDASSLDAKTKCPVKARSYIETET
FT                   ESRERAEGFESESEDGATKPKLFASRLPVKSRSTSSSGRPGTSPTRESREHFFDLYRNS
FT                   IEFFEEISDEASKLVDRLTQSEREQEPPSDDESSSALEVSVIESLPPVDIEHSAPEDIF
FT                   DTRPIWDESIETMIERIPDENGHDRAEDPQDEQERMEERLAYIADHLGFSWTELARELD
FT                   FTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTILIECLTKINRMDIVHLLET
FT                   NTEPLQERMGRSYAEIEQTITLDHSEGFSVLPDELCAAKEKKEQEASKESESSDHPPMV
FT                   SEEDISVGYSTFQDCLPKTEGDSPAAALSPQMHQEPVQQDFSGKTQDQQEYYVTTPGAE
FT                   VEDPQKATAVPDSLCKTPEDISTPPEGTKPCLQTPVTSERGSPIVQEPEEASEPKEENS
FT                   PRKTSLVIVESTDDQSQVFERLDGDAAFQKGDDMPDIPPETVTEEEYVDENGHTVVKKV
FT                   TRKIIRRYVSSDGTEKEEVTMQGMPQEPVNIEDGDNYSKVIKRVVLKSDTQQSEVRPPS
FT                   SAEFIAQRKLKHRPNK"
FT   mRNA            complement(join(<13506526..13507221,13510151..13510172,
FT                   13511909..13511941,13512597..13512719,13514402..13514527,
FT                   13515288..13515516,13516673..13516769,13518322..13518526,
FT                   13519081..13519292,13521682..13521836,13524369..13524593,
FT                   13535467..13535570,13536260..13536362,13541223..13541367,
FT                   13547546..13547618,13557233..13557331,13558323..13558421,
FT                   13562125..13562223,13563393..13563491,13570297..13570494,
FT                   13572680..13572778,13576258..13576455,13582722..13582820,
FT                   13587641..13587739,13587897..13587995,13590537..13590734,
FT                   13597189..13597287,13605161..13605259,13606633..13606731,
FT                   13610685..13610708,13611138..13611323,13615422..13615520,
FT                   13643026..13643124,13645411..13645510,13673167..13673268,
FT                   13906609..13906669,13976048..>13976262))
FT                   /gene="Ank2"
FT                   /locus_tag="mCG_126687"
FT                   /product="ankyrin 2, brain, transcript variant mCT190583"
FT                   /note="gene_id=mCG126687.1 transcript_id=mCT190583.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<13506526..13507221,13510151..13510172,
FT                   13511909..13511941,13512597..13512719,13514402..13514527,
FT                   13515288..13515516,13516673..13516769,13518322..13518526,
FT                   13519081..13519292,13521682..13521836,13524369..13524593,
FT                   13535467..13535570,13536260..13536362,13541223..13541367,
FT                   13547546..13547618,13557233..13557331,13558323..13558421,
FT                   13562125..13562223,13563393..13563491,13570297..13570494,
FT                   13572680..13572778,13576258..13576455,13582722..13582820,
FT                   13587641..13587739,13587897..13587995,13590537..13590734,
FT                   13597189..13597287,13605161..13605259,13606633..13606731,
FT                   13610685..13610708,13611138..13611323,13615422..13615520,
FT                   13643026..13643124,13645411..13645510,13673167..>13673198))
FT                   /codon_start=1
FT                   /gene="Ank2"
FT                   /locus_tag="mCG_126687"
FT                   /product="ankyrin 2, brain, isoform CRA_a"
FT                   /note="gene_id=mCG126687.1 transcript_id=mCT190583.0
FT                   protein_id=mCP111543.0 isoform=CRA_a"
FT                   /protein_id="EDL12268.1"
FT                   /translation="KGALTSIPAIRMDSMLSTWQPRKAMWASCRSCWEEGPPWILPPRK
FT                   GNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN
FT                   QSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQN
FT                   DHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVA
FT                   SKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG
FT                   LSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP
FT                   NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL
FT                   LQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGK
FT                   TEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLH
FT                   VAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTK
FT                   QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGA
FT                   DRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIIN
FT                   VLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPE
FT                   TMTEVLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS
FT                   DSLRSFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLD
FT                   NVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRL
FT                   ATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWK
FT                   EHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIG
FT                   PEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEP
FT                   RRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLT
FT                   FVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEA
FT                   RLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIF
FT                   SFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYAKESE
FT                   SDQEPEEEIGMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTA
FT                   ILTTDVSDKAGSLKVKELAKAGEEEPGEPFEIVERVKEDLEKVNAILRSGTCMRDEGRA
FT                   RSSQSERELEEEWVIVSDEEIQEAKQHAPVEIDEHPCIEVRVDRETKAKVEKDSTGLVN
FT                   YLTDDLNSYTSPHEKKPHTAPEKSGETSQASAVGKSSESNKGKATSAEEKQSAQKQLKP
FT                   GLAIKKPVRRK"
FT   assembly_gap    13558055..13558268
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    13586654..13587192
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    13620952..13622078
FT                   /estimated_length=1127
FT                   /gap_type="unknown"
FT   assembly_gap    13625053..13625892
FT                   /estimated_length=840
FT                   /gap_type="unknown"
FT   assembly_gap    13628891..13628910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13632987..13636516
FT                   /estimated_length=3530
FT                   /gap_type="unknown"
FT   assembly_gap    13638047..13638066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13649855..13649874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13654799..13654818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13661172..13661276
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    13670556..13670665
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13685017..13685036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13687002..13687021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13705836..13705967
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            13725079..13731024
FT                   /locus_tag="mCG_1050978"
FT                   /note="gene_id=mCG1050978.0"
FT   mRNA            join(13725079..13725156,13725530..13725599,
FT                   13730003..13730197,13730549..13731024)
FT                   /locus_tag="mCG_1050978"
FT                   /product="mCG1050978"
FT                   /note="gene_id=mCG1050978.0 transcript_id=mCT194767.0
FT                   created on 27-JAN-2005"
FT   CDS             join(13730127..13730197,13730549..13730681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050978"
FT                   /product="mCG1050978"
FT                   /note="gene_id=mCG1050978.0 transcript_id=mCT194767.0
FT                   protein_id=mCP115796.0"
FT                   /protein_id="EDL12271.1"
FT                   /translation="MSKASLQPQSASRHERGACCGSDVDILCSKSNLSHGPHFMAVQFL
FT                   AAVLSLIKHRSRRSTRRYPCLS"
FT   assembly_gap    13730262..13730411
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    13732244..13732599
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    13742833..13742852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13753241..13753260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13756928..13759358
FT                   /estimated_length=2431
FT                   /gap_type="unknown"
FT   assembly_gap    13769477..13769961
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    13785130..13791536
FT                   /estimated_length=6407
FT                   /gap_type="unknown"
FT   assembly_gap    13802304..13802323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13803594..13803613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13805262..13805925
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    13821690..13821709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13828807..13828826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13831327..13834501
FT                   /locus_tag="mCG_147423"
FT                   /note="gene_id=mCG147423.0"
FT   mRNA            join(13831327..13831845,13831987..13834501)
FT                   /locus_tag="mCG_147423"
FT                   /product="mCG147423"
FT                   /note="gene_id=mCG147423.0 transcript_id=mCT187686.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    13831851..13831980
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   CDS             13833969..13834403
FT                   /codon_start=1
FT                   /locus_tag="mCG_147423"
FT                   /product="mCG147423"
FT                   /note="gene_id=mCG147423.0 transcript_id=mCT187686.0
FT                   protein_id=mCP109647.0"
FT                   /protein_id="EDL12270.1"
FT                   /translation="MSLVTLYSTVWPLQVMSRLVSILLSKAQLDLFSLGLFVSIFFLFI
FT                   SLGCFVLFLSQLSYISLFCPGYPQTHSVGQAGLIEIHLPLPLTCWTKGIHYQDGHLSPP
FT                   QRRFSMVILNLVKVTVKINHDKDPITGPIKSLYFESMESL"
FT   assembly_gap    13849519..13849538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13851113..13851132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13856259..13856278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13862660..13863014
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    13864171..13864190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13865275..13865294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13866516..13867496
FT                   /estimated_length=981
FT                   /gap_type="unknown"
FT   assembly_gap    13925215..13926106
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   assembly_gap    13928295..13929357
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   assembly_gap    13935334..13937956
FT                   /estimated_length=2623
FT                   /gap_type="unknown"
FT   assembly_gap    13953350..13953484
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    13960846..13960865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13971139..13971542
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    13982311..13982330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13985914..13985933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13988611..13988630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13988657..>13990030)
FT                   /locus_tag="mCG_55270"
FT                   /note="gene_id=mCG55270.2"
FT   mRNA            complement(13988657..>13990030)
FT                   /locus_tag="mCG_55270"
FT                   /product="mCG55270"
FT                   /note="gene_id=mCG55270.2 transcript_id=mCT55453.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(13988835..>13989581)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55270"
FT                   /product="mCG55270"
FT                   /note="gene_id=mCG55270.2 transcript_id=mCT55453.2
FT                   protein_id=mCP39674.2"
FT                   /protein_id="EDL12267.1"
FT                   /translation="WAVSVPRSNYSSWTRYWDMMQSLATGCSSSSSLKEHLEDTTEKNE
FT                   ALLGELFSSPNLRAILKPESDPWPLDMQSSLNKQSDDLPKADPSAQSEGEKVADLARQL
FT                   QESATKLQTLRDQCFAQHKAGTDTSTIDQKLRLVISDFYQLILAFLQVYDDELRECCQR
FT                   PVPSLHPSGPIIQAVYQTLASCGQLLRAVMEIADTSAEAMKAARKQEGEPNCWSSNNSG
FT                   ISLAARIDEVTQKYKILTDRFHRGTR"
FT   assembly_gap    13994591..13995784
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    13998392..13999929
FT                   /estimated_length=1538
FT                   /gap_type="unknown"
FT   assembly_gap    14002247..14002601
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    14007367..14007386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14008829..14008848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14010132..14010151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14011502..14011521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14013577..14013596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14015326..14015534
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    14018211..14018230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14029176..14029670
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    14036986..14037005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14039032..14046039
FT                   /estimated_length=7008
FT                   /gap_type="unknown"
FT   assembly_gap    14047749..14047768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14049908..14053597
FT                   /estimated_length=3690
FT                   /gap_type="unknown"
FT   assembly_gap    14054924..14054943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14070986..14071005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14077432..14078141
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    14085167..14085186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14085633..14085663
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    14094776..14094817
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14097066..14100205
FT                   /estimated_length=3140
FT                   /gap_type="unknown"
FT   assembly_gap    14103350..14103369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14104990..14105009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14106030..14106049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14107056..14107075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14108220..14108239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14110333..14110980
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   gene            complement(14113143..>14132574)
FT                   /gene="Larp7"
FT                   /locus_tag="mCG_20251"
FT                   /note="gene_id=mCG20251.2"
FT   mRNA            complement(join(14113143..14113461,14116972..14117063,
FT                   14117226..14117385,14119460..14119584,14120580..14120704,
FT                   14122257..14122404,14122481..14122637,14122890..14123089,
FT                   14123162..14123255,14123340..14123504,14123607..14123690,
FT                   14123776..14123877,14124050..14124234,14132409..>14132574))
FT                   /gene="Larp7"
FT                   /locus_tag="mCG_20251"
FT                   /product="La ribonucleoprotein domain family, member 7,
FT                   transcript variant mCT19555"
FT                   /note="gene_id=mCG20251.2 transcript_id=mCT19555.2 created
FT                   on 11-APR-2003"
FT   mRNA            complement(join(14113143..14113461,14116972..14117063,
FT                   14117226..14117385,14119460..14119584,14120580..14120704,
FT                   14124636..14124783,14124860..14125216,14125290..14125380,
FT                   14125464..14125628,14125735..14125819,14125905..14126005,
FT                   14126178..14126365,14132409..>14132574))
FT                   /gene="Larp7"
FT                   /locus_tag="mCG_20251"
FT                   /product="La ribonucleoprotein domain family, member 7,
FT                   transcript variant mCT181771"
FT                   /note="gene_id=mCG20251.2 transcript_id=mCT181771.0 created
FT                   on 11-APR-2003"
FT   CDS             complement(join(14113381..14113461,14116972..14117063,
FT                   14117226..14117385,14119460..14119584,14120580..14120704,
FT                   14124636..14124783,14124860..14125216,14125290..14125380,
FT                   14125464..14125628,14125735..>14125788))
FT                   /codon_start=1
FT                   /gene="Larp7"
FT                   /locus_tag="mCG_20251"
FT                   /product="La ribonucleoprotein domain family, member 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20251.2 transcript_id=mCT181771.0
FT                   protein_id=mCP104693.0 isoform=CRA_b"
FT                   /protein_id="EDL12266.1"
FT                   /translation="KNPLGERPKDEEERTVYVELLPKNVTHSWIERVFGKCGNVVYISI
FT                   PHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLQAE
FT                   EKKKKKKKKGRIKKEESVQAKESAVDSSSSGLCKATKRPRTASEGSEAETPEAPKQPAK
FT                   KKKKRDKVEASSLPEARSGKRERCSAEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESR
FT                   DLEFCSTEEEKETGDRKGDSLSKVKRKHKKKHKERHKMGEEVIPLRVLSKTEWMDLKKE
FT                   YLALQKASMASLKKTISQIKLESEMETDCKAPTAGSGQECSTQEKVSAQGPQFVTGVIV
FT                   KIVSGEPLPGRKQVKDILATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKK
FT                   HSWNLEVLSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASQH
FT                   IRFSEYD"
FT   CDS             complement(join(14113381..14113461,14116972..14117063,
FT                   14117226..14117385,14119460..14119584,14120580..14120704,
FT                   14122257..14122404,14122481..14122637,14122890..14123089,
FT                   14123162..14123255,14123340..14123504,14123607..14123690,
FT                   14123776..>14123844))
FT                   /codon_start=1
FT                   /gene="Larp7"
FT                   /locus_tag="mCG_20251"
FT                   /product="La ribonucleoprotein domain family, member 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20251.2 transcript_id=mCT19555.2
FT                   protein_id=mCP19231.2 isoform=CRA_a"
FT                   /protein_id="EDL12265.1"
FT                   /translation="KMKKLTTDGKLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEE
FT                   ERTVYVELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKA
FT                   IEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKEESVQAKESAV
FT                   DSSSSGVCKATKRPRTASEGSEAETPEAPKQPAKKKKKRDKVEASSLPEARSGKRERCS
FT                   AEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESRDLEFCSTEEEKETGDRKGDSLSKVK
FT                   RKHKKKHKERHKMGEEVIPLRVLSKTEWMDLKKEYLALQKASMASLKKTISQIKLESEM
FT                   ETDCKAPTAGSGQECSTQEKVSAQGPQFVTGVIVKIVSGEPLPGRKQVKDILATISEVV
FT                   YIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKKHSWNLEVLSGDHEQRYWQKILVDRQ
FT                   AKLNQPREKKRGTEKLITKAEKIRLAKTQQASQHIRFSEYD"
FT   assembly_gap    14122836..14122855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14124530..14124549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14126523..14130549
FT                   /estimated_length=4027
FT                   /gap_type="unknown"
FT   gene            <14135428..>14167882
FT                   /locus_tag="mCG_55823"
FT                   /note="gene_id=mCG55823.2"
FT   mRNA            join(<14135428..14135508,14138810..14138869,
FT                   14140133..14140318,14140713..14142456,14147044..14147117,
FT                   14152557..14152742,14160520..14160643,14162784..14163370,
FT                   14163856..14163994,14165758..14165918,14167678..>14167882)
FT                   /locus_tag="mCG_55823"
FT                   /product="mCG55823"
FT                   /note="gene_id=mCG55823.2 transcript_id=mCT56006.2 created
FT                   on 23-OCT-2002"
FT   CDS             join(<14135428..14135508,14138810..14138869,
FT                   14140133..14140318,14140713..14142456,14147044..14147117,
FT                   14152557..14152742,14160520..14160643,14162784..14163370,
FT                   14163856..14163994,14165758..14165918,14167678..>14167882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55823"
FT                   /product="mCG55823"
FT                   /note="gene_id=mCG55823.2 transcript_id=mCT56006.2
FT                   protein_id=mCP39685.2"
FT                   /protein_id="EDL12264.1"
FT                   /translation="VLYTHQKMKKSKVWQDGVLKITHLGNKAILYDDKGACLESLFLKC
FT                   LEVKPGDDLESERYLITVEEAKAVGSRAVEPDGSREALESGPRTLVSSSRSLGCQPSGL
FT                   KRKATGFQRPYKMPKKVTITENSEPAASLGDENPGPPGPRLLPTFSSTLPLFPTVGQKD
FT                   LTPVSADNQSPITFSNRERSDTPLSLPSSYFKINTNTLGKEDKLCFPVSSETKHSDSLL
FT                   ASEPMRRNGLDSHCPGVSQNVRSKAQILALLKSSSTNRKDLHGEIPGHFPKIEPQGCLN
FT                   IISKPEEDYAETQSIGNLRCEQQSENPTRTTSRWARYLPSQRSPPCSAADENDTEDKPE
FT                   AQEDVNIFNLSELLQKKSELFETCSKKGELHSEDKPVDNTCQYWNQEDNLAPSFCKNSS
FT                   VLVSCSSKENASLLSESDIQYSSKVPVNQHEKVWTREGSQGADADAALELEYRPVSPLP
FT                   EIGHKQTEVEASLSTSSRISDDIADMGPKSNADTEDLKTVHKAVQPFLEVSFNLSNFET
FT                   SDTDEASQEDSRLSQDSERWEKEAVLTDDSCVQKSCEDIGCREIAGKLPLLSSTDDEPK
FT                   EALPADGTLLSEFCDRTCVGFNSGPHGDVKTGKALEGQCHSDTGSSLDSSLEWSEDVAG
FT                   DSRADASQSIQGNAINCGGVSPSKKPRGVNRSLHSPYLLTAVTDPAPENSDLLSEARKS
FT                   PAIEVSRVLLECPREHRASQHPVEFQGHQVKGSATSGVMVRGHSLQRGCTQFPDSIDYE
FT                   NFLTDTCVWTPGLPSTYGQTDFLQVISPEQKIPALSPAPTFSFNTRNEDTVLEFSEESL
FT                   KTRTLPGLKNIGFQDSKNLQRFPFLSGASVPFATLPPDDGPAVLDPCSFMIDDDSGEPS
FT                   GSSMLNLCEESGLSFDLGLEGQGGTPGGVSLLPKSSTQSKWLKYQNPPQYNSTAPNRLA
FT                   SEVTEGLFAEAVSGLHFSHTSESESSVDPVRLQMIKGLLHQQQQDLVSRKQAFSLTLNQ
FT                   TCKTQEHETVLGSSASKNCRAKDLQEINNSDLCFPNGQKIISAYLPQRQVHIPAVFQSP
FT                   AHYRQVFTASIIEHLNILLFELAQRLYKALSKVDISFYTSSKGETMRSGKNNSPSCHHN
FT                   QPAKLVMGRLFYTCDKSKDNQCKFFKWLEEVTPGQLPQNTSQSTMVFNDIKSIGSYLRS
FT                   QKVPVYEECQLLLRYV"
FT   assembly_gap    14144677..14144696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14154635..14154822
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    14159064..14159178
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    14161114..14161766
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    14164780..14164799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14170395..14171335
FT                   /estimated_length=941
FT                   /gap_type="unknown"
FT   assembly_gap    14172475..14172494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14174332..14175148
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    14176243..14176262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14178103..14178122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14178567..>14183500
FT                   /locus_tag="mCG_1050977"
FT                   /note="gene_id=mCG1050977.0"
FT   mRNA            join(14178567..14178849,14181183..14181297,
FT                   14183464..>14183500)
FT                   /locus_tag="mCG_1050977"
FT                   /product="mCG1050977"
FT                   /note="gene_id=mCG1050977.0 transcript_id=mCT194766.0
FT                   created on 27-JAN-2005"
FT   CDS             join(14178690..14178849,14181183..14181297,
FT                   14183464..>14183500)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050977"
FT                   /product="mCG1050977"
FT                   /note="gene_id=mCG1050977.0 transcript_id=mCT194766.0
FT                   protein_id=mCP115795.0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C776"
FT                   /protein_id="EDL12263.1"
FT                   /translation="MFVLPGDLWVISKTLDFELDTFIACSAFFGPSSVNEVELLPLKGY
FT                   FPSNWPTNITVHALLVCNASTELTTLQNIQDYFNPAALPLMPYLLAMSQSATVSSKNIS
FT                   "
FT   assembly_gap    14179191..14179210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14184023..14190045
FT                   /estimated_length=6023
FT                   /gap_type="unknown"
FT   gene            14190143..14194833
FT                   /locus_tag="mCG_20248"
FT                   /note="gene_id=mCG20248.2"
FT   mRNA            join(14190143..14190273,14191934..14192110,
FT                   14192244..14192378,14193070..14193331,14193478..14194833)
FT                   /locus_tag="mCG_20248"
FT                   /product="mCG20248"
FT                   /note="gene_id=mCG20248.2 transcript_id=mCT19552.2 created
FT                   on 23-OCT-2002"
FT   CDS             join(14190271..14190273,14191934..14192110,
FT                   14192244..14192378,14193070..14193331,14193478..14193614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20248"
FT                   /product="mCG20248"
FT                   /note="gene_id=mCG20248.2 transcript_id=mCT19552.2
FT                   protein_id=mCP19212.2"
FT                   /protein_id="EDL12262.1"
FT                   /translation="MGHKPVLLRTQYRCHPAISAIANDLFYEGSLVNGISERERSPVLE
FT                   WLPTLCFYNVTGAEQVERENSFVNVAEATFTLKLIQSLMASGVESCMIGVITLYKSQMY
FT                   KICNLLSAVDVGHPDVKAVQVSTVDAFQGAEKEITILSCVRTRQVGFIDSEKRMNVALT
FT                   RGRRHLLIVGSLSCLRKNRLWGRVIQHCEGREDGLQHASQCEPQLDHLLKDYLEKQAEE
FT                   KQKKKEKEKSKDKSH"
FT   assembly_gap    14195545..14195666
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    14196696..14196715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14199764..14199915
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            14210422..14212256
FT                   /gene="Neurog2"
FT                   /locus_tag="mCG_20249"
FT                   /note="gene_id=mCG20249.2"
FT   mRNA            join(14210422..14210504,14210775..14212256)
FT                   /gene="Neurog2"
FT                   /locus_tag="mCG_20249"
FT                   /product="neurogenin 2"
FT                   /note="gene_id=mCG20249.2 transcript_id=mCT19553.1 created
FT                   on 25-JUL-2002"
FT   CDS             14210776..14211567
FT                   /codon_start=1
FT                   /gene="Neurog2"
FT                   /locus_tag="mCG_20249"
FT                   /product="neurogenin 2"
FT                   /note="gene_id=mCG20249.2 transcript_id=mCT19553.1
FT                   protein_id=mCP19210.1"
FT                   /db_xref="GOA:Q6GTH9"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:109619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GTH9"
FT                   /protein_id="EDL12261.1"
FT                   /translation="MFVKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEEL
FT                   RRPGSARGQRGAEAGQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAE
FT                   TVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWA
FT                   LTETLRLADHCAGAGGLQGALFTEAVLLSPGAALGASGDSPSPPSSWSCTNSPASSSNS
FT                   TSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI"
FT   assembly_gap    14216914..14216979
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    14222050..14222069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14224411..14224541
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    14225801..14226058
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   gene            complement(<14248457..14369540)
FT                   /locus_tag="mCG_20250"
FT                   /note="gene_id=mCG20250.2"
FT   mRNA            complement(join(<14248457..14248656,14249884..14250070,
FT                   14250845..14251007,14254856..14255009,14256509..14258600,
FT                   14260700..14260804,14261534..14261629,14262430..14262506,
FT                   14263418..14263504,14264773..14264832,14272159..14272357,
FT                   14314854..14315008,14321587..14321817,14369187..14369540))
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, transcript variant mCT19554"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT19554.2 created
FT                   on 02-JUN-2003"
FT   CDS             complement(join(14248457..14248656,14249884..14250070,
FT                   14250845..14251007,14254856..14255009,14256509..14258600,
FT                   14260700..14260804,14261534..14261629,14262430..14262506,
FT                   14263418..14263504,14264773..14264832,14272159..14272357,
FT                   14314854..14315008,14321587..14321707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, isoform CRA_c"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT19554.2
FT                   protein_id=mCP19227.2 isoform=CRA_c"
FT                   /protein_id="EDL12260.1"
FT                   /translation="MNNQDAVASILHECKQVLDRLLLETPDVSTEDKSEDQRCRASLPS
FT                   ELRTLIQEAEEMKWPFVPEKWQYKQAMSPEDKTNLQDVIGAGLQQLLAALRASILVQDC
FT                   AAASAIVFLMDRFLYGLDVSGKLLQVAKGLHKLKPATPIAPQVVIRQARVSVNSGKLLK
FT                   AEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASVI
FT                   GYLTLPQPDKKGISTSLGILADIFVSMSKTDYEKFKKSPKVNLALLKEFDHHLLSAAEA
FT                   CKLAAAFSAYTPLFVLRAVNIRGTCLLSYSCSADCPPGMKSVHLCEAKEAFEIGLLTKK
FT                   DGELVSGKQELHSFIKAAFGLTTVHSRLHGETDAVRAARQLCSEAVGKLYTFSTSPTSQ
FT                   DREGLSQEIMSLISQVKGHLRVQSFPNLDACSYVPESFKCGLDRLILHGHVDFQQILET
FT                   YSQHHTSVCEVFESTCGNSKSNQRDTKSEVCITTLKTETNTADTMVATLERVSSQDSRS
FT                   TASSKMSKKDQGKLQRERGRSWTRSKAFRVSLDLDMETETEPPNHSNGGTDVFNKSLRD
FT                   NSSSCSWGRLSGLSSSTSWEEVNCAVQDVVRKGSGQEKHPVEAQSSEAVSEEPKRNRSS
FT                   RAVFLSSKLRGVSLQTTGDDNLESSPSQLHNHTSILPFNAKDTCLASGAGLVETAEGSN
FT                   NTSLQSSHSCGSDSWSLSSSDRFTDVTTNPSVQEEEPSGIMGDVPESKYDCKDWHGEKN
FT                   GGTLAEICTGPELTSAPSSVDPEGETAESTDDGLSPSQVALGCLEGSHSMSTRRTFFPD
FT                   GSVQNADSAKTGCSVRDQTVDPDASTVDEEGQMLDSTEICSIGQDGAHRPRALRSGQSA
FT                   EGPKSFVNGSSPSPIFDEDFSTTEEGEELGSMLKSSQNSSSYSPWWLKSPAFSRSSSDG
FT                   ESSWSLLNSSRSSFASLAGQTSQEILEARTLQPDDLEKLLAGVRHDWLLQRLENTGVLK
FT                   SNQLQQAHSALLLKYSKKSELWTAQETVVYLGDYLKVKKKGKQRNAFWVHYLHQEETLG
FT                   RYVGKEYKERKGLRHHFTDVERQMTAQHYVTEFNKRLYEQKIPTQIFYVPSTILLILED
FT                   RTIKGCISVEPYILGEFVKLSNNTKVVKNEYKATEYGLAYGHFSYEFSNHRDVVVDLQG
FT                   WVTGNGKGLIYLTDPQIHSVDQKDVTTNFGKRGIFYFFNNQHASCNEICHRLSLTRPSL
FT                   EQTSKV"
FT   assembly_gap    14252942..14253058
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    14253644..14253806
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    14258754..14258856
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   mRNA            complement(join(14263083..14263504,14264773..14264832,
FT                   14272159..14272357,14314854..14315008,14321587..14321817,
FT                   14369187..14369540))
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, transcript variant mCT185209"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT185209.0 created
FT                   on 02-JUN-2003"
FT   CDS             complement(join(14263407..14263504,14264773..14264832,
FT                   14272159..14272357,14314854..14315008,14321587..14321707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, isoform CRA_a"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT185209.0
FT                   protein_id=mCP106467.0 isoform=CRA_a"
FT                   /protein_id="EDL12258.1"
FT                   /translation="MNNQDAVASILHECKQVLDRLLLETPDVSTEDKSEDQRCRASLPS
FT                   ELRTLIQEAEEMKWPFVPEKWQYKQAMSPEDKTNLQDVIGAGLQQLLAALRASILVQDC
FT                   AAASAIVFLMDRFLYGLDVSGKLLQVAKGLHKLKPATPIAPQVVIRQARVSVNSGKLLK
FT                   AEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGTD"
FT   gene            complement(14268409..14269115)
FT                   /pseudo
FT                   /locus_tag="mCG_126684"
FT                   /note="gene_id=mCG126684.1"
FT   mRNA            complement(14268409..14269115)
FT                   /pseudo
FT                   /locus_tag="mCG_126684"
FT                   /note="gene_id=mCG126684.1 transcript_id=mCT127957.1
FT                   created on 02-JUN-2003"
FT   assembly_gap    14274649..14274668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14275854..14276226
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    14277229..14277248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14279047..14279066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14285048..14285067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14286069..14286088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14292258..14292277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14303432..14303451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14305184..14305203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14307382..14312739
FT                   /estimated_length=5358
FT                   /gap_type="unknown"
FT   mRNA            complement(join(14314764..14315008,14321587..14321817,
FT                   14369187..14369540))
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, transcript variant mCT185210"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT185210.0 created
FT                   on 02-JUN-2003"
FT   CDS             complement(join(14314794..14315008,14321587..14321707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20250"
FT                   /product="mCG20250, isoform CRA_b"
FT                   /note="gene_id=mCG20250.2 transcript_id=mCT185210.0
FT                   protein_id=mCP106468.0 isoform=CRA_b"
FT                   /protein_id="EDL12259.1"
FT                   /translation="MNNQDAVASILHECKQVLDRLLLETPDVSTEDKSEDQRCRASLPS
FT                   ELRTLIQEAEEMKWPFVPEKWQYKQAMSPEDKTNLQDVIGAGLQQLLVGRIPPPVPLTS
FT                   PREAFRV"
FT   assembly_gap    14317618..14317637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14319003..14319022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14331678..14331697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14333346..14333365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14339746..14340175
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    14348579..14348598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14358166..14358185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14359416..14359435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14376778..14376797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14379022..14387482
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /note="gene_id=mCG52165.2"
FT   mRNA            join(14379022..14379159,14380556..14380619,
FT                   14385667..14387482)
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, transcript variant
FT                   mCT174970"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT174970.0 created
FT                   on 23-OCT-2002"
FT   mRNA            join(14379022..14379159,14385667..14387482)
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, transcript variant
FT                   mCT52348"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT52348.2 created
FT                   on 23-OCT-2002"
FT   assembly_gap    14379160..14379383
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   mRNA            join(14380483..14380619,14385667..14387482)
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, transcript variant
FT                   mCT174969"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT174969.0 created
FT                   on 23-OCT-2002"
FT   CDS             14385680..14386234
FT                   /codon_start=1
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT174969.0
FT                   protein_id=mCP97888.0 isoform=CRA_a"
FT                   /db_xref="GOA:I3PQW8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="MGI:MGI:2182965"
FT                   /db_xref="UniProtKB/TrEMBL:I3PQW8"
FT                   /protein_id="EDL12255.1"
FT                   /translation="MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIE
FT                   VVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELG
FT                   YLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPED
FT                   GMYSSYFTHRSSPSEMDENEL"
FT   CDS             14385680..14386234
FT                   /codon_start=1
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT174970.0
FT                   protein_id=mCP97889.0 isoform=CRA_a"
FT                   /db_xref="GOA:I3PQW8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="MGI:MGI:2182965"
FT                   /db_xref="UniProtKB/TrEMBL:I3PQW8"
FT                   /protein_id="EDL12256.1"
FT                   /translation="MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIE
FT                   VVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELG
FT                   YLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPED
FT                   GMYSSYFTHRSSPSEMDENEL"
FT   CDS             14385680..14386234
FT                   /codon_start=1
FT                   /gene="T2bp"
FT                   /locus_tag="mCG_52165"
FT                   /product="Traf2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG52165.2 transcript_id=mCT52348.2
FT                   protein_id=mCP39662.2 isoform=CRA_a"
FT                   /db_xref="GOA:I3PQW8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="MGI:MGI:2182965"
FT                   /db_xref="UniProtKB/TrEMBL:I3PQW8"
FT                   /protein_id="EDL12257.1"
FT                   /translation="MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIE
FT                   VVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELG
FT                   YLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPED
FT                   GMYSSYFTHRSSPSEMDENEL"
FT   assembly_gap    14391311..14391382
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(14397209..>14426215)
FT                   /locus_tag="mCG_49853"
FT                   /note="gene_id=mCG49853.2"
FT   mRNA            complement(join(14397209..14397918,14401390..14401518,
FT                   14401708..14401781,14402422..14402477,14406277..14406373,
FT                   14410121..14410146,14411945..14411971,14412625..14412673,
FT                   14426157..>14426215))
FT                   /locus_tag="mCG_49853"
FT                   /product="mCG49853, transcript variant mCT174968"
FT                   /note="gene_id=mCG49853.2 transcript_id=mCT174968.0 created
FT                   on 23-OCT-2002"
FT   mRNA            complement(join(14397209..14397918,14401390..14401518,
FT                   14401708..14401781,14402422..14402477,14404954..14405052,
FT                   14406277..14406373,14410121..14410146,14411945..14411971,
FT                   14412625..14412673,14426157..>14426215))
FT                   /locus_tag="mCG_49853"
FT                   /product="mCG49853, transcript variant mCT50036"
FT                   /note="gene_id=mCG49853.2 transcript_id=mCT50036.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(join(14397656..14397918,14401390..14401518,
FT                   14401708..14401781,14402422..14402477,14406277..14406373,
FT                   14410121..14410146,14411945..14411971,14412625..14412673,
FT                   14426157..>14426215))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49853"
FT                   /product="mCG49853, isoform CRA_a"
FT                   /note="gene_id=mCG49853.2 transcript_id=mCT174968.0
FT                   protein_id=mCP97887.0 isoform=CRA_a"
FT                   /protein_id="EDL12253.1"
FT                   /translation="TQCFGLLRREAGRLQRAGGGSKYFRTCPRGEHLTIEFENLVESDE
FT                   GESPGSSHRPLTEDEIADLQERHYDSIAEKQKDVDRKIQRQQEKQRVAQHYHCSSGDYQ
FT                   SAGPEDDFESSLRNIKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTS
FT                   LDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSSKKGSNPTSASDDSNGLEWENDFV
FT                   SAEMDDNGNSEYSGFVNPVLELSDSAIKQSDTDQQIR"
FT   CDS             complement(join(14397656..14397918,14401390..14401518,
FT                   14401708..14401781,14402422..14402477,14404954..14405052,
FT                   14406277..14406373,14410121..14410146,14411945..14411971,
FT                   14412625..14412673,14426157..>14426215))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49853"
FT                   /product="mCG49853, isoform CRA_b"
FT                   /note="gene_id=mCG49853.2 transcript_id=mCT50036.2
FT                   protein_id=mCP39651.2 isoform=CRA_b"
FT                   /protein_id="EDL12254.1"
FT                   /translation="TQCFGLLRREAGRLQRAGGGSKYFRTCPRGEHLTIEFENLVESDE
FT                   GESPGSSHRPLTEDEIADLQERHYDSIAEKQKDVDRKIQRQLALQEEKLRLEEEALYAA
FT                   QREAARAARQRKLLEQEKQRVAQHYHCSSGDYQSAGPEDDFESSLRNIKSQYEVFRSSR
FT                   LSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEED
FT                   ILRAALKYSSKKGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSA
FT                   IKQSDTDQQIR"
FT   assembly_gap    14403446..14404192
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    14426216..14426470
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    14432318..14432337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14443124..14443143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14450418..14454248
FT                   /locus_tag="mCG_147416"
FT                   /note="gene_id=mCG147416.0"
FT   mRNA            join(14450418..14450472,14452731..14454248)
FT                   /locus_tag="mCG_147416"
FT                   /product="mCG147416"
FT                   /note="gene_id=mCG147416.0 transcript_id=mCT187679.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    14450977..14451150
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   CDS             14453252..14453356
FT                   /codon_start=1
FT                   /locus_tag="mCG_147416"
FT                   /product="mCG147416"
FT                   /note="gene_id=mCG147416.0 transcript_id=mCT187679.0
FT                   protein_id=mCP109641.0"
FT                   /protein_id="EDL12252.1"
FT                   /translation="MRSRTDPVLCVLIFPLRLKTLYLQLLADNLQSSV"
FT   gene            complement(14458797..14485689)
FT                   /gene="5730508B09Rik"
FT                   /locus_tag="mCG_147411"
FT                   /note="gene_id=mCG147411.0"
FT   mRNA            complement(join(14458797..14459986,14485436..14485689))
FT                   /gene="5730508B09Rik"
FT                   /locus_tag="mCG_147411"
FT                   /product="RIKEN cDNA 5730508B09"
FT                   /note="gene_id=mCG147411.0 transcript_id=mCT187674.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(14459741..14459986,14485436..14485585))
FT                   /codon_start=1
FT                   /gene="5730508B09Rik"
FT                   /locus_tag="mCG_147411"
FT                   /product="RIKEN cDNA 5730508B09"
FT                   /note="gene_id=mCG147411.0 transcript_id=mCT187674.0
FT                   protein_id=mCP109636.0"
FT                   /db_xref="InterPro:IPR027953"
FT                   /db_xref="UniProtKB/TrEMBL:I3PQX0"
FT                   /protein_id="EDL12251.1"
FT                   /translation="MCSARKLLRGGAGSAGGECDEDGAAPAGRVEEPDHGASPRRRRPQ
FT                   DEGEQDIEEPQNHSGEPIGDDYKKMGTLFGELNKNLLNMGFTRMYFGERIVEPVVVLFF
FT                   WLMLWFLGLQALGLVAVLCLVIIYVQQ"
FT   assembly_gap    14473211..14474239
FT                   /estimated_length=1029
FT                   /gap_type="unknown"
FT   assembly_gap    14489953..14489972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14493784..14493874
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    14497120..14497139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14505844..14552173
FT                   /locus_tag="mCG_145188"
FT                   /note="gene_id=mCG145188.0"
FT   mRNA            join(<14505844..14505961,14516362..14516489,
FT                   14517588..14517735,14540407..14540631,14548590..14552173)
FT                   /locus_tag="mCG_145188"
FT                   /product="mCG145188"
FT                   /note="gene_id=mCG145188.0 transcript_id=mCT184612.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    14509346..14510432
FT                   /estimated_length=1087
FT                   /gap_type="unknown"
FT   assembly_gap    14512311..14512330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14513821..14513840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14516594..14516613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14518979..14518998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14521866..14521885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14524838..14524857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14533547..14533566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14538547..14538566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14541855..14541874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14545634..14545653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14546755..14546774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <14550576..14550893
FT                   /codon_start=1
FT                   /locus_tag="mCG_145188"
FT                   /product="mCG145188"
FT                   /note="gene_id=mCG145188.0 transcript_id=mCT184612.0
FT                   protein_id=mCP106181.0"
FT                   /protein_id="EDL12250.1"
FT                   /translation="QVLVRMRGTRNPHALLVRMQTGTTTMEISVIVPQETRNRPRNITK
FT                   QYHAWAHSKDSISCYRDTCSSIFIVALFTIAKAWSLHRYRLDDTWIMGMWRLYVMECIY
FT                   L"
FT   assembly_gap    14553418..14553697
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    14557211..14557321
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    14558646..14558871
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    14561638..14562830
FT                   /estimated_length=1193
FT                   /gap_type="unknown"
FT   assembly_gap    14566951..14567998
FT                   /estimated_length=1048
FT                   /gap_type="unknown"
FT   assembly_gap    14569487..14569506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14571155..14571174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14575585..14575939
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    14588111..14588130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14589333..14589352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14590124..14590143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14603025..14603044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14606140..14606323
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    14625790..14626028
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    14638917..14640726
FT                   /estimated_length=1810
FT                   /gap_type="unknown"
FT   assembly_gap    14660169..14660365
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    14687793..14691392
FT                   /estimated_length=3600
FT                   /gap_type="unknown"
FT   assembly_gap    14692431..14692450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14695619..14695704
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    14707723..14707896
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    14709103..14709256
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   gene            complement(14723268..>14832302)
FT                   /locus_tag="mCG_145185"
FT                   /note="gene_id=mCG145185.0"
FT   mRNA            complement(join(14723268..14724786,14730443..14730644,
FT                   14730862..14730996,14749338..14749452,14812378..14812465,
FT                   14832015..>14832302))
FT                   /locus_tag="mCG_145185"
FT                   /product="mCG145185"
FT                   /note="gene_id=mCG145185.0 transcript_id=mCT184609.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(14723339..>14723620)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145185"
FT                   /product="mCG145185"
FT                   /note="gene_id=mCG145185.0 transcript_id=mCT184609.0
FT                   protein_id=mCP106182.0"
FT                   /protein_id="EDL12249.1"
FT                   /translation="LPRIRVSFKKMSRKQLDFCSRSQQFFLNVWTNFTLFFESSNISMV
FT                   KMSPSPLNHTVYSEASSLFSSIVLTKCHKQTSDFKRTKRLKRPVNGNA"
FT   assembly_gap    14773089..14773108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14780130..14780149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14785261..14785280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14826449..14826900
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    14848380..14848399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14855509..14855528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14860765..14860784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14881208..14881644)
FT                   /pseudo
FT                   /locus_tag="mCG_51528"
FT                   /note="gene_id=mCG51528.1"
FT   mRNA            complement(14881208..14881644)
FT                   /pseudo
FT                   /locus_tag="mCG_51528"
FT                   /note="gene_id=mCG51528.1 transcript_id=mCT51711.1 created
FT                   on 29-OCT-2002"
FT   assembly_gap    14933058..14933077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14961408..14961427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14965576..14965595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14970219..14970238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14993563..14993582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14994687..14994706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15019598..15019687
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    15038561..15038580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15044226..15048182
FT                   /estimated_length=3957
FT                   /gap_type="unknown"
FT   assembly_gap    15062214..15062294
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    15077250..15077269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15195640..15195676
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    15207477..15207496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <15215152..15480393
FT                   /locus_tag="mCG_1045662"
FT                   /note="gene_id=mCG1045662.1"
FT   mRNA            join(<15215152..15215287,15236234..15236423,
FT                   15350182..15350447,15356084..15356153,15478467..15480393)
FT                   /locus_tag="mCG_1045662"
FT                   /product="mCG1045662"
FT                   /note="gene_id=mCG1045662.1 transcript_id=mCT163366.1
FT                   created on 11-MAR-2003"
FT   CDS             join(<15215154..15215287,15236234..15236312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045662"
FT                   /product="mCG1045662"
FT                   /note="gene_id=mCG1045662.1 transcript_id=mCT163366.1
FT                   protein_id=mCP89329.1"
FT                   /protein_id="EDL12248.1"
FT                   /translation="PSVLKTQQETIRDSSSKRDRIICKLQASKVRCDWSSSIPMTFGKR
FT                   ILRGKRSEIFCWRGYFPFKKHSFAS"
FT   assembly_gap    15238356..15238375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15241796..15242117
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    15244844..15245938
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   assembly_gap    15255140..15258587
FT                   /estimated_length=3448
FT                   /gap_type="unknown"
FT   assembly_gap    15338151..15338192
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    15344536..15344758
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    15354652..15354671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15361592..15361814
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    15373486..15375451
FT                   /estimated_length=1966
FT                   /gap_type="unknown"
FT   assembly_gap    15387896..15387976
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    15399537..15399556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15414237..15414256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15433018..15433698
FT                   /pseudo
FT                   /locus_tag="mCG_1045587"
FT                   /note="gene_id=mCG1045587.1"
FT   mRNA            15433018..15433698
FT                   /pseudo
FT                   /locus_tag="mCG_1045587"
FT                   /note="gene_id=mCG1045587.1 transcript_id=mCT163291.1
FT                   created on 04-DEC-2002"
FT   assembly_gap    15513431..15513450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15535802..15535821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15546479..15548308)
FT                   /locus_tag="mCG_49496"
FT                   /note="gene_id=mCG49496.1"
FT   mRNA            complement(15546479..15548308)
FT                   /locus_tag="mCG_49496"
FT                   /product="mCG49496"
FT                   /note="gene_id=mCG49496.1 transcript_id=mCT49679.1 created
FT                   on 29-OCT-2002"
FT   CDS             complement(15546966..15548282)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49496"
FT                   /product="mCG49496"
FT                   /note="gene_id=mCG49496.1 transcript_id=mCT49679.1
FT                   protein_id=mCP39631.1"
FT                   /protein_id="EDL12247.1"
FT                   /translation="MMADEEEEAKHVLQKLQGLVDRLYCFRVSYFETHRVEDAGRKQQD
FT                   VQEEMEKTLQQMEEVLGSVQVEVQALMLKGKALNVTPDYSPKAEVLLSKAVKLEPELME
FT                   AWNQLGKMYWKKGDVASAHTCFSGALTHCKNKVSLQILSMVLRQLQTDSGDEHSRHIMN
FT                   SVRQAKLAVQIDVLDGRSWYILGNAYLSLYFNTGQNPKISQQALSAYAQAEKVDRKASS
FT                   NPDLHLNRATLHKYEESYGEALEGFSQAAVLAPAWPEPQQREQQLLEFLSRLTSLLESK
FT                   GKTKPKKLQSMLGSLRPAHLGPCGDGCYQSASGQKVTLELKPLSTLQPGVNSGTVVLGK
FT                   VVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNVVQSWGVLIGDSVAIPEPNLRHHQIRHK
FT                   GKDYSFSSVRVETPLLLVVNGKPQNSSSQASGTVASRPQ"
FT   assembly_gap    15557145..15557301
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    15563091..15563247
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    15567080..15567099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15571915..15571934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15577188..15577258
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    15583790..15583883
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    15598675..15598694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15619899..15620087
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    15620944..15620993
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    15659383..15659430
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    15664959..15665090
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    15698047..15698066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15708728..15708797
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    15713095..15713210
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    15720999..15721050
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15733256..15733629
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    15760851..15760919
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    15770671..15771701
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    15777163..15777352
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    15783950..15784018
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    15787342..15787818
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    15792475..15792556
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            15793402..15813006
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /note="gene_id=mCG5277.2"
FT   mRNA            join(15793402..15793638,15797413..15797468,
FT                   15809107..15809312,15811752..15813006)
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   transcript variant mCT171309"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT171309.0 created
FT                   on 25-JUL-2002"
FT   mRNA            join(15793419..15793638,15797413..15797468,
FT                   15797916..15798053,15809107..15809312,15811752..15813006)
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   transcript variant mCT171308"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT171308.0 created
FT                   on 25-JUL-2002"
FT   CDS             join(15797423..15797468,15797916..15798053,
FT                   15809107..15809312,15811752..15812315)
FT                   /codon_start=1
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT171308.0
FT                   protein_id=mCP94228.0 isoform=CRA_a"
FT                   /protein_id="EDL12244.1"
FT                   /translation="METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRK
FT                   ESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATF
FT                   QRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGL
FT                   MQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSM
FT                   SSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSL
FT                   ASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV"
FT   CDS             join(15797423..15797468,15809107..15809312,
FT                   15811752..15812315)
FT                   /codon_start=1
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT171309.0
FT                   protein_id=mCP94227.0 isoform=CRA_b"
FT                   /protein_id="EDL12245.1"
FT                   /translation="METNCRKLVSACVQLEKDKGQQGKNEDVGAEDPSKKKRQRRQRTH
FT                   FTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAE
FT                   LCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQS
FT                   MFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPT
FT                   PPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV"
FT   mRNA            join(15807398..15808249,15809107..15809312,
FT                   15811752..15813006)
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   transcript variant mCT4213"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT4213.2 created on
FT                   25-JUL-2002"
FT   CDS             join(15808045..15808249,15809107..15809312,
FT                   15811752..15812315)
FT                   /codon_start=1
FT                   /gene="Pitx2"
FT                   /locus_tag="mCG_5277"
FT                   /product="paired-like homeodomain transcription factor 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5277.2 transcript_id=mCT4213.2
FT                   protein_id=mCP19201.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q6DIA6"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003654"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016233"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:109340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DIA6"
FT                   /protein_id="EDL12246.1"
FT                   /translation="MNCMKGPLPLEHRAAGTKLSAASSPFCHHPQALAMASVLAPGQPR
FT                   SLDSSKHRLEVHTISDTSSPEVAEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQL
FT                   QELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGF
FT                   GPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPN
FT                   SISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYR
FT                   DTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV"
FT   assembly_gap    15811200..15811300
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    15813997..15815045
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    15815732..15815751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15818694..15818731
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    15830291..15831664
FT                   /estimated_length=1374
FT                   /gap_type="unknown"
FT   assembly_gap    15835085..15835260
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    15840175..15840620
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    15841259..15841898
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    15859890..15859909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15863034..15926743)
FT                   /gene="Enpep"
FT                   /locus_tag="mCG_5274"
FT                   /note="gene_id=mCG5274.2"
FT   mRNA            complement(join(15863034..15864283,15865206..15865284,
FT                   15870505..15870645,15874300..15874470,15874562..15874666,
FT                   15874779..15874852,15875421..15875571,15877745..15877800,
FT                   15877927..15878060,15887085..15887164,15892709..15892860,
FT                   15892977..15893042,15897761..15897826,15899451..15899585,
FT                   15903068..15903181,15903815..15903969,15906608..15906728,
FT                   15913427..15913558,15915407..15915548,15925875..15926743))
FT                   /gene="Enpep"
FT                   /locus_tag="mCG_5274"
FT                   /product="glutamyl aminopeptidase"
FT                   /note="gene_id=mCG5274.2 transcript_id=mCT4208.2 created on
FT                   19-SEP-2002"
FT   CDS             complement(join(15864140..15864283,15865206..15865284,
FT                   15870505..15870645,15874300..15874470,15874562..15874666,
FT                   15874779..15874852,15875421..15875571,15877745..15877800,
FT                   15877927..15878060,15887085..15887164,15892709..15892860,
FT                   15892977..15893042,15897761..15897826,15899451..15899585,
FT                   15903068..15903181,15903815..15903969,15906608..15906728,
FT                   15913427..15913558,15915407..15915548,15925875..15926494))
FT                   /codon_start=1
FT                   /gene="Enpep"
FT                   /locus_tag="mCG_5274"
FT                   /product="glutamyl aminopeptidase"
FT                   /note="gene_id=mCG5274.2 transcript_id=mCT4208.2
FT                   protein_id=mCP19274.1"
FT                   /db_xref="GOA:Q52JJ6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="MGI:MGI:106645"
FT                   /db_xref="UniProtKB/TrEMBL:Q52JJ6"
FT                   /protein_id="EDL12243.1"
FT                   /translation="MNFAEEEPSKKYCIKGKHVAIICGVVVAVGLIVGLSVGLTRSCEQ
FT                   DTTPAPSQPPPEASTALPPQDQNVCPDSEDESGEWKNFRLPDFINPVHYDLEVKALMEE
FT                   DRYTGIVTISVNLSKPTRDLWLHIRETKITKLPELRRPSGEQVPIRRCFEYKKQEYVVI
FT                   QAAEDLAATSGDSVYRLTMEFKGWLNGSLVGFYKTTYMEDGQIRSIAATDHEPTDARKS
FT                   FPCFDEPNKKSTYSISIIHPKEYSALSNMPEEKSEMVDDNWKKTTFVKSVPMSTYLVCF
FT                   AVHRFTAIERKSRSGKPLKVYVQPNQKETAEYAANITQAVFDYFEDYFAMEYALPKLDK
FT                   IAIPDFGTGAMENWGLVTYRETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMD
FT                   WWDDLWLNEGFASFFEFLGVNHAEKDWQMLSQVLLEDVFPVQEDDSLMSSHPVVVTVST
FT                   PAEITSVFDGISYSKGASILRMLQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSLQE
FT                   ASNLPVKEVMDTWTSQMGYPVVTVSGRQNITQKRFLLDSKADPSQPPSELGYTWNIPVR
FT                   WADNDNSRITVYNRLDKGGITLNANLSGDAFLKINPDHIGFYRVNYEGGTWDWIAEALS
FT                   SNHTRFSAADRSSFIDDAFALARAQLLNYKIALNLTMYLKSEEDFLPWERVISSVSYII
FT                   SMFEDDRELYPMIETYFQGQVKPVADLLGWQDTGSHITKLLRASILGFACKMGDREALG
FT                   NASQLFDSWLKGSASIPVNLRLLVYRYGMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLY
FT                   GLASVKDVKLLARYLEMLKDPNIIKTQDVFTVIRYISYNSYGKTMAWNWIQLNWDYLVS
FT                   RFTINDRYLGRIVTIAEPFNTELQLWQMQSFFAKYPNAGAGAKPREQVLETVKNNIEWL
FT                   NVNRQSIREWFASLP"
FT   assembly_gap    15870891..15870953
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    15894470..15894489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15917179..15918013
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    15944356..15944420
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    15946444..15947315
FT                   /estimated_length=872
FT                   /gap_type="unknown"
FT   assembly_gap    15951133..15951313
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    15973671..15973760
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    15976753..15979308
FT                   /estimated_length=2556
FT                   /gap_type="unknown"
FT   assembly_gap    15984794..15984928
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    15986622..15987375
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    15988260..15988523
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    15991117..15991679
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    15994758..15994777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15996352..15996371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16000809..16000828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16013185..16013204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16018391..16018410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16020863..16020930
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    16023282..16023397
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    16024926..16025872
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   assembly_gap    16026965..16027197
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            16030243..16031362
FT                   /pseudo
FT                   /locus_tag="mCG_125508"
FT                   /note="gene_id=mCG125508.1"
FT   mRNA            16030243..16031362
FT                   /pseudo
FT                   /locus_tag="mCG_125508"
FT                   /note="gene_id=mCG125508.1 transcript_id=mCT126769.1
FT                   created on 22-OCT-2002"
FT   assembly_gap    16031465..16031631
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    16033477..16033582
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    16056685..16057025
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   gene            <16058882..16059722
FT                   /locus_tag="mCG_5269"
FT                   /note="gene_id=mCG5269.2"
FT   mRNA            <16058882..16059722
FT                   /locus_tag="mCG_5269"
FT                   /product="mCG5269"
FT                   /note="gene_id=mCG5269.2 transcript_id=mCT4222.2 created on
FT                   22-OCT-2002"
FT   CDS             <16059195..16059680
FT                   /codon_start=1
FT                   /locus_tag="mCG_5269"
FT                   /product="mCG5269"
FT                   /note="gene_id=mCG5269.2 transcript_id=mCT4222.2
FT                   protein_id=mCP19264.1"
FT                   /protein_id="EDL12242.1"
FT                   /translation="ACPQVQARDKAREEAKAAGKGDVPTKRPPVLRAGVNTVTTLVENK
FT                   KAQLVVIAHGVDPTELVVFLPALCRKMGVPYCIIKGKARLGHLVHRKTCTTVAFTQVNS
FT                   EDKGALAKLVEAIRTNYNDRYDEIRRHWRGNVLGPKSVARIAKLEKAKAKELATKLG"
FT   assembly_gap    16088565..16088860
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    16090864..16091033
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    16098453..16098472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16104845..16105310
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    16125727..16125838
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   gene            16129230..16235387
FT                   /gene="Elovl6"
FT                   /locus_tag="mCG_125511"
FT                   /note="gene_id=mCG125511.1"
FT   mRNA            join(16129230..16129320,16129473..16129593,
FT                   16201974..16202105,16225186..16225337,16229963..16235387)
FT                   /gene="Elovl6"
FT                   /locus_tag="mCG_125511"
FT                   /product="ELOVL family member 6, elongation of long chain
FT                   fatty acids (yeast), transcript variant mCT126772"
FT                   /note="gene_id=mCG125511.1 transcript_id=mCT126772.1
FT                   created on 25-JUL-2002"
FT   mRNA            join(16129328..16129593,16201974..16202105,
FT                   16225186..16225337,16229963..16235387)
FT                   /gene="Elovl6"
FT                   /locus_tag="mCG_125511"
FT                   /product="ELOVL family member 6, elongation of long chain
FT                   fatty acids (yeast), transcript variant mCT171291"
FT                   /note="gene_id=mCG125511.1 transcript_id=mCT171291.0
FT                   created on 25-JUL-2002"
FT   CDS             join(16129505..16129593,16201974..16202105,
FT                   16225186..16225337,16229963..16230393)
FT                   /codon_start=1
FT                   /gene="Elovl6"
FT                   /locus_tag="mCG_125511"
FT                   /product="ELOVL family member 6, elongation of long chain
FT                   fatty acids (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG125511.1 transcript_id=mCT126772.1
FT                   protein_id=mCP89255.1 isoform=CRA_a"
FT                   /protein_id="EDL12240.1"
FT                   /translation="MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIF
FT                   GGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFY
FT                   NGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGG
FT                   GWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQH
FT                   DNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE"
FT   CDS             join(16129505..16129593,16201974..16202105,
FT                   16225186..16225337,16229963..16230393)
FT                   /codon_start=1
FT                   /gene="Elovl6"
FT                   /locus_tag="mCG_125511"
FT                   /product="ELOVL family member 6, elongation of long chain
FT                   fatty acids (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG125511.1 transcript_id=mCT171291.0
FT                   protein_id=mCP94210.0 isoform=CRA_a"
FT                   /protein_id="EDL12241.1"
FT                   /translation="MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIF
FT                   GGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFY
FT                   NGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGG
FT                   GWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQH
FT                   DNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE"
FT   gene            <16255975..16258753
FT                   /locus_tag="mCG_144630"
FT                   /note="gene_id=mCG144630.0"
FT   mRNA            join(<16255975..16256048,16256069..16257811,
FT                   16257832..16258753)
FT                   /locus_tag="mCG_144630"
FT                   /product="mCG144630"
FT                   /note="gene_id=mCG144630.0 transcript_id=mCT184054.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    16256049..16256068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <16257213..16257572
FT                   /codon_start=1
FT                   /locus_tag="mCG_144630"
FT                   /product="mCG144630"
FT                   /note="gene_id=mCG144630.0 transcript_id=mCT184054.0
FT                   protein_id=mCP106168.0"
FT                   /protein_id="EDL12239.1"
FT                   /translation="RFLWDEFQGQRQMAFGTGYYFFHQLHQFQGQDHDDSLLIMSNDRR
FT                   PHFCIHLIFLRATPSFMMVLLIKKNGNTFMKIKCLVGATRHVKTKNKQTNKQKTKKPKP
FT                   MLWDEAGTRQVLRVW"
FT   assembly_gap    16257812..16257831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16258944..16258963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16274319..16354881)
FT                   /gene="Egf"
FT                   /locus_tag="mCG_5267"
FT                   /note="gene_id=mCG5267.2"
FT   mRNA            complement(join(16274319..16275299,16277866..16277971,
FT                   16279971..16280091,16282997..16283164,16287421..16287565,
FT                   16289552..16289674,16293425..16293550,16294352..16294468,
FT                   16299090..16299215,16302746..16302892,16303851..16304018,
FT                   16307874..16308097,16309575..16309679,16313247..16313395,
FT                   16314541..16314677,16315674..16315799,16316848..16316970,
FT                   16319887..16320009,16321843..16321968,16332529..16332731,
FT                   16333484..16333708,16334122..16334303,16336575..16336774,
FT                   16354380..16354881))
FT                   /gene="Egf"
FT                   /locus_tag="mCG_5267"
FT                   /product="epidermal growth factor, transcript variant
FT                   mCT4220"
FT                   /note="gene_id=mCG5267.2 transcript_id=mCT4220.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(16274319..16275299,16277866..16277971,
FT                   16279971..16280091,16282997..16283164,16287421..16287565,
FT                   16289552..16289674,16293425..16293550,16294352..16294468,
FT                   16299090..16299215,16302746..16302892,16303851..16304018,
FT                   16307874..16308097,16309575..16309679,16313247..16313395,
FT                   16314541..16314677,16315674..16315799,16316848..16316970,
FT                   16319887..16320009,16321843..16321968,16332529..16332731,
FT                   16333484..16333708,16334122..16334303,16336575..16336774,
FT                   16354380..16354402,16354453..16354873))
FT                   /gene="Egf"
FT                   /locus_tag="mCG_5267"
FT                   /product="epidermal growth factor, transcript variant
FT                   mCT171305"
FT                   /note="gene_id=mCG5267.2 transcript_id=mCT171305.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(16275064..16275299,16277866..16277971,
FT                   16279971..16280091,16282997..16283164,16287421..16287565,
FT                   16289552..16289674,16293425..16293550,16294352..16294468,
FT                   16299090..16299215,16302746..16302892,16303851..16304018,
FT                   16307874..16308097,16309575..16309679,16313247..16313395,
FT                   16314541..16314677,16315674..16315799,16316848..16316970,
FT                   16319887..16320009,16321843..16321968,16332529..16332731,
FT                   16333484..16333708,16334122..16334303,16336575..16336774,
FT                   16354380..16354527))
FT                   /codon_start=1
FT                   /gene="Egf"
FT                   /locus_tag="mCG_5267"
FT                   /product="epidermal growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG5267.2 transcript_id=mCT4220.2
FT                   protein_id=mCP19222.2 isoform=CRA_b"
FT                   /protein_id="EDL12238.1"
FT                   /translation="MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERS
FT                   GTCAGPAPFLVFSQGKSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQV
FT                   LLRVFLNGTGLEKVCNVERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSS
FT                   LKHPSNIAVDPIERLMFWSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFW
FT                   VQDSGEGSHAYIHSCDYEGGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKH
FT                   TGKDTVRINLHPSFVTPGKLMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDP
FT                   KSHSSACAEGYTLSRDRKYCEDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGK
FT                   QCHELVSCPGNVSKCSHGCVLTSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICL
FT                   PLRPGSWECDCFPGYDLQSDRKSCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQM
FT                   GMVFALDYDPVESKIYFAQTALKWIERANMDGSQRERLITEGVDTLEGLALDWIGRRIY
FT                   WTDSGKSVVGGSDLSGKHHRIIIQERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQ
FT                   GSDRVLIASSNLLEPSGITIDYLTDTLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPF
FT                   SLAVFEDHLWVSDWAIPSVIRVNKRTGQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLY
FT                   RNGGCEHICQESLGTARCLCREGFVKAWDGKMCLPQDYPILSGENADLSKEVTSLSNST
FT                   QAEVPDDDGTESSTLVAEIMVSGMNYEDDCGPGGCGSHARCVSDGETAECQCLKGFARD
FT                   GNLCSDIDECVLARSDCPSTSSRCINTEGGYVCRCSEGYEGDGISCFDIDECQRGAHNC
FT                   GENAACTNTEGGYNCTCAGRPSSPGLSCPDSTAPSLLGEDGHHLDRNSYPGCPSSYDGY
FT                   CLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRHAGYGQKHDIMVVAVCMVA
FT                   LVLLLLLGMWGTYYYRTRKQLSNPPKNPCDEPSGSVSSSGPDSSSGAAVASCPQPWFVV
FT                   LEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLGSVHLTSWRQKPHIDGMGTGQSCWIPP
FT                   SSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANGSCHERAPDLPRQTEPVQ"
FT   CDS             complement(join(16275064..16275299,16277866..16277971,
FT                   16279971..16280091,16282997..16283164,16287421..16287565,
FT                   16289552..16289674,16293425..16293550,16294352..16294468,
FT                   16299090..16299215,16302746..16302892,16303851..16304018,
FT                   16307874..16308097,16309575..16309679,16313247..16313395,
FT                   16314541..16314677,16315674..16315799,16316848..16316970,
FT                   16319887..16320009,16321843..16321968,16332529..16332731,
FT                   16333484..16333708,16334122..16334303,16336575..16336667))
FT                   /codon_start=1
FT                   /gene="Egf"
FT                   /locus_tag="mCG_5267"
FT                   /product="epidermal growth factor, isoform CRA_a"
FT                   /note="gene_id=mCG5267.2 transcript_id=mCT171305.0
FT                   protein_id=mCP94224.0 isoform=CRA_a"
FT                   /protein_id="EDL12237.1"
FT                   /translation="MDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCNVERKVSGLAI
FT                   DWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMFWSSEVTGSL
FT                   HRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYEGGSVRLIR
FT                   HQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGKLMVVHPR
FT                   AQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYCEDVNEC
FT                   ATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVLTSDGP
FT                   RCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRKSCAA
FT                   SGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALKWIE
FT                   RANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQER
FT                   ISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTDT
FT                   LYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
FT                   GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVK
FT                   AWDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNY
FT                   EDDCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCIN
FT                   TEGGYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGL
FT                   SCPDSTAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSG
FT                   DRCQTRDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLLLGMWGTYYYRTRKQLSNPPK
FT                   NPCDEPSGSVSSSGPDSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGL
FT                   SPSLQLGSVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKL
FT                   HSLQSANGSCHERAPDLPRQTEPVQ"
FT   assembly_gap    16321291..16321310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16342948..16342967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16344078..16344097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16345219..16345238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16353320..16363447
FT                   /locus_tag="mCG_146134"
FT                   /note="gene_id=mCG146134.0"
FT   mRNA            join(<16353320..16353486,16354025..16355196,
FT                   16355994..16356152,16357574..16357701,16361202..16363447)
FT                   /locus_tag="mCG_146134"
FT                   /product="mCG146134"
FT                   /note="gene_id=mCG146134.0 transcript_id=mCT186237.0
FT                   created on 14-JUL-2003"
FT   CDS             <16362276..16362743
FT                   /codon_start=1
FT                   /locus_tag="mCG_146134"
FT                   /product="mCG146134"
FT                   /note="gene_id=mCG146134.0 transcript_id=mCT186237.0
FT                   protein_id=mCP107723.0"
FT                   /protein_id="EDL12236.1"
FT                   /translation="SFSKNVTNVLSIQEDLDRHLEQWIDTFYDTTQIIREEVQSLKVRS
FT                   HLKCHAKYQWICVTSKVYNGSHYSWEIFQRHLQGIWHNSNTSLDILAFHSEFMNLKNAA
FT                   LLSFDAADITGKIIHGLKSVFPSWSSFKNDIYGLIMLALLVLGISYSCTSC"
FT   assembly_gap    16377421..16377440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16383543..16384328
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   gene            complement(<16388027..16400519)
FT                   /locus_tag="mCG_65670"
FT                   /note="gene_id=mCG65670.2"
FT   mRNA            complement(join(<16388027..16388791,16390928..16391233,
FT                   16400047..16400519))
FT                   /locus_tag="mCG_65670"
FT                   /product="mCG65670"
FT                   /note="gene_id=mCG65670.2 transcript_id=mCT65853.2 created
FT                   on 22-OCT-2002"
FT   CDS             complement(join(<16388027..16388791,16390928..16391233,
FT                   16400047..16400494))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65670"
FT                   /product="mCG65670"
FT                   /note="gene_id=mCG65670.2 transcript_id=mCT65853.2
FT                   protein_id=mCP39650.2"
FT                   /protein_id="EDL12235.1"
FT                   /translation="MNEVPANFPVDTSKLRIEKTVVRRLPAEAFYYLVELQYLWLAYNS
FT                   VASIETSSFYNLRQLHELRLDGNSLTAFPWVSLLDMPHLRTLDLHNNRIASVPNEAVRY
FT                   LRNLTCLDLSSNRLTTLPPDFLDSWSHLAVTPSRSPDFPPRRIILGLQDNPWFCDCHIS
FT                   KVIELSKVTDHAVVLLDPLMVCSEPERFQGILFQRVELEKCLKPSVMMSATKITSALGS
FT                   NVLLRCDAKGHPTPQLTWTRSDGSTVNYTAASATTSVQTSISGRTARTSHQPPLLHPGG
FT                   KSNAKIEKNGRKFPPLSASKKEELALLDQAAPMETNVTIKDLRVARETGVSVTLMWNSS
FT                   SSTQESSVTVLYSKYGEKDLLLVNADDYGKNQATINGLEPGSQYVACVCPKGVGPREDL
FT                   CITFSTNRVEGRGSQWSLLLVVTSTACVIVVPLICFLLYKVCKLQCTSDPFWEEDLSKE
FT                   TYIQFETLSPRSQSIGELWTRRHRDDGERLLLCSQSSVDSQMNLKSDG"
FT   assembly_gap    16406594..16406674
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            complement(16408342..16422136)
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /note="gene_id=mCG5265.2"
FT   mRNA            complement(join(16408342..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16422006..16422136))
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, transcript variant mCT171303"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT171303.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(16408342..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16413015..16413114,
FT                   16415145..16415335,16422006..16422136))
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, transcript variant mCT4218"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT4218.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(16408342..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16413015..16413114,
FT                   16414825..16414951,16415145..16415335,16422006..>16422127))
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, transcript variant mCT190562"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT190562.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16408697..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16422006..16422111))
FT                   /codon_start=1
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, isoform CRA_a"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT171303.0
FT                   protein_id=mCP94222.0 isoform=CRA_a"
FT                   /protein_id="EDL12232.1"
FT                   /translation="MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGRRMTTNTYL
FT                   SMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVP
FT                   LTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVC
FT                   LWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFRKAMLAMFKCQPHLAVPE
FT                   PSTLPMDMPQSSLAPVRI"
FT   CDS             complement(join(16408697..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16413015..16413114,
FT                   16415145..16415335,16422006..16422111))
FT                   /codon_start=1
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, isoform CRA_c"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT4218.2
FT                   protein_id=mCP19218.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q543W9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002962"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR027430"
FT                   /db_xref="MGI:MGI:1097709"
FT                   /db_xref="UniProtKB/TrEMBL:Q543W9"
FT                   /protein_id="EDL12234.1"
FT                   /translation="MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVV
FT                   VLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGL
FT                   NIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGW
FT                   ASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAAS
FT                   DCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPL
FT                   FAKSSTFYNPCIYVAAHKKFRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI"
FT   CDS             complement(join(16408697..16408811,16410291..16410469,
FT                   16411376..16411544,16412373..16412526,16413015..16413114,
FT                   16414825..>16414923))
FT                   /codon_start=1
FT                   /gene="Rrh"
FT                   /locus_tag="mCG_5265"
FT                   /product="retinal pigment epithelium derived rhodopsin
FT                   homolog, isoform CRA_b"
FT                   /note="gene_id=mCG5265.2 transcript_id=mCT190562.0
FT                   protein_id=mCP111523.0 isoform=CRA_b"
FT                   /protein_id="EDL12233.1"
FT                   /translation="LGACIHVLYRMYAMLVEPRGGQWDLLKLTLQMDIYAGLNIFFGMV
FT                   SIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDP
FT                   TGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLH
FT                   RDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTF
FT                   YNPCIYVAAHKKFRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI"
FT   assembly_gap    16414171..16414810
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    16416839..16416871
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(16424553..16430938)
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /note="gene_id=mCG5264.2"
FT   mRNA            complement(join(16424553..16424844,16425183..16425251,
FT                   16426459..16426609,16428541..16428600,16428973..16429127,
FT                   16430231..16430371,16430408..16430489,16430754..16430938))
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), transcript variant mCT171301"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT171301.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(16424555..16424844,16425183..16425251,
FT                   16426459..16426609,16428541..16428600,16428973..16429127,
FT                   16430231..16430489,16430754..16430938))
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), transcript variant mCT4217"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT4217.2 created on
FT                   24-JUL-2002"
FT   mRNA            complement(join(16424715..16424840,16425179..16425251,
FT                   16426459..16426609,16428956..16429127,16430231..16430489,
FT                   16430754..16430938))
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), transcript variant mCT171302"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT171302.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(16424831..16424844,16425183..16425251,
FT                   16426459..16426609,16428541..16428600,16428973..16429127,
FT                   16430231..16430371,16430408..16430477))
FT                   /codon_start=1
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), isoform CRA_c"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT171301.0
FT                   protein_id=mCP94220.0 isoform=CRA_c"
FT                   /protein_id="EDL12231.1"
FT                   /translation="MSFRGGGRGGFNRGGGGGGFNRGGGGGSFRGGGGGGGGSFRGGGR
FT                   GGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLE
FT                   NKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGE
FT                   KGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGFRGRGH"
FT   CDS             complement(join(16424831..16424844,16425183..16425251,
FT                   16426459..16426609,16428541..16428600,16428973..16429127,
FT                   16430231..16430477))
FT                   /codon_start=1
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), isoform CRA_b"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT4217.2
FT                   protein_id=mCP19203.2 isoform=CRA_b"
FT                   /protein_id="EDL12230.1"
FT                   /translation="MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGG
FT                   GGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEEN
FT                   KVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLL
FT                   PLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRG
FT                   GGGFRGRGH"
FT   CDS             complement(join(16426600..16426609,16428956..16429127,
FT                   16430231..16430477))
FT                   /codon_start=1
FT                   /gene="Nola1"
FT                   /locus_tag="mCG_5264"
FT                   /product="nucleolar protein family A, member 1 (H/ACA small
FT                   nucleolar RNPs), isoform CRA_a"
FT                   /note="gene_id=mCG5264.2 transcript_id=mCT171302.0
FT                   protein_id=mCP94221.0 isoform=CRA_a"
FT                   /protein_id="EDL12229.1"
FT                   /translation="MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGG
FT                   GGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEEN
FT                   KVPYFNAPVYLENKEQVGKVDEIFGQLRDFVSFLIGSI"
FT   gene            16436353..16476571
FT                   /gene="Cfi"
FT                   /locus_tag="mCG_140760"
FT                   /note="gene_id=mCG140760.0"
FT   mRNA            join(16436353..16436482,16448165..16448445,
FT                   16454952..16455133,16458367..16458480,16458725..16458835,
FT                   16462194..16462220,16462358..16462378,16466586..16466642,
FT                   16469452..16469555,16469726..16469829,16474086..16474363,
FT                   16475531..16475635,16476165..16476571)
FT                   /gene="Cfi"
FT                   /locus_tag="mCG_140760"
FT                   /product="complement component factor i"
FT                   /note="gene_id=mCG140760.0 transcript_id=mCT171307.0
FT                   created on 24-JUL-2002"
FT   CDS             join(16436426..16436482,16448165..16448445,
FT                   16454952..16455133,16458367..16458480,16458725..16458835,
FT                   16462194..16462220,16462358..16462378,16466586..16466642,
FT                   16469452..16469555,16469726..16469829,16474086..16474363,
FT                   16475531..16475635,16476165..16476382)
FT                   /codon_start=1
FT                   /gene="Cfi"
FT                   /locus_tag="mCG_140760"
FT                   /product="complement component factor i"
FT                   /note="gene_id=mCG140760.0 transcript_id=mCT171307.0
FT                   protein_id=mCP94226.0"
FT                   /protein_id="EDL12228.1"
FT                   /translation="MKLAHLSLFLLALHLSSSRSPSASDLPQEELVDQKCLLQKYTHRS
FT                   CNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFS
FT                   HNGTCAAEGGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTESSNGL
FT                   AGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKS
FT                   GVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGM
FT                   DNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYI
FT                   GGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDI
FT                   ALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEV
FT                   DLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGE
FT                   NCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV"
FT   assembly_gap    16449431..16450428
FT                   /estimated_length=998
FT                   /gap_type="unknown"
FT   assembly_gap    16454205..16454224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16456374..16456393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16457504..16457523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16463355..16463374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16479821..16480029
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            <16480030..16497126
FT                   /gene="Pla2g12a"
FT                   /locus_tag="mCG_5270"
FT                   /note="gene_id=mCG5270.2"
FT   mRNA            join(<16480030..16480232,16490176..16490252,
FT                   16491563..16491728,16496145..16497126)
FT                   /gene="Pla2g12a"
FT                   /locus_tag="mCG_5270"
FT                   /product="phospholipase A2, group XIIA, transcript variant
FT                   mCT4224"
FT                   /note="gene_id=mCG5270.2 transcript_id=mCT4224.2 created on
FT                   24-JUL-2002"
FT   CDS             join(<16480031..16480232,16490176..16490252,
FT                   16491563..16491728,16496145..16496263)
FT                   /codon_start=1
FT                   /gene="Pla2g12a"
FT                   /locus_tag="mCG_5270"
FT                   /product="phospholipase A2, group XIIA, isoform CRA_b"
FT                   /note="gene_id=mCG5270.2 transcript_id=mCT4224.2
FT                   protein_id=mCP19258.1 isoform=CRA_b"
FT                   /protein_id="EDL12227.1"
FT                   /translation="PAPARSPALLLLLLLATARGQEQDQTTDWRATLKTIRNGIHKIDT
FT                   YLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKC
FT                   CNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIH
FT                   LGCKPYLDSQRAACWCRYEEKTDL"
FT   mRNA            join(16482479..16482591,16490176..16490252,
FT                   16491563..16491728,16496145..16497126)
FT                   /gene="Pla2g12a"
FT                   /locus_tag="mCG_5270"
FT                   /product="phospholipase A2, group XIIA, transcript variant
FT                   mCT171306"
FT                   /note="gene_id=mCG5270.2 transcript_id=mCT171306.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(16482492..16482591,16490176..16490252,
FT                   16491563..16491728,16496145..16496263)
FT                   /codon_start=1
FT                   /gene="Pla2g12a"
FT                   /locus_tag="mCG_5270"
FT                   /product="phospholipase A2, group XIIA, isoform CRA_a"
FT                   /note="gene_id=mCG5270.2 transcript_id=mCT171306.0
FT                   protein_id=mCP94225.0 isoform=CRA_a"
FT                   /protein_id="EDL12226.1"
FT                   /translation="MKDYHSGPGKYWEPFAFPVGCSGTEEEEGLRIGRSKPVPRYGYKP
FT                   SPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ
FT                   KTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL"
FT   gene            16502753..16515312
FT                   /gene="Casp6"
FT                   /locus_tag="mCG_5268"
FT                   /note="gene_id=mCG5268.2"
FT   mRNA            join(16502753..16502813,16506773..16506814,
FT                   16507210..16507359,16507708..16507784,16511733..16511908,
FT                   16513328..16513484,16514542..16515312)
FT                   /gene="Casp6"
FT                   /locus_tag="mCG_5268"
FT                   /product="caspase 6"
FT                   /note="gene_id=mCG5268.2 transcript_id=mCT4221.2 created on
FT                   24-JUL-2002"
FT   CDS             join(16506786..16506814,16507210..16507359,
FT                   16507708..16507784,16511733..16511908,16513328..16513484,
FT                   16514542..16514783)
FT                   /codon_start=1
FT                   /gene="Casp6"
FT                   /locus_tag="mCG_5268"
FT                   /product="caspase 6"
FT                   /note="gene_id=mCG5268.2 transcript_id=mCT4221.2
FT                   protein_id=mCP19253.1"
FT                   /db_xref="GOA:Q3TPJ9"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="MGI:MGI:1312921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPJ9"
FT                   /protein_id="EDL12225.1"
FT                   /translation="MTETDGFYKSREVFDPAEQYKMDHKRRGVALIFNHERFFWHLTLP
FT                   ERRGTNADRDNLTRRFSDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSH
FT                   GEGNHVYAYDAKIEIQTLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDH
FT                   QTDKLDNVTQVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYG
FT                   SSLEFTELLTLVNRKVSQRRVDFCKDPDAIGKKQVPCFASMLTKKLHFCPKPSK"
FT   assembly_gap    16508548..16508861
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   gene            complement(16516171..16571595)
FT                   /gene="Ccdc109b"
FT                   /locus_tag="mCG_5266"
FT                   /note="gene_id=mCG5266.2"
FT   mRNA            complement(join(16516171..16516396,16516913..16517029,
FT                   16518149..16518352,16519796..16519956,16527575..16527679,
FT                   16535811..16535886,16571399..16571595))
FT                   /gene="Ccdc109b"
FT                   /locus_tag="mCG_5266"
FT                   /product="coiled-coil domain containing 109B, transcript
FT                   variant mCT171304"
FT                   /note="gene_id=mCG5266.2 transcript_id=mCT171304.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(16516171..16516396,16516913..16517029,
FT                   16518149..16518352,16519796..16519956,16527575..16527679,
FT                   16534769..16534939,16535811..16535886,16571399..16571595))
FT                   /gene="Ccdc109b"
FT                   /locus_tag="mCG_5266"
FT                   /product="coiled-coil domain containing 109B, transcript
FT                   variant mCT4219"
FT                   /note="gene_id=mCG5266.2 transcript_id=mCT4219.2 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(16516319..16516396,16516913..16517029,
FT                   16518149..16518352,16519796..16519956,16527575..16527679,
FT                   16535811..16535886,16571399..16571524))
FT                   /codon_start=1
FT                   /gene="Ccdc109b"
FT                   /locus_tag="mCG_5266"
FT                   /product="coiled-coil domain containing 109B, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5266.2 transcript_id=mCT171304.0
FT                   protein_id=mCP94223.0 isoform=CRA_b"
FT                   /protein_id="EDL12224.1"
FT                   /translation="MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLC
FT                   MKLYGNPKYHQALHYGTVEPQDDGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEE
FT                   PSGEHMTELENTKSLVHRLFTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEA
FT                   RSEANTSGLLWAGLALLSVQGGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIIT
FT                   RQNYTYSSLRSRQFLQFFHKKSQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQG
FT                   GEASEKN"
FT   CDS             complement(join(16516319..16516396,16516913..16517029,
FT                   16518149..16518352,16519796..16519956,16527575..16527679,
FT                   16534769..16534939,16535811..16535886,16571399..16571524))
FT                   /codon_start=1
FT                   /gene="Ccdc109b"
FT                   /locus_tag="mCG_5266"
FT                   /product="coiled-coil domain containing 109B, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5266.2 transcript_id=mCT4219.2
FT                   protein_id=mCP19237.2 isoform=CRA_a"
FT                   /protein_id="EDL12223.1"
FT                   /translation="MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLC
FT                   MKLYGNPKYHQALHYGTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGS
FT                   FLQDLQNEDKGIKTAAIITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPS
FT                   GEHMTELENTKSLVHRLFTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARS
FT                   EANTSGLLWAGLALLSVQGGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQ
FT                   NYTYSSLRSRQFLQFFHKKSQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGGE
FT                   ASEKN"
FT   assembly_gap    16528403..16528422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16554302..16554525
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    16558513..16558822
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    16569387..16569667
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   gene            complement(16584192..16643116)
FT                   /gene="Sec24b"
FT                   /locus_tag="mCG_125686"
FT                   /note="gene_id=mCG125686.1"
FT   mRNA            complement(join(16584192..16585433,16585594..16585697,
FT                   16589377..16589469,16590586..16590690,16591339..16591476,
FT                   16591985..16592160,16593023..16593133,16594665..16594838,
FT                   16595420..16595578,16595959..16596082,16597604..16597810,
FT                   16598031..16598086,16598371..16598489,16601187..16601299,
FT                   16603981..16604090,16604616..16604742,16606670..16606772,
FT                   16609089..16609273,16611339..16611571,16613469..16613549,
FT                   16622217..16622321,16635510..16635653,16642342..16643116))
FT                   /gene="Sec24b"
FT                   /locus_tag="mCG_125686"
FT                   /product="SEC24 related gene family, member B (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG125686.1 transcript_id=mCT126953.1
FT                   created on 22-OCT-2002"
FT   CDS             complement(join(16585319..16585433,16585594..16585697,
FT                   16589377..16589469,16590586..16590690,16591339..16591476,
FT                   16591985..16592160,16593023..16593133,16594665..16594838,
FT                   16595420..16595578,16595959..16596082,16597604..16597810,
FT                   16598031..16598086,16598371..16598489,16601187..16601299,
FT                   16603981..16604090,16604616..16604742,16606670..16606772,
FT                   16609089..16609273,16611339..16611571,16613469..16613549,
FT                   16622217..16622321,16635510..16635653,16642342..16643098))
FT                   /codon_start=1
FT                   /gene="Sec24b"
FT                   /locus_tag="mCG_125686"
FT                   /product="SEC24 related gene family, member B (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG125686.1 transcript_id=mCT126953.1
FT                   protein_id=mCP89168.1"
FT                   /protein_id="EDL12222.1"
FT                   /translation="MQVPSGYGLPHQNYMVPSGHYSQGPGKMTSLPLDSQCDSYYSRPY
FT                   TVPTQNSGTPSSANQPGAQQMYGRGPSAPHMGGSMPGSFQGIPASASHSYSSASQPYSS
FT                   LGNRYSSPTTYSANASVASQGYPSTCSHYPISTVSNVVYPNVSYPSLPASEPYGQMFTS
FT                   QSAPPPARPVKESYSGPSTALTYPSRPPPPPSQHQQQQQQQQQQQQQQQSHSGYSSLPW
FT                   SGPALPPAQDSLIRNQMGSLATANSHPTNNENVQPPKSSSVVSTVLPGPSSTRMPPAPS
FT                   HPVGPVPSAPPPPEQMQTKGMQYGDYGNNQASSTATPLSSASDDEEEQEEDEEAGVDSS
FT                   STTSSASPLPNSYDALEGGSYPDMHSSSASSPVPDHALEPSPTLAQALSAAPTPPAAQP
FT                   AKVAKPFGYGYPALQPAYQNAAPPPMPAAHPSGPAYTGYPQHYPGVNQLSSGLGGLSLQ
FT                   SSPQPESLRPVNLTQEKNILPPTPIWAPVPNLSAELSKLNCSPDSFRCTLTSIPQTQAL
FT                   LNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRV
FT                   NDVPEEFLYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAV
FT                   EAGYLTVLCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDV
FT                   FLPTPDSLLVNLYESKELIKDLLNALPSMFINTRETHSALGPALQAAFKLMSPTGGRVS
FT                   VFQTQLPSLGAGLLQSREDPNQRSSTKVVHHLGPATDFYKKLALDCSGQQTAVDLFLLS
FT                   SQYSDLASLACMSKYSAGCIFYYPSFHSTHNPSQAEKLQKDLKRYLTRKIGFEAVMRIR
FT                   CTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTALVCFQTALLYTS
FT                   SKGERRIRVHTLCLPVVSSLADVYAGVDVQAAVCLLANMAVDRSVSSSLSDARDALVNA
FT                   VVDPLSAYSSAVASVPRSTLTAPSSLKLLPLYVLALLKQKAFRTGTSTRLDDRVYAMCQ
FT                   MKSQPLVHLMKMIHPNLYRIDRLTDEGAIHVNDRVVPQPPLQKLSAEKLTREGAFLMDC
FT                   GSVFYIWVGKGCDSNFIENVLGYPDFASIPQKMTHLPELDTLPSERTRSFVTWLRDSRP
FT                   LSPVLHLVKDESPAKTDFFQHLLEDRTEAALSYYEFLIHIQQQVCK"
FT   assembly_gap    16585971..16586026
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    16587515..16587534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16661995..16662799
FT                   /estimated_length=805
FT                   /gap_type="unknown"
FT   assembly_gap    16667481..16667623
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    16671335..16671354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16671355..16671762
FT                   /locus_tag="mCG_125679"
FT                   /note="gene_id=mCG125679.0"
FT   mRNA            <16671355..16671762
FT                   /locus_tag="mCG_125679"
FT                   /product="mCG125679"
FT                   /note="gene_id=mCG125679.0 transcript_id=mCT126942.0
FT                   created on 22-OCT-2002"
FT   CDS             <16671355..16671720
FT                   /codon_start=1
FT                   /locus_tag="mCG_125679"
FT                   /product="mCG125679"
FT                   /note="gene_id=mCG125679.0 transcript_id=mCT126942.0
FT                   protein_id=mCP89740.0"
FT                   /protein_id="EDL12221.1"
FT                   /translation="DIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPP
FT                   RDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHP
FT                   HDIIDDINSGAVECPAS"
FT   assembly_gap    16672359..16672378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16686452..16686471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16714763..16714782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16726522..16726541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16727865..16727884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16734779..17198697
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /note="gene_id=mCG125680.2"
FT   mRNA            join(16734779..16735066,16739159..16739354,
FT                   16747834..16748078,16748544..16748694,16749920..16749999,
FT                   16788769..16788838,16990178..16990222,16992237..16992244,
FT                   17022088..17022105,17042385..17042411,17042547..17042573,
FT                   17076889..17076948,17078450..17078557,17081066..17081101,
FT                   17096407..17096433,17098479..17098523,17119967..17120020,
FT                   17122083..17122109,17124739..17124783,17131996..17132028,
FT                   17132403..17132438,17137627..17137671,17148554..17148616,
FT                   17151369..17151437,17152231..17152275,17154154..17154198,
FT                   17155078..17155155,17162047..17162070,17163122..17163166,
FT                   17166420..17166464,17168765..17168845,17169884..17169946,
FT                   17170549..17170599,17172616..17172642,17177682..17177717,
FT                   17179609..17179662,17185574..17185627,17187004..17187030,
FT                   17187987..17188040,17192264..17192341,17194098..17194136,
FT                   17197937..17198697)
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, transcript
FT                   variant mCT182149"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182149.0
FT                   created on 21-MAY-2003"
FT   mRNA            join(16734779..16735066,16739159..16739354,
FT                   16747834..16748078,16748544..16748694,16749920..16749999,
FT                   16788769..16788838,16990178..16990222,16992237..16992244,
FT                   17022088..17022105,17042385..17042411,17042547..17042573,
FT                   17077674..17077745,17078450..17078557,17081066..17081101,
FT                   17096407..17096433,17098479..17098523,17119967..17120020,
FT                   17122083..17122109,17124739..17124783,17131996..17132028,
FT                   17132403..17132438,17137627..17137671,17148554..17148616,
FT                   17151369..17151437,17152231..17152275,17154154..17154198,
FT                   17155078..17155155,17162047..17162070,17163122..17163166,
FT                   17166420..17166464,17168765..17168845,17169884..17169946,
FT                   17170549..17170599,17172616..17172642,17177682..17177717,
FT                   17179609..17179662,17185574..17185627,17187004..17187030,
FT                   17187987..17188040,17192264..17192341,17194098..17194136,
FT                   17197380..17197412)
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, transcript
FT                   variant mCT182148"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182148.0
FT                   created on 21-MAY-2003"
FT   mRNA            join(16734779..16735066,16739159..16739354,
FT                   16747834..16748078,16748544..16748694,16749920..16749999,
FT                   16788769..16788886)
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, transcript
FT                   variant mCT126954"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT126954.0
FT                   created on 21-MAY-2003"
FT   assembly_gap    16752516..16752854
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    16755370..16756348
FT                   /estimated_length=979
FT                   /gap_type="unknown"
FT   assembly_gap    16757774..16758529
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    16760977..16761973
FT                   /estimated_length=997
FT                   /gap_type="unknown"
FT   assembly_gap    16763244..16763263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16768978..16768997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(16786893..16787784,16788769..16788838,
FT                   16990178..16990222,16992237..16992244,17022088..17022105,
FT                   17042385..17042411,17042547..17042573,17076889..17076948,
FT                   17078450..17078557,17081066..17081101,17096407..17096433,
FT                   17098479..17098523,17119967..17120020,17122083..17122109,
FT                   17124739..17124783,17131996..17132028,17132403..17132438,
FT                   17137627..17137671,17148554..17148616,17151369..17151437,
FT                   17152231..17152275,17154154..17154198,17155078..17155155,
FT                   17162047..17162070,17163122..17163166,17166420..17166464,
FT                   17168765..17168845,17169884..17169946,17170549..17170599,
FT                   17172616..17172642,17177682..17177717,17179609..17179662,
FT                   17185574..17185627,17187004..17187030,17187987..17188040,
FT                   17192264..17192341,17194098..17194136,17197937..17198697)
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, transcript
FT                   variant mCT182147"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182147.0
FT                   created on 21-MAY-2003"
FT   mRNA            join(16786893..16787784,16788769..16788838,
FT                   16990178..16990222,16992237..16992244,17022088..17022105,
FT                   17042385..17042411,17042547..17042573,17077674..17077745,
FT                   17078450..17078557,17081066..17081101,17096407..17096433,
FT                   17098479..17098523,17119967..17120020,17122083..17122109,
FT                   17124739..17124783,17131996..17132028,17132403..17132438,
FT                   17137627..17137671,17148554..17148616,17151369..17151437,
FT                   17152231..17152275,17154154..17154198,17155078..17155155,
FT                   17162047..17162070,17163122..17163166,17166420..17166464,
FT                   17168765..17168845,17169884..17169946,17170549..17170599,
FT                   17172616..17172642,17177682..17177717,17179609..17179662,
FT                   17185574..17185627,17187004..17187030,17187987..17188040,
FT                   17192264..17192341,17194098..17194136,17197380..17197412)
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, transcript
FT                   variant mCT126945"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT126945.2
FT                   created on 21-MAY-2003"
FT   CDS             join(16787488..16787784,16788769..16788838,
FT                   16990178..16990222,16992237..16992244,17022088..17022105,
FT                   17042385..17042411,17042547..17042573,17076889..17076948,
FT                   17078450..17078557,17081066..17081101,17096407..17096433,
FT                   17098479..17098523,17119967..17120020,17122083..17122109,
FT                   17124739..17124783,17131996..17132028,17132403..17132438,
FT                   17137627..17137671,17148554..17148616,17151369..17151437,
FT                   17152231..17152275,17154154..17154198,17155078..17155155,
FT                   17162047..17162070,17163122..17163166,17166420..17166464,
FT                   17168765..17168845,17169884..17169946,17170549..17170599,
FT                   17172616..17172642,17177682..17177717,17179609..17179662,
FT                   17185574..17185627,17187004..17187030,17187987..17188040,
FT                   17192264..17192341,17194098..17194136,17197937..17197972)
FT                   /codon_start=1
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182147.0
FT                   protein_id=mCP105068.0 isoform=CRA_b"
FT                   /protein_id="EDL12217.1"
FT                   /translation="MLVKKLAGKGGGRESGSEDPRPLGQRCAGTMPSCTALATLLSVVA
FT                   VAFCFYLGVKTNDLQARIAALESAKGTPSFHPLSDTVDELKAMVQEKVERLLAQKSYEH
FT                   MAKIRTAREAPLECNCPAGPPGKRGKRGRRGESGPPGQPGPQGPPGPKGDKGEQGDQGP
FT                   RGLPGFPTVAALHSNQILTVKGDQGQAGPPGPPGPPGPRGPPGDTGKDGPRGMPGVPGE
FT                   PGKPGEQGLMGPLGPPGQKGSIGAPGTPGMDGQKGEPGSPGAAGQSGLPGPKGEPGKEG
FT                   EKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIKGEPG
FT                   FIGPQGEPGLPGLPGTKGDRGEAGPPGRGERGDPGAPGPKGKQGESGARGPKGSKGDRG
FT                   DKGDSGALGPRGPPGQKGDPGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGP
FT                   KGEQGSPGIPGVDGEQGLKGSKGDMGDPGVPGEKGGLGLPGLPGANGVKGEKGDTGLPG
FT                   PQGPSIIGPPGPPGPHGPPGPMGPHGLPGPKGASGLDGKPGSRGADGPIGPHGPAGPKG
FT                   ERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFPGPRGEKGDLGEKGEKGFRGVKGEKGEP
FT                   GQPGLDGLDAPCQLGPDGLPMPGCWQKGVTPWLIAKKR"
FT   CDS             join(16787488..16787784,16788769..16788838,
FT                   16990178..16990222,16992237..16992244,17022088..17022105,
FT                   17042385..17042411,17042547..17042573,17077674..17077745,
FT                   17078450..17078557,17081066..17081101,17096407..17096433,
FT                   17098479..17098523,17119967..17120020,17122083..17122109,
FT                   17124739..17124783,17131996..17132028,17132403..17132438,
FT                   17137627..17137671,17148554..17148616,17151369..17151437,
FT                   17152231..17152275,17154154..17154198,17155078..17155155,
FT                   17162047..17162070,17163122..17163166,17166420..17166464,
FT                   17168765..17168845,17169884..17169946,17170549..17170599,
FT                   17172616..17172642,17177682..17177717,17179609..17179662,
FT                   17185574..17185627,17187004..17187030,17187987..17188040,
FT                   17192264..17192341,17194098..17194136,17197380..17197382)
FT                   /codon_start=1
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, isoform CRA_e"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT126945.2
FT                   protein_id=mCP89741.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q99MQ5"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR029575"
FT                   /db_xref="MGI:MGI:1924268"
FT                   /protein_id="EDL12220.1"
FT                   /translation="MLVKKLAGKGGGRESGSEDPRPLGQRCAGTMPSCTALATLLSVVA
FT                   VAFCFYLGVKTNDLQARIAALESAKGTPSFHPLSDTVDELKAMVQEKVERLLAQKSYEH
FT                   MAKIRTAREAPLECNCPAGPPGKRGKRGRRGESGPPGQPGPQGPPGPKGDKGEQGDQGP
FT                   RMVFPKINHGFLSADQQLIKRRLIKGDQGQAGPPGPPGPPGPRGPPGDTGKDGPRGMPG
FT                   VPGEPGKPGEQGLMGPLGPPGQKGSIGAPGTPGMDGQKGEPGSPGAAGQSGLPGPKGEP
FT                   GKEGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIK
FT                   GEPGFIGPQGEPGLPGLPGTKGDRGEAGPPGRGERGDPGAPGPKGKQGESGARGPKGSK
FT                   GDRGDKGDSGALGPRGPPGQKGDPGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQG
FT                   LQGPKGEQGSPGIPGVDGEQGLKGSKGDMGDPGVPGEKGGLGLPGLPGANGVKGEKGDT
FT                   GLPGPQGPSIIGPPGPPGPHGPPGPMGPHGLPGPKGASGLDGKPGSRGADGPIGPHGPA
FT                   GPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFPGPRGEKGDLGEKGEKGFRGVKGE
FT                   KGEPGQPGLDGLDAPCQLGPDGLPMPGCWQK"
FT   CDS             join(16788784..16788838,16990178..16990222,
FT                   16992237..16992244,17022088..17022105,17042385..17042411,
FT                   17042547..17042573,17076889..17076948,17078450..17078557,
FT                   17081066..17081101,17096407..17096433,17098479..17098523,
FT                   17119967..17120020,17122083..17122109,17124739..17124783,
FT                   17131996..17132028,17132403..17132438,17137627..17137671,
FT                   17148554..17148616,17151369..17151437,17152231..17152275,
FT                   17154154..17154198,17155078..17155155,17162047..17162070,
FT                   17163122..17163166,17166420..17166464,17168765..17168845,
FT                   17169884..17169946,17170549..17170599,17172616..17172642,
FT                   17177682..17177717,17179609..17179662,17185574..17185627,
FT                   17187004..17187030,17187987..17188040,17192264..17192341,
FT                   17194098..17194136,17197937..17197972)
FT                   /codon_start=1
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, isoform CRA_d"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182149.0
FT                   protein_id=mCP105069.0 isoform=CRA_d"
FT                   /protein_id="EDL12219.1"
FT                   /translation="MAKIRTAREAPLECNCPAGPPGKRGKRGRRGESGPPGQPGPQGPP
FT                   GPKGDKGEQGDQGPRGLPGFPTVAALHSNQILTVKGDQGQAGPPGPPGPPGPRGPPGDT
FT                   GKDGPRGMPGVPGEPGKPGEQGLMGPLGPPGQKGSIGAPGTPGMDGQKGEPGSPGAAGQ
FT                   SGLPGPKGEPGKEGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKGEPGL
FT                   PGLPGLPGIKGEPGFIGPQGEPGLPGLPGTKGDRGEAGPPGRGERGDPGAPGPKGKQGE
FT                   SGARGPKGSKGDRGDKGDSGALGPRGPPGQKGDPGATEIIDYNGNLHEALQRITTLTVT
FT                   GPPGPPGPQGLQGPKGEQGSPGIPGVDGEQGLKGSKGDMGDPGVPGEKGGLGLPGLPGA
FT                   NGVKGEKGDTGLPGPQGPSIIGPPGPPGPHGPPGPMGPHGLPGPKGASGLDGKPGSRGA
FT                   DGPIGPHGPAGPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFPGPRGEKGDLGEKG
FT                   EKGFRGVKGEKGEPGQPGLDGLDAPCQLGPDGLPMPGCWQKGVTPWLIAKKR"
FT   CDS             join(16788784..16788838,16990178..16990222,
FT                   16992237..16992244,17022088..17022105,17042385..17042411,
FT                   17042547..17042573,17077674..17077745,17078450..17078557,
FT                   17081066..17081101,17096407..17096433,17098479..17098523,
FT                   17119967..17120020,17122083..17122109,17124739..17124783,
FT                   17131996..17132028,17132403..17132438,17137627..17137671,
FT                   17148554..17148616,17151369..17151437,17152231..17152275,
FT                   17154154..17154198,17155078..17155155,17162047..17162070,
FT                   17163122..17163166,17166420..17166464,17168765..17168845,
FT                   17169884..17169946,17170549..17170599,17172616..17172642,
FT                   17177682..17177717,17179609..17179662,17185574..17185627,
FT                   17187004..17187030,17187987..17188040,17192264..17192341,
FT                   17194098..17194136,17197380..17197382)
FT                   /codon_start=1
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT182148.0
FT                   protein_id=mCP105067.0 isoform=CRA_c"
FT                   /protein_id="EDL12218.1"
FT                   /translation="MAKIRTAREAPLECNCPAGPPGKRGKRGRRGESGPPGQPGPQGPP
FT                   GPKGDKGEQGDQGPRMVFPKINHGFLSADQQLIKRRLIKGDQGQAGPPGPPGPPGPRGP
FT                   PGDTGKDGPRGMPGVPGEPGKPGEQGLMGPLGPPGQKGSIGAPGTPGMDGQKGEPGSPG
FT                   AAGQSGLPGPKGEPGKEGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKG
FT                   EPGLPGLPGLPGIKGEPGFIGPQGEPGLPGLPGTKGDRGEAGPPGRGERGDPGAPGPKG
FT                   KQGESGARGPKGSKGDRGDKGDSGALGPRGPPGQKGDPGATEIIDYNGNLHEALQRITT
FT                   LTVTGPPGPPGPQGLQGPKGEQGSPGIPGVDGEQGLKGSKGDMGDPGVPGEKGGLGLPG
FT                   LPGANGVKGEKGDTGLPGPQGPSIIGPPGPPGPHGPPGPMGPHGLPGPKGASGLDGKPG
FT                   SRGADGPIGPHGPAGPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFPGPRGEKGDL
FT                   GEKGEKGFRGVKGEKGEPGQPGLDGLDAPCQLGPDGLPMPGCWQK"
FT   CDS             16788784..16788858
FT                   /codon_start=1
FT                   /gene="Col25a1"
FT                   /locus_tag="mCG_125680"
FT                   /product="procollagen, type XXV, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG125680.2 transcript_id=mCT126954.0
FT                   protein_id=mCP89443.0 isoform=CRA_a"
FT                   /protein_id="EDL12216.1"
FT                   /translation="MAKIRTAREAPLECNCPAGKTALI"
FT   assembly_gap    16793966..16794054
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    16809609..16809628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16813384..16813403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16814480..16814499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16845686..16845724
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    16861953..16862021
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    16871425..16871495
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    16874934..16874953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16883676..16883792
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    16884974..16885034
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    17035650..17035669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17058648..17058674
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    17101357..17101376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17102821..17102840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17107565..17107584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17108750..17108769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17110076..17113584
FT                   /estimated_length=3509
FT                   /gap_type="unknown"
FT   assembly_gap    17117187..17117297
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    17133852..17133871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17162537..17162688
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            17219733..17238071
FT                   /gene="Agxt2l1"
FT                   /locus_tag="mCG_5262"
FT                   /note="gene_id=mCG5262.2"
FT   mRNA            join(17219733..17219756,17219923..17220031,
FT                   17222626..17222744,17222949..17223108,17224625..17224699,
FT                   17227791..17227881,17228761..17228877,17231067..17231149,
FT                   17231678..17231903,17232831..17232985,17233652..17233741,
FT                   17234043..17234173,17235731..17235798,17236872..17238071)
FT                   /gene="Agxt2l1"
FT                   /locus_tag="mCG_5262"
FT                   /product="alanine-glyoxylate aminotransferase 2-like 1,
FT                   transcript variant mCT174972"
FT                   /note="gene_id=mCG5262.2 transcript_id=mCT174972.0 created
FT                   on 22-OCT-2002"
FT   mRNA            join(17219856..17220031,17222626..17222744,
FT                   17222949..17223108,17224625..17224699,17227791..17227881,
FT                   17228761..17228877,17231067..17231149,17231678..17231903,
FT                   17232831..17232985,17233652..17233741,17234043..17234173,
FT                   17235731..17235798,17236872..17238071)
FT                   /gene="Agxt2l1"
FT                   /locus_tag="mCG_5262"
FT                   /product="alanine-glyoxylate aminotransferase 2-like 1,
FT                   transcript variant mCT4489"
FT                   /note="gene_id=mCG5262.2 transcript_id=mCT4489.2 created on
FT                   22-OCT-2002"
FT   CDS             join(17219976..17220031,17222626..17222744,
FT                   17222949..17223108,17224625..17224699,17227791..17227881,
FT                   17228761..17228877,17231067..17231149,17231678..17231903,
FT                   17232831..17232985,17233652..17233741,17234043..17234173,
FT                   17235731..17235798,17236872..17237000)
FT                   /codon_start=1
FT                   /gene="Agxt2l1"
FT                   /locus_tag="mCG_5262"
FT                   /product="alanine-glyoxylate aminotransferase 2-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5262.2 transcript_id=mCT174972.0
FT                   protein_id=mCP97891.0 isoform=CRA_a"
FT                   /protein_id="EDL12214.1"
FT                   /translation="MCELYSKQDTLVLRERHIGPSCKIFFAADPIKIMRAQGQYMFDEK
FT                   GERYLDCINNVAHVGHCHPEVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELS
FT                   VCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKRE
FT                   TVHVAPAPDTYRGKYREDHEDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQI
FT                   IPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMG
FT                   NGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVG
FT                   TYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLL
FT                   SADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEEAMDSKSGTVFSENTAYRTKM
FT                   PKEIQVELPNLSATEAREIPRGKRNGVCSDQQALLSKRLKT"
FT   CDS             join(17219976..17220031,17222626..17222744,
FT                   17222949..17223108,17224625..17224699,17227791..17227881,
FT                   17228761..17228877,17231067..17231149,17231678..17231903,
FT                   17232831..17232985,17233652..17233741,17234043..17234173,
FT                   17235731..17235798,17236872..17237000)
FT                   /codon_start=1
FT                   /gene="Agxt2l1"
FT                   /locus_tag="mCG_5262"
FT                   /product="alanine-glyoxylate aminotransferase 2-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5262.2 transcript_id=mCT4489.2
FT                   protein_id=mCP19255.2 isoform=CRA_a"
FT                   /protein_id="EDL12215.1"
FT                   /translation="MCELYSKQDTLVLRERHIGPSCKIFFAADPIKIMRAQGQYMFDEK
FT                   GERYLDCINNVAHVGHCHPEVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELS
FT                   VCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKRE
FT                   TVHVAPAPDTYRGKYREDHEDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQI
FT                   IPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMG
FT                   NGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVG
FT                   TYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLL
FT                   SADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEEAMDSKSGTVFSENTAYRTKM
FT                   PKEIQVELPNLSATEAREIPRGKRNGVCSDQQALLSKRLKT"
FT   assembly_gap    17267744..17267930
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    17269092..17270004
FT                   /estimated_length=913
FT                   /gap_type="unknown"
FT   assembly_gap    17278833..17279916
FT                   /estimated_length=1084
FT                   /gap_type="unknown"
FT   gene            complement(17298584..17312083)
FT                   /gene="2310008M10Rik"
FT                   /locus_tag="mCG_5259"
FT                   /note="gene_id=mCG5259.2"
FT   mRNA            complement(join(17298584..17299141,17305980..17306177,
FT                   17308614..17308707,17311901..17312083))
FT                   /gene="2310008M10Rik"
FT                   /locus_tag="mCG_5259"
FT                   /product="RIKEN cDNA 2310008M10"
FT                   /note="gene_id=mCG5259.2 transcript_id=mCT4500.2 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(17299123..17299141,17305980..17306177,
FT                   17308614..17308707,17311901..17312039))
FT                   /codon_start=1
FT                   /gene="2310008M10Rik"
FT                   /locus_tag="mCG_5259"
FT                   /product="RIKEN cDNA 2310008M10"
FT                   /note="gene_id=mCG5259.2 transcript_id=mCT4500.2
FT                   protein_id=mCP19229.1"
FT                   /protein_id="EDL12213.1"
FT                   /translation="METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLIT
FT                   GGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIIL
FT                   DRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG"
FT   gene            complement(17329498..17333025)
FT                   /locus_tag="mCG_5258"
FT                   /note="gene_id=mCG5258.2"
FT   mRNA            complement(join(17329498..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331969,17332985..17333025))
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, transcript variant mCT174971"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT174971.0 created
FT                   on 05-MAR-2003"
FT   mRNA            complement(join(17329498..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331969,17332788..17332990))
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, transcript variant mCT4499"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT4499.2 created on
FT                   05-MAR-2003"
FT   mRNA            complement(join(17329498..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331931,17332918..>17332952))
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, transcript variant mCT180909"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT180909.0 created
FT                   on 05-MAR-2003"
FT   CDS             complement(join(17329542..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331931,17332918..>17332952))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, isoform CRA_b"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT180909.0
FT                   protein_id=mCP103831.0 isoform=CRA_b"
FT                   /protein_id="EDL12211.1"
FT                   /translation="YRLRSVAIRGVRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPK
FT                   SACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKI
FT                   VVKVLKAQAQSQKAK"
FT   CDS             complement(join(17329542..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331960))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, isoform CRA_a"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT174971.0
FT                   protein_id=mCP97890.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D1R9"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="MGI:MGI:1915686"
FT                   /protein_id="EDL12210.1"
FT                   /translation="MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSA
FT                   CGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVV
FT                   KVLKAQAQSQKAK"
FT   CDS             complement(join(17329542..17329626,17331415..17331518,
FT                   17331718..17331817,17331896..17331960))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5258"
FT                   /product="mCG5258, isoform CRA_a"
FT                   /note="gene_id=mCG5258.2 transcript_id=mCT4499.2
FT                   protein_id=mCP19282.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D1R9"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="MGI:MGI:1915686"
FT                   /protein_id="EDL12212.1"
FT                   /translation="MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSA
FT                   CGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVV
FT                   KVLKAQAQSQKAK"
FT   assembly_gap    17339733..17339752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17344358..17345738
FT                   /estimated_length=1381
FT                   /gap_type="unknown"
FT   assembly_gap    17380036..17380554
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    17382203..17382222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17428372..17428391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17429528..17429547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17430911..17430930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17432265..17432284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17444264..>17447922)
FT                   /locus_tag="mCG_1045855"
FT                   /note="gene_id=mCG1045855.0"
FT   mRNA            complement(join(17444264..17444735,17447874..>17447922))
FT                   /locus_tag="mCG_1045855"
FT                   /product="mCG1045855"
FT                   /note="gene_id=mCG1045855.0 transcript_id=mCT163559.0
FT                   created on 10-JAN-2003"
FT   CDS             complement(join(17444365..17444735,17447874..>17447883))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045855"
FT                   /product="mCG1045855"
FT                   /note="gene_id=mCG1045855.0 transcript_id=mCT163559.0
FT                   protein_id=mCP89667.0"
FT                   /protein_id="EDL12209.1"
FT                   /translation="RQGVHGFHLRGRCHKSTFQKLPLAPSFLFDYVLAQSPASNTEPLF
FT                   GPLQLEDNRISHLPFNTPNPHKAAILEATRNNSSDVRKTVISILVYLGQTHLGRPLKQR
FT                   HPEHRESEAPDTNYKLGTKYHN"
FT   assembly_gap    17450616..17450955
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    17451884..17452702
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    17465087..17465106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17472384..17472403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17475058..17475077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17482293..17483650
FT                   /estimated_length=1358
FT                   /gap_type="unknown"
FT   assembly_gap    17494297..17495259
FT                   /estimated_length=963
FT                   /gap_type="unknown"
FT   assembly_gap    17499103..17499217
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    17502900..17502919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17525978..17525997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17531620..17531838
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            complement(17534969..17536684)
FT                   /locus_tag="mCG_5260"
FT                   /note="gene_id=mCG5260.1"
FT   mRNA            complement(17534969..17536684)
FT                   /locus_tag="mCG_5260"
FT                   /product="mCG5260"
FT                   /note="gene_id=mCG5260.1 transcript_id=mCT4501.1 created on
FT                   22-OCT-2002"
FT   CDS             complement(17535624..17536589)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5260"
FT                   /product="mCG5260"
FT                   /note="gene_id=mCG5260.1 transcript_id=mCT4501.1
FT                   protein_id=mCP19225.2"
FT                   /protein_id="EDL12208.1"
FT                   /translation="MSILRIHAREIFDSHGNPTVVVDLYTTKGLFRAAVPSGASTGISE
FT                   ALELRDNDKTRFMGKGVSWAVEHINNTIAPALVSKKVSVVEQETIDQLMIEMDGTENKS
FT                   KFGANAILGVSLAVCKAGAMEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKL
FT                   AMQEFMILPVGASSFREAMHIGAEVYHNLKNVIKEKYGKDATNVGDEGGFASNILENKE
FT                   ALLLLKTAMAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYK
FT                   SFIQNYPVVSIEDPFDQTTGAPGRSSRLVRASRWWVMTSQ"
FT   assembly_gap    17544127..17544270
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    17545046..17545303
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    17563032..17563062
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    17611364..17611383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17627186..17627205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17634258..17634577
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    17639861..17639995
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    17650514..17650853
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    17670646..17670947
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    17673491..17673510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17686388..17686766
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    17689353..17689875
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    17693527..17693770
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    17708346..17708365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17714295..17716566
FT                   /estimated_length=2272
FT                   /gap_type="unknown"
FT   gene            17717205..17832357
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /note="gene_id=mCG10208.2"
FT   mRNA            join(17717205..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17799017..17799100,17801123..17801245,17802621..17802783,
FT                   17808295..17808402,17812256..17812304,17812933..17812973,
FT                   17831075..17832357)
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, transcript
FT                   variant mCT10193"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT10193.2 created
FT                   on 22-OCT-2002"
FT   mRNA            join(17717205..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17801123..17801245,17802621..17802783,17808295..17808402,
FT                   17812256..17812304,17812933..17812973,17831075..17832357)
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, transcript
FT                   variant mCT174980"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174980.0 created
FT                   on 22-OCT-2002"
FT   mRNA            join(17717205..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17801123..17801245,17802621..17802783,17808295..17808402,
FT                   17812256..17812304,17831075..17832357)
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, transcript
FT                   variant mCT174979"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174979.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(17717893..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17801123..17801245,17802621..17802783,17808295..17808402,
FT                   17812256..17812304,17831075..17831154)
FT                   /codon_start=1
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174979.0
FT                   protein_id=mCP97897.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BGZ9"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR013558"
FT                   /db_xref="InterPro:IPR024940"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="InterPro:IPR028769"
FT                   /db_xref="MGI:MGI:96770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGZ9"
FT                   /protein_id="EDL12206.1"
FT                   /translation="MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEE
FT                   GDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGP
FT                   SYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHF
FT                   SPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWFSHHMIPGPPG
FT                   PHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMK
FT                   EMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARD
FT                   NYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC"
FT   CDS             join(17717893..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17799017..17799100,17801123..17801245,17802621..17802783,
FT                   17808295..17808402,17812256..17812304,17812933..17812967)
FT                   /codon_start=1
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT10193.2
FT                   protein_id=mCP19207.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TYB0"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR013558"
FT                   /db_xref="InterPro:IPR024940"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:96770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYB0"
FT                   /protein_id="EDL12204.1"
FT                   /translation="MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEE
FT                   GDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGP
FT                   SYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHF
FT                   SPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGG
FT                   FRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVK
FT                   PQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSR
FT                   EEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI"
FT   CDS             join(17717893..17718099,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17801123..17801245,17802621..17802783,17808295..17808402,
FT                   17812256..17812304,17812933..17812967)
FT                   /codon_start=1
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174980.0
FT                   protein_id=mCP97898.0 isoform=CRA_d"
FT                   /db_xref="GOA:D3Z654"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR013558"
FT                   /db_xref="InterPro:IPR024940"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="InterPro:IPR028769"
FT                   /db_xref="MGI:MGI:96770"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z654"
FT                   /protein_id="EDL12207.1"
FT                   /translation="MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEE
FT                   GDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGP
FT                   SYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHF
FT                   SPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWFSHHMIPGPPG
FT                   PHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMK
FT                   EMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARD
FT                   NYGKKKKRKREKLQESTSGTGPRMTAAYI"
FT   mRNA            join(17719221..17719241,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17799017..17799100,17801123..17801245,17802621..17802783,
FT                   17808295..17808402,17812256..17812304,17812933..17812973,
FT                   17831075..17832357)
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, transcript
FT                   variant mCT174978"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174978.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(17719233..17719241,17720277..17720343,
FT                   17721834..17721967,17792637..17792769,17797329..17797419,
FT                   17799017..17799100,17801123..17801245,17802621..17802783,
FT                   17808295..17808402,17812256..17812304,17812933..17812967)
FT                   /codon_start=1
FT                   /gene="Lef1"
FT                   /locus_tag="mCG_10208"
FT                   /product="lymphoid enhancer binding factor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG10208.2 transcript_id=mCT174978.0
FT                   protein_id=mCP97899.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C402"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR013558"
FT                   /db_xref="InterPro:IPR024940"
FT                   /db_xref="MGI:MGI:96770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C402"
FT                   /protein_id="EDL12205.1"
FT                   /translation="MAGVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSG
FT                   YIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPS
FT                   HIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPS
FT                   SLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRK
FT                   EQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYY
FT                   ELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI"
FT   assembly_gap    17723891..17723910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17739828..17739847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17740964..17741090
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    17748075..17748094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17755506..17755525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17779464..17779483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17788068..17788087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17817267..17818769
FT                   /estimated_length=1503
FT                   /gap_type="unknown"
FT   assembly_gap    17836385..17836532
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    17836741..17837235
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   gene            complement(17841606..17880122)
FT                   /gene="Hadhsc"
FT                   /locus_tag="mCG_10207"
FT                   /note="gene_id=mCG10207.1"
FT   mRNA            complement(join(17841606..17842438,17843694..17843810,
FT                   17849088..17849160,17850667..17850756,17853310..17853436,
FT                   17856566..17856723,17857953..17858081,17879971..17880122))
FT                   /gene="Hadhsc"
FT                   /locus_tag="mCG_10207"
FT                   /product="L-3-hydroxyacyl-Coenzyme A dehydrogenase, short
FT                   chain"
FT                   /note="gene_id=mCG10207.1 transcript_id=mCT10192.1 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(17842320..17842438,17843694..17843810,
FT                   17849088..17849160,17850667..17850756,17853310..17853436,
FT                   17856566..17856723,17857953..17858081,17879971..17880102))
FT                   /codon_start=1
FT                   /gene="Hadhsc"
FT                   /locus_tag="mCG_10207"
FT                   /product="L-3-hydroxyacyl-Coenzyme A dehydrogenase, short
FT                   chain"
FT                   /note="gene_id=mCG10207.1 transcript_id=mCT10192.1
FT                   protein_id=mCP19185.1"
FT                   /protein_id="EDL12203.1"
FT                   /translation="MAFVTRQFLRSMSSSSSASAAAKKILIKHVTVIGGGLMGAGIAQV
FT                   AAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKKFTENPKAGDEFVEKTLSCLSTST
FT                   DAASVVHSTDLVVEAIVENLKLKNELFQRLDKFAAEHTIFASNTSSLQITNIANATTRQ
FT                   DRFAGLHFFNPVPMMKLVEVIKTPMTSQKTFESLVDFCKTLGKHPVSCKDTPGFIVNRL
FT                   LVPYLIEAVRLHERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFILDGWHEME
FT                   PENPLFQPSPSMNNLVAQKKLGKKTGEGFYKYK"
FT   assembly_gap    17875991..17876010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17892249..17893171)
FT                   /pseudo
FT                   /locus_tag="mCG_48952"
FT                   /note="gene_id=mCG48952.2"
FT   mRNA            complement(join(17892249..17892810,17893052..17893171))
FT                   /pseudo
FT                   /locus_tag="mCG_48952"
FT                   /note="gene_id=mCG48952.2 transcript_id=mCT49135.2 created
FT                   on 04-DEC-2002"
FT   gene            complement(17901323..>17911245)
FT                   /locus_tag="mCG_10210"
FT                   /note="gene_id=mCG10210.3"
FT   mRNA            complement(join(17901323..17901700,17903404..17903565,
FT                   17905802..17906437,17910696..17911218))
FT                   /locus_tag="mCG_10210"
FT                   /product="mCG10210, transcript variant mCT10195"
FT                   /note="gene_id=mCG10210.3 transcript_id=mCT10195.1 created
FT                   on 22-OCT-2002"
FT   CDS             complement(join(17901441..17901700,17903404..17903565,
FT                   17905802..17906437,17910696..17911143))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10210"
FT                   /product="mCG10210, isoform CRA_a"
FT                   /note="gene_id=mCG10210.3 transcript_id=mCT10195.1
FT                   protein_id=mCP19226.1 isoform=CRA_a"
FT                   /protein_id="EDL12201.1"
FT                   /translation="MSSLGDQRPAAGEQPGARLHVRATGGALLLCLLAVLLGWVWLRRQ
FT                   RACGIPPGPKPRPLVGNFGHLLVPRFLRPQFWLGSGSQTDTVGQHVYLARMARVYGNIF
FT                   SFFIGHRLVVVLSDFHSVREALVQQAEVFSDRPRMPLISIMTKEKGIVFAHYGPIWKQQ
FT                   RRFSHSTLRHFGLGKLSLEPRIIEEFAYVKEAMQKHGEAPFSPFPIISNAVSNIICSLC
FT                   FGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINICPWFYYLPFGPFKELRQIERDIS
FT                   CFLKNIIREHQESLDASNPQDFIDMYLLHMEEEQGASRRSSFDEDYLFYIIGDLFIAGT
FT                   DTTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRL
FT                   SMVVPLAIPHMTSEKTVLQGFTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQG
FT                   QLLKRETFIPFGIGQLKLGFNLFFTLSLVCVCVCVCVCVYRHV"
FT   mRNA            complement(join(17902426..17903071,17903404..17903565,
FT                   17905802..17906072,17906178..17906437,17910696..>17911245))
FT                   /locus_tag="mCG_10210"
FT                   /product="mCG10210, transcript variant mCT190586"
FT                   /note="gene_id=mCG10210.3 transcript_id=mCT190586.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(17903067..17903071,17903404..17903565,
FT                   17905802..17906072,17906178..17906437,17910696..>17911245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10210"
FT                   /product="mCG10210, isoform CRA_b"
FT                   /note="gene_id=mCG10210.3 transcript_id=mCT190586.0
FT                   protein_id=mCP111530.0 isoform=CRA_b"
FT                   /protein_id="EDL12202.1"
FT                   /translation="VPCPASRLTLSHVAGYCRGAGASAAELDAGGTWDMSSLGDQRPAA
FT                   GEQPGARLHVRATGGALLLCLLAVLLGWVWLRRQRACGIPPGPKPRPLVGNFGHLLVPR
FT                   FLRPQFWLGSGSQTDTVGQHVYLARMARVYGNIFSFFIGHRLVVVLSDFHSVREALVQQ
FT                   AEVFSDRPRMPLISIMTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEE
FT                   FAYVKEAMQKHGEAPFSPFPIISNAVSNIICSLCFGQRFDYTNKEFKKELRQIERDISC
FT                   FLKNIIREHQESLDASNPQDFIDMYLLHMEEEQGASRRSSFDEDYLFYIIGDLFIAGTD
FT                   TTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRLS
FT                   MVVPLAIPHMTSEKTA"
FT   assembly_gap    17917197..17917490
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    17925774..17927101
FT                   /estimated_length=1328
FT                   /gap_type="unknown"
FT   gene            complement(17931424..18009562)
FT                   /gene="4933405A16Rik"
FT                   /locus_tag="mCG_10209"
FT                   /note="gene_id=mCG10209.2"
FT   mRNA            complement(join(17931424..17931996,17933633..17933799,
FT                   17939018..17939171,17944860..17944977,17950464..17951155,
FT                   18009281..18009562))
FT                   /gene="4933405A16Rik"
FT                   /locus_tag="mCG_10209"
FT                   /product="RIKEN cDNA 4933405A16, transcript variant
FT                   mCT174943"
FT                   /note="gene_id=mCG10209.2 transcript_id=mCT174943.0 created
FT                   on 22-OCT-2002"
FT   mRNA            complement(join(17931424..17931996,17933633..17933799,
FT                   17939018..17939171,17944860..17944977,17950464..17951155,
FT                   17953301..17953649))
FT                   /gene="4933405A16Rik"
FT                   /locus_tag="mCG_10209"
FT                   /product="RIKEN cDNA 4933405A16, transcript variant
FT                   mCT10194"
FT                   /note="gene_id=mCG10209.2 transcript_id=mCT10194.2 created
FT                   on 22-OCT-2002"
FT   CDS             complement(join(17931793..17931996,17933633..17933799,
FT                   17939018..17939171,17944860..17944977,17950464..17950918))
FT                   /codon_start=1
FT                   /gene="4933405A16Rik"
FT                   /locus_tag="mCG_10209"
FT                   /product="RIKEN cDNA 4933405A16, isoform CRA_a"
FT                   /note="gene_id=mCG10209.2 transcript_id=mCT10194.2
FT                   protein_id=mCP19224.2 isoform=CRA_a"
FT                   /protein_id="EDL12199.1"
FT                   /translation="MDIIETAKLEGHLESQTNDSTNTYTSPTEAVEEEGKNGKGKPKTL
FT                   SNGLRKGAKKYPDYIQISMPNDSKNKFPLEWWKTGIAFVYALFNLILTTVMITVVHERV
FT                   PPKELSPPLPDKFFDYFDRVKWAFSVSEINGMVLVGLWITQWLFLRYKSIVGRRFFFIM
FT                   GTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKIQRILRLISGGGLSITGSHILCG
FT                   DFLFSGHTVVLTLTYLFIKEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAY
FT                   YITTRLFWWYHSMANEKNLKVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWP
FT                   PGCFKSSCRKYSRVQKIGEDNEKST"
FT   CDS             complement(join(17931793..17931996,17933633..17933799,
FT                   17939018..17939171,17944860..17944977,17950464..17950918))
FT                   /codon_start=1
FT                   /gene="4933405A16Rik"
FT                   /locus_tag="mCG_10209"
FT                   /product="RIKEN cDNA 4933405A16, isoform CRA_a"
FT                   /note="gene_id=mCG10209.2 transcript_id=mCT174943.0
FT                   protein_id=mCP97862.0 isoform=CRA_a"
FT                   /protein_id="EDL12200.1"
FT                   /translation="MDIIETAKLEGHLESQTNDSTNTYTSPTEAVEEEGKNGKGKPKTL
FT                   SNGLRKGAKKYPDYIQISMPNDSKNKFPLEWWKTGIAFVYALFNLILTTVMITVVHERV
FT                   PPKELSPPLPDKFFDYFDRVKWAFSVSEINGMVLVGLWITQWLFLRYKSIVGRRFFFIM
FT                   GTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKIQRILRLISGGGLSITGSHILCG
FT                   DFLFSGHTVVLTLTYLFIKEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAY
FT                   YITTRLFWWYHSMANEKNLKVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWP
FT                   PGCFKSSCRKYSRVQKIGEDNEKST"
FT   assembly_gap    17952962..17953020
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    17960975..17961233
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    17972118..17972406
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    17980752..17981786
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    17992249..17993392
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    18002725..18003140
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    18007567..18008513
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   assembly_gap    18020034..18020467
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    18027572..18027591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18043140..18043163
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    18060388..18061734
FT                   /estimated_length=1347
FT                   /gap_type="unknown"
FT   assembly_gap    18074082..18074229
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   gene            18084598..18164430
FT                   /gene="Papss1"
FT                   /locus_tag="mCG_10206"
FT                   /note="gene_id=mCG10206.1"
FT   mRNA            join(18084598..18084690,18099060..18099174,
FT                   18102130..18102365,18102836..18102974,18104797..18104915,
FT                   18119685..18119798,18121795..18121906,18125665..18125870,
FT                   18127148..18127283,18138721..18138989,18152344..18152573,
FT                   18163723..18164430)
FT                   /gene="Papss1"
FT                   /locus_tag="mCG_10206"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate synthase 1,
FT                   transcript variant mCT10191"
FT                   /note="gene_id=mCG10206.1 transcript_id=mCT10191.1 created
FT                   on 23-JUL-2002"
FT   mRNA            join(18084611..18084690,18087209..18087385,
FT                   18099060..18099174,18102130..18102365,18102836..18102974,
FT                   18104797..18104915,18119685..18119798,18121795..18121906,
FT                   18125665..18125870,18127148..18127283,18138721..18138989,
FT                   18152344..18152573,18163723..18164430)
FT                   /gene="Papss1"
FT                   /locus_tag="mCG_10206"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate synthase 1,
FT                   transcript variant mCT170956"
FT                   /note="gene_id=mCG10206.1 transcript_id=mCT170956.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(18084631..18084690,18099060..18099174,
FT                   18102130..18102365,18102836..18102974,18104797..18104915,
FT                   18119685..18119798,18121795..18121906,18125665..18125870,
FT                   18127148..18127283,18138721..18138989,18152344..18152573,
FT                   18163723..18163861)
FT                   /codon_start=1
FT                   /gene="Papss1"
FT                   /locus_tag="mCG_10206"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate synthase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG10206.1 transcript_id=mCT10191.1
FT                   protein_id=mCP19285.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U647"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1330587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U647"
FT                   /protein_id="EDL12198.1"
FT                   /translation="MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVG
FT                   TRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPE
FT                   DREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLH
FT                   VCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQE
FT                   RDIVPVDASYEVKELYVPENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGF
FT                   MREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRN
FT                   PEFFEHRKEERCARQWGTTCKNHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLT
FT                   PTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWT
FT                   KDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANF
FT                   YIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYD
FT                   SEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEYYKSLEKA"
FT   assembly_gap    18091305..18091468
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    18097352..18097623
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   CDS             join(18099063..18099174,18102130..18102365,
FT                   18102836..18102974,18104797..18104915,18119685..18119798,
FT                   18121795..18121906,18125665..18125870,18127148..18127283,
FT                   18138721..18138989,18152344..18152573,18163723..18163861)
FT                   /codon_start=1
FT                   /gene="Papss1"
FT                   /locus_tag="mCG_10206"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate synthase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG10206.1 transcript_id=mCT170956.0
FT                   protein_id=mCP93874.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6NZM8"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1330587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NZM8"
FT                   /protein_id="EDL12197.1"
FT                   /translation="MQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKT
FT                   TVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGL
FT                   VCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKG
FT                   FTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENK
FT                   LHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVI
FT                   NLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFFEHRKEERCARQWGTTCK
FT                   NHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
FT                   RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEG
FT                   ILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYE
FT                   PTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLARE
FT                   GQKPPEGFMAPKAWTVLVEYYKSLEKA"
FT   assembly_gap    18109091..18109480
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    18119016..18119040
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    18128441..18129740
FT                   /estimated_length=1300
FT                   /gap_type="unknown"
FT   assembly_gap    18143917..18143936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18165961..18165980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18229195..18230394
FT                   /estimated_length=1200
FT                   /gap_type="unknown"
FT   assembly_gap    18238152..18238952
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   assembly_gap    18252481..18253348
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   gene            18280051..18538264
FT                   /locus_tag="mCG_147417"
FT                   /note="gene_id=mCG147417.0"
FT   mRNA            join(18280051..18280097,18481967..18482064,
FT                   18492709..18492817,18538064..18538264)
FT                   /locus_tag="mCG_147417"
FT                   /product="mCG147417"
FT                   /note="gene_id=mCG147417.0 transcript_id=mCT187680.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    18289386..18289405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18291868..18291887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18345457..18347404
FT                   /estimated_length=1948
FT                   /gap_type="unknown"
FT   assembly_gap    18349724..18350011
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    18366252..18366288
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    18370442..18370461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18384208..18384260
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    18398854..18400173
FT                   /estimated_length=1320
FT                   /gap_type="unknown"
FT   assembly_gap    18423317..18423336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18445742..18445986
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    18449886..18450480
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   CDS             join(18492800..18492817,18538064..18538174)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147417"
FT                   /product="mCG147417"
FT                   /note="gene_id=mCG147417.0 transcript_id=mCT187680.0
FT                   protein_id=mCP109640.0"
FT                   /protein_id="EDL12196.1"
FT                   /translation="MTQLVKDPWLLYGSHHQAACHEAAHHDAPCQRMNGWNQQIFH"
FT   assembly_gap    18493564..18493583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18524492..18524511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18532878..18532898
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    18574845..18574864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18577052..18579024
FT                   /estimated_length=1973
FT                   /gap_type="unknown"
FT   assembly_gap    18580890..18580909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18582530..18582549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18584229..18584248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18586072..18586091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18588404..18588423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18592903..18592922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18599064..18692777
FT                   /gene="Dkk2"
FT                   /locus_tag="mCG_50274"
FT                   /note="gene_id=mCG50274.1"
FT   mRNA            join(18599064..18599410,18686905..18687055,
FT                   18688090..18688245,18690991..18692777)
FT                   /gene="Dkk2"
FT                   /locus_tag="mCG_50274"
FT                   /product="dickkopf homolog 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG50274.1 transcript_id=mCT50457.1 created
FT                   on 23-JUL-2002"
FT   CDS             join(18599189..18599410,18686905..18687055,
FT                   18688090..18688245,18690991..18691241)
FT                   /codon_start=1
FT                   /gene="Dkk2"
FT                   /locus_tag="mCG_50274"
FT                   /product="dickkopf homolog 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG50274.1 transcript_id=mCT50457.1
FT                   protein_id=mCP39684.2"
FT                   /db_xref="GOA:Q9QYZ8"
FT                   /db_xref="InterPro:IPR006796"
FT                   /db_xref="MGI:MGI:1890663"
FT                   /db_xref="PDB:2JTK"
FT                   /protein_id="EDL12195.1"
FT                   /translation="MAALMRVKDSSRCLLLLAAVLMVESSQLGSSRAKLNSIKSSLGGE
FT                   TPAQSANRSAGMNQGLAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMLCR
FT                   RKKKRCHRDGMCCPGTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQ
FT                   NLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGS
FT                   HGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI"
FT   assembly_gap    18721686..18721705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18748654..18749026
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    18756148..18756167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18759767..18759786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18760898..18760917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18762021..18762040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18763137..18763156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18764161..18764602
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    18773134..18773153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18822241..18822324
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    18843987..18844006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18846059..18846078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18848070..18848089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18849596..18849615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18853280..18853299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18861147..18861334
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    18865919..18865938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18870545..18870564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18879054..18879266
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    18888101..18888120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18910438..18910457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18931738..18931757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18964348..18964487
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    18966363..18966382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18970022..18970041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19020924..19021301
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    19047515..19047720
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    19058615..19058634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19072379..19072560
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    19075480..19076036
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    19094046..19094160
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    19131488..19132175
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    19166801..19166939
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    19170621..19170885
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   gene            complement(19176039..19199358)
FT                   /gene="Scye1"
FT                   /locus_tag="mCG_20854"
FT                   /note="gene_id=mCG20854.1"
FT   mRNA            complement(join(19176039..19176277,19182909..19183077,
FT                   19187507..19187715,19189493..19189657,19190277..19190390,
FT                   19192533..19192666,19199321..19199358))
FT                   /gene="Scye1"
FT                   /locus_tag="mCG_20854"
FT                   /product="small inducible cytokine subfamily E, member 1"
FT                   /note="gene_id=mCG20854.1 transcript_id=mCT21750.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(19176111..19176277,19182909..19183077,
FT                   19187507..19187715,19189493..19189657,19190277..19190390,
FT                   19192533..19192641))
FT                   /codon_start=1
FT                   /gene="Scye1"
FT                   /locus_tag="mCG_20854"
FT                   /product="small inducible cytokine subfamily E, member 1"
FT                   /note="gene_id=mCG20854.1 transcript_id=mCT21750.0
FT                   protein_id=mCP19265.1"
FT                   /protein_id="EDL12194.1"
FT                   /translation="MATNDAVLKRLEQKGAEADQIIEYLKQQVALLKEKAILQATMREE
FT                   KKLRVENAKLKKEIEELKQELILAEIHNGVEQVRVRLSTPLQTNCTASESVVQSPSVAT
FT                   TASPATKEQIKAGEEKKVKEKTEKKGEKKEKQQSAAASTDSKPIDASRLDLRIGCIVTA
FT                   KKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQ
FT                   AMVMCASSPEKVEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAE
FT                   CVATYKGAPFEVKGKGVCRAQTMANSGIK"
FT   gene            19199697..19352409
FT                   /gene="A630047E20Rik"
FT                   /locus_tag="mCG_123751"
FT                   /note="gene_id=mCG123751.1"
FT   mRNA            join(19199697..19199922,19202302..19202522,
FT                   19209893..19209965,19221045..19221159,19223318..19223391,
FT                   19231121..19231262,19234152..19234212,19236053..19236114,
FT                   19237838..19237899,19238200..19238348,19240308..19240446,
FT                   19242323..19242370,19242715..19242844,19247830..19247928,
FT                   19250026..19250088,19250397..19250523,19251753..19251803,
FT                   19253182..19253265,19258700..19258785,19266885..19266921,
FT                   19268206..19268367,19290308..19290483,19317780..19317955,
FT                   19331378..19331537,19348681..19352409)
FT                   /gene="A630047E20Rik"
FT                   /locus_tag="mCG_123751"
FT                   /product="RIKEN cDNA A630047E20"
FT                   /note="gene_id=mCG123751.1 transcript_id=mCT124987.1
FT                   created on 22-OCT-2002"
FT   CDS             join(19202330..19202522,19209893..19209965,
FT                   19221045..19221159,19223318..19223391,19231121..19231262,
FT                   19234152..19234212,19236053..19236114,19237838..19237899,
FT                   19238200..19238348,19240308..19240446,19242323..19242370,
FT                   19242715..19242844,19247830..19247928,19250026..19250088,
FT                   19250397..19250523,19251753..19251803,19253182..19253265,
FT                   19258700..19258785,19266885..19266921,19268206..19268367,
FT                   19290308..19290483,19317780..19317955,19331378..19331537,
FT                   19348681..19348791)
FT                   /codon_start=1
FT                   /gene="A630047E20Rik"
FT                   /locus_tag="mCG_123751"
FT                   /product="RIKEN cDNA A630047E20"
FT                   /note="gene_id=mCG123751.1 transcript_id=mCT124987.1
FT                   protein_id=mCP89172.1"
FT                   /protein_id="EDL12193.1"
FT                   /translation="MFPLKDAEMGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQIL
FT                   KTITHPRLCQYVDISRGKHERLVVVAEHCERSLEDLLRERKPVSHSTVLCIAYEVLEGL
FT                   HYLNKHGIVHRALSPHNILLDRKGHIKLAKFGLYHMTAHGDDVDFPIGYPSYLAPEVIA
FT                   QGIPKTTDHVPSEKPLPSGPKSDVWSLGIILFELCVGRKLFQSLDVSERVKFLLTLGCV
FT                   DDTIIVLAEEHGCLDIIKELPENVINILKKCLTFHPSKRPTPDELMKDQVFSEVSPLYT
FT                   PFIKPASLFSSSLRCADLTLPEDISDLCKDIDNDYLAERSIEEVYYLWCLAGGDLEKEL
FT                   INKEIIRSKPPVCTLPKLKDVGGEAFYPLLEDDQSNLPHSNSNNELSAAATLPLIIRER
FT                   DTEYQLNRIILFDRLLKAYPYKKNQIWKEARVDIPPLMRGLTWAALLGVEGAIHAKYDA
FT                   IDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHPDLVYWQGLDSL
FT                   CAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQMIAFHDPELSN
FT                   HLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGVAILQQLRDR
FT                   LLANGFNECILLFSDLPEIDIERCVRESVNLFCWTPKSATYRQHAQPPKPASESSVVRS
FT                   SAPYFSAECTDPPKTDLSRESIPLSDLKSEVSPRISAEDLIDLCELTVTGHFKTPTKKT
FT                   KSSKPKLLVVDIRNSEDFVRGHIAGSINIPFSAAFTAEGELSQGPYTTMLHNFKGKVIV
FT                   VVGHVAKQTAEFAAHLVKMKYPRVCILDGGINKIRPTGLLTVPSPQI"
FT   assembly_gap    19241055..19241463
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    19291870..19291889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19294437..19294456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19332620..19332694
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    19338464..19338483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19339853..19339872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19352940..19355261
FT                   /pseudo
FT                   /locus_tag="mCG_1045554"
FT                   /note="gene_id=mCG1045554.1"
FT   mRNA            19352940..19355261
FT                   /pseudo
FT                   /locus_tag="mCG_1045554"
FT                   /note="gene_id=mCG1045554.1 transcript_id=mCT163258.1
FT                   created on 15-NOV-2002"
FT   gene            complement(19392483..19461365)
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /note="gene_id=mCG20859.2"
FT   mRNA            complement(join(19392483..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19428201..19428293,19459077..19459177,
FT                   19461046..19461365))
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, transcript variant mCT170963"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT170963.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(19392483..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19425105..19425197,19428201..19428293,
FT                   19459077..19459177,19461046..19461365))
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, transcript variant mCT170964"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT170964.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(19392483..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19425105..19425197,19428201..19428293,
FT                   19442532..19442582,19459077..19459177,19461046..19461365))
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, transcript variant mCT21958"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT21958.2 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(19395166..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19428201..19428293,19459077..19459177,
FT                   19461046..19461116))
FT                   /codon_start=1
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, isoform CRA_a"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT170963.0
FT                   protein_id=mCP93882.0 isoform=CRA_a"
FT                   /protein_id="EDL12190.1"
FT                   /translation="MAVLLAAVLASSLYLQVAADFDGRWPRQIVSSIGLCRYGGRIDCC
FT                   WGWARQSWGQCQPVCQPQCKHGECVGPNKCKCHPGFAGKTCNQDLNECGLKPRPCKHRC
FT                   MNTFGSYKCYCLNGYMLLPDGSCSSALSCSMANCQYGCDVVKGQVRCQCPSPGLQLAPD
FT                   GRTCVDIDECATGRVSCPRFRQCVNTFGSYICKCHTGFDLMYIGGKYQCHDIDECSLGQ
FT                   HQCSSYARCYNIHGSYKCQCRDGYEGDGLNCVYIPKVMIEPSGPIHMPERNGTISKGDG
FT                   GHANRIPDAGSTRWPLKTPYIPPVITNRPTSKPTTRPTPNPTPQPTPPPPPPLPTEPRT
FT                   TPLPPTPERPSTRPTTIAPATSTTTRVITVDNRIQTDPQKPRGDVFIPRQPTNDLFEIF
FT                   EIERGVSADEEVKDDPGILIHSCNFDHGLCGWIREKDSDLHWETARDPAGGQYLTVSAA
FT                   KAPGGKAARLVLRLGHLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGTHGAALWGRNGG
FT                   HGWRQTQITLRGADVKSVIFKGEKRRGHTGEIGLDDVSLKRGRC"
FT   CDS             complement(join(19395166..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19425105..19425197,19428201..19428293,
FT                   19459077..19459177,19461046..19461116))
FT                   /codon_start=1
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, isoform CRA_b"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT170964.0
FT                   protein_id=mCP93881.0 isoform=CRA_b"
FT                   /protein_id="EDL12191.1"
FT                   /translation="MAVLLAAVLASSLYLQVAADFDGRWPRQIVSSIGLCRYGGRIDCC
FT                   WGWARQSWGQCQPVCQPQCKHGECVGPNKCKCHPGFAGKTCNQDESFHPTPLDQGSEQP
FT                   LFQPPDHQATNVPSRDLNECGLKPRPCKHRCMNTFGSYKCYCLNGYMLLPDGSCSSALS
FT                   CSMANCQYGCDVVKGQVRCQCPSPGLQLAPDGRTCVDIDECATGRVSCPRFRQCVNTFG
FT                   SYICKCHTGFDLMYIGGKYQCHDIDECSLGQHQCSSYARCYNIHGSYKCQCRDGYEGDG
FT                   LNCVYIPKVMIEPSGPIHMPERNGTISKGDGGHANRIPDAGSTRWPLKTPYIPPVITNR
FT                   PTSKPTTRPTPNPTPQPTPPPPPPLPTEPRTTPLPPTPERPSTRPTTIAPATSTTTRVI
FT                   TVDNRIQTDPQKPRGDVFIPRQPTNDLFEIFEIERGVSADEEVKDDPGILIHSCNFDHG
FT                   LCGWIREKDSDLHWETARDPAGGQYLTVSAAKAPGGKAARLVLRLGHLMHSGDLCLSFR
FT                   HKVTGLHSGTLQVFVRKHGTHGAALWGRNGGHGWRQTQITLRGADVKSVIFKGEKRRGH
FT                   TGEIGLDDVSLKRGRC"
FT   CDS             complement(join(19395166..19395249,19396492..19396748,
FT                   19401500..19401598,19402138..19402224,19415386..19415781,
FT                   19417075..19417197,19417423..19417557,19419071..19419190,
FT                   19420628..19420747,19425105..19425197,19428201..19428293,
FT                   19442532..19442582,19459077..19459177,19461046..19461116))
FT                   /codon_start=1
FT                   /gene="Npnt"
FT                   /locus_tag="mCG_20859"
FT                   /product="nephronectin, isoform CRA_c"
FT                   /note="gene_id=mCG20859.2 transcript_id=mCT21958.2
FT                   protein_id=mCP19215.2 isoform=CRA_c"
FT                   /protein_id="EDL12192.1"
FT                   /translation="MAVLLAAVLASSLYLQVAADFDGRWPRQIVSSIGLCRYGGRIDCC
FT                   WGWARQSWGQCQPFYVLRQRLARIRCQLKAVCQPQCKHGECVGPNKCKCHPGFAGKTCN
FT                   QDESFHPTPLDQGSEQPLFQPPDHQATNVPSRDLNECGLKPRPCKHRCMNTFGSYKCYC
FT                   LNGYMLLPDGSCSSALSCSMANCQYGCDVVKGQVRCQCPSPGLQLAPDGRTCVDIDECA
FT                   TGRVSCPRFRQCVNTFGSYICKCHTGFDLMYIGGKYQCHDIDECSLGQHQCSSYARCYN
FT                   IHGSYKCQCRDGYEGDGLNCVYIPKVMIEPSGPIHMPERNGTISKGDGGHANRIPDAGS
FT                   TRWPLKTPYIPPVITNRPTSKPTTRPTPNPTPQPTPPPPPPLPTEPRTTPLPPTPERPS
FT                   TRPTTIAPATSTTTRVITVDNRIQTDPQKPRGDVFIPRQPTNDLFEIFEIERGVSADEE
FT                   VKDDPGILIHSCNFDHGLCGWIREKDSDLHWETARDPAGGQYLTVSAAKAPGGKAARLV
FT                   LRLGHLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGTHGAALWGRNGGHGWRQTQITLR
FT                   GADVKSVIFKGEKRRGHTGEIGLDDVSLKRGRC"
FT   assembly_gap    19441506..19441731
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    19460655..19460726
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    19489111..19489179
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            complement(19492941..19603338)
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /note="gene_id=mCG20857.3"
FT   mRNA            complement(join(19492941..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..19596295,
FT                   19602885..>19603083))
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, transcript variant mCT190573"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT190573.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(19492964..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..19596295,
FT                   19603182..19603338))
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, transcript variant mCT21956"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT21956.2 created
FT                   on 22-OCT-2002"
FT   mRNA            complement(join(19492964..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19513230..19513354,
FT                   19514369..19514497,19516096..19516140,19516268..19516383,
FT                   19573208..19573301,19582854..19583105,19593309..19593776,
FT                   19595846..19596295,19603182..19603338))
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, transcript variant mCT174955"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT174955.0 created
FT                   on 22-OCT-2002"
FT   mRNA            complement(join(19492964..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19514369..19514497,
FT                   19516096..19516383,19573208..19573301,19582854..19583105,
FT                   19593309..19593776,19595846..19596295,19603182..19603338))
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, transcript variant mCT174956"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT174956.0 created
FT                   on 22-OCT-2002"
FT   CDS             complement(join(19494271..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..>19596283))
FT                   /codon_start=1
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, isoform CRA_c"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT190573.0
FT                   protein_id=mCP111549.0 isoform=CRA_c"
FT                   /protein_id="EDL12187.1"
FT                   /translation="QQKMKGIKKSPTEESLYLEYSHQTEGCIFPLHTSVTLFLLSYCEC
FT                   KVFNVCLVLTEESTDTSDTSFLKEALPQDLEIQVISKQALPPIVQNCCLPAVVDQPDVF
FT                   CRAGLAVVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQWTRLCELTIPLAVE
FT                   NFLQESSEHPPTIPEEILELERKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAK
FT                   SKASAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAASNREPSHIRKAKAADLPPLEHVF
FT                   AEGLYFTLADIVLLPCIHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVPKVKTAASKCG
FT                   IYFLYLPELLNSARKQPVNSDEVAAVDEQSDPLFIGGPRPTMTKLMEKGIEAMFSPHPC
FT                   PAWTLDWSSLPAAVSPKEGKMSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGH
FT                   VGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVAL
FT                   HACGVATDMVIEHCIQTRASFITCPCCYGFIQNTSKFNFPKSEKFKKTLSYKEHMLLCR
FT                   FADQTAVQLPPERRLIGKQCMGLVDLDRAAAAGEHGYSVQVISMEPESCSPKNNMIVGV
FT                   PL"
FT   CDS             complement(join(19494271..19494407,19497578..19497647,
FT                   19506929..19506959,19509547..19509680,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..19596274))
FT                   /codon_start=1
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, isoform CRA_e"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT21956.2
FT                   protein_id=mCP19290.2 isoform=CRA_e"
FT                   /protein_id="EDL12189.1"
FT                   /translation="MKGIKKSPTEESLYLEYSHQTEGCIFPLHTSVTLFLLSYCECKVF
FT                   NVCLVLTEESTDTSDTSFLKEALPQDLEIQVISKQALPPIVQNCCLPAVVDQPDVFCRA
FT                   GLAVVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQWTRLCELTIPLAVENFL
FT                   QESSEHPPTIPEEILELERKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAKSKA
FT                   SAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAASNREPSHIRKAKAADLPPLEHVFAEG
FT                   LYFTLADIVLLPCIHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVPKVKTAASKCGIYF
FT                   LYLPELLNSARKQPVNSDEVAAVDEQSDPLFIGGPRPTMTKLMEKGIEAMFSPHPCPAW
FT                   TLDWSSLPAAVSPKEGKMSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGHVGI
FT                   VLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHAC
FT                   GVATDMVIEHCIQTRASFITCPCCYGFIQNTSKFNFPKSEKFKKTLSYKEHMLLCRFAD
FT                   QTAVQLPPERRLIGKQCMGLVDLDRAAAAGEHGYSVQVISMEPESCSPKNNMIVGVPL"
FT   mRNA            complement(join(19509553..19509680,19513230..19513354,
FT                   19514369..19514497,19516096..19516140,19516268..19516383,
FT                   19573208..19573301,19582854..19583105,19593309..19593776,
FT                   19595846..19596295,19602885..>19603053))
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, transcript variant mCT190574"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT190574.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(19513259..19513354,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..>19596283))
FT                   /codon_start=1
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, isoform CRA_d"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT190574.0
FT                   protein_id=mCP111550.0 isoform=CRA_d"
FT                   /protein_id="EDL12188.1"
FT                   /translation="QQKMKGIKKSPTEESLYLEYSHQTEGCIFPLHTSVTLFLLSYCEC
FT                   KVFNVCLVLTEESTDTSDTSFLKEALPQDLEIQVISKQALPPIVQNCCLPAVVDQPDVF
FT                   CRAGLAVVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQWTRLCELTIPLAVE
FT                   NFLQESSEHPPTIPEEILELERKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAK
FT                   SKASAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAASNREPSHIRKAKAADLPPLEHVF
FT                   AEGLYFTLADIVLLPCIHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVPKVKTAASKCG
FT                   IYFLYLPELLNSARKQPVNSDEVAAVDEQSDPLFIGGPRPTMTKLMEKGIEAMFSPHPC
FT                   PAWTLDWSSLPAAVSPKEGKMSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGH
FT                   VGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGPNR
FT                   PTTDVQCRDDKMFERAVMCDTVLTFSPH"
FT   CDS             complement(join(19513259..19513354,19514369..19514497,
FT                   19516096..19516140,19516268..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..19596274))
FT                   /codon_start=1
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, isoform CRA_a"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT174955.0
FT                   protein_id=mCP97874.0 isoform=CRA_a"
FT                   /protein_id="EDL12185.1"
FT                   /translation="MKGIKKSPTEESLYLEYSHQTEGCIFPLHTSVTLFLLSYCECKVF
FT                   NVCLVLTEESTDTSDTSFLKEALPQDLEIQVISKQALPPIVQNCCLPAVVDQPDVFCRA
FT                   GLAVVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQWTRLCELTIPLAVENFL
FT                   QESSEHPPTIPEEILELERKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAKSKA
FT                   SAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAASNREPSHIRKAKAADLPPLEHVFAEG
FT                   LYFTLADIVLLPCIHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVPKVKTAASKCGIYF
FT                   LYLPELLNSARKQPVNSDEVAAVDEQSDPLFIGGPRPTMTKLMEKGIEAMFSPHPCPAW
FT                   TLDWSSLPAAVSPKEGKMSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGHVGI
FT                   VLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGPNRPTT
FT                   DVQCRDDKMFERAVMCDTVLTFSPH"
FT   CDS             complement(join(19516223..19516383,19573208..19573301,
FT                   19582854..19583105,19593309..19593776,19595846..19596274))
FT                   /codon_start=1
FT                   /gene="Gstcd"
FT                   /locus_tag="mCG_20857"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   containing, isoform CRA_b"
FT                   /note="gene_id=mCG20857.3 transcript_id=mCT174956.0
FT                   protein_id=mCP97875.0 isoform=CRA_b"
FT                   /protein_id="EDL12186.1"
FT                   /translation="MKGIKKSPTEESLYLEYSHQTEGCIFPLHTSVTLFLLSYCECKVF
FT                   NVCLVLTEESTDTSDTSFLKEALPQDLEIQVISKQALPPIVQNCCLPAVVDQPDVFCRA
FT                   GLAVVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQWTRLCELTIPLAVENFL
FT                   QESSEHPPTIPEEILELERKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAKSKA
FT                   SAQKTPKDLAAPSKSLELKVAFSKLTVQEDAAASNREPSHIRKAKAADLPPLEHVFAEG
FT                   LYFTLADIVLLPCIHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVPKVKTAASKCGIYF
FT                   LYLPELLNSARKQPVNSDEVAAVDEQSDPLFIGGPRPTMTKLMEKGIEAMFSPHPCPAW
FT                   TLDWSSLPAAVSPKEGKMSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGVSYVS
FT                   SRPLACPRS"
FT   assembly_gap    19532860..19532979
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    19558318..19559749
FT                   /estimated_length=1432
FT                   /gap_type="unknown"
FT   assembly_gap    19564946..19565127
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    19566368..19566448
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    19574672..19577772
FT                   /estimated_length=3101
FT                   /gap_type="unknown"
FT   assembly_gap    19582341..19582360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19586981..19587307
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    19600303..19600330
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            19603222..19622293
FT                   /gene="Ints12"
FT                   /locus_tag="mCG_20856"
FT                   /note="gene_id=mCG20856.2"
FT   mRNA            join(19603222..19603281,19608053..19608217,
FT                   19609715..19609867,19611929..19612113,19613663..19613822,
FT                   19618246..19618392,19620146..19622293)
FT                   /gene="Ints12"
FT                   /locus_tag="mCG_20856"
FT                   /product="integrator complex subunit 12"
FT                   /note="gene_id=mCG20856.2 transcript_id=mCT21752.2 created
FT                   on 22-OCT-2002"
FT   CDS             join(19608062..19608217,19609715..19609867,
FT                   19611929..19612113,19613663..19613822,19618246..19618392,
FT                   19620146..19620730)
FT                   /codon_start=1
FT                   /gene="Ints12"
FT                   /locus_tag="mCG_20856"
FT                   /product="integrator complex subunit 12"
FT                   /note="gene_id=mCG20856.2 transcript_id=mCT21752.2
FT                   protein_id=mCP19281.2"
FT                   /protein_id="EDL12184.1"
FT                   /translation="MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDS
FT                   SYRPTQKDVEPPKISSTKSLSIKQEPKTSSSLPSGSSNGKVLTAEKIKKEAEKRPADKM
FT                   KDVTEGIDVPKKPRLEKPETRSSPITVQTSKDLSMADLSSFEETSADDFAMEMGLACVV
FT                   CRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKT
FT                   QKPPQKPAPTVVSVTPTVKDPLVKKPETKLKQETTFLAFKRTEVKPSTVISGNSSSNNV
FT                   SSSVTSGLTGWAAFAAKTSSAGPSTAKLNSAAQNSSGKPAASSSNQKPVGLTGLATSSK
FT                   GGIGSKIGSGNSTSPSVPLKPLPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGGSSQ
FT                   LSGNGNSATTGPSGSTTSKATSETSSSTSASLKGPTSQESQLNAMKRLQMVKKKAAQKK
FT                   LKK"
FT   gene            complement(19627673..19743435)
FT                   /gene="9130221D24Rik"
FT                   /locus_tag="mCG_123955"
FT                   /note="gene_id=mCG123955.1"
FT   mRNA            complement(join(19627673..19627933,19635796..19636037,
FT                   19636144..19636342,19637350..19637493,19646141..19646452,
FT                   19649620..19649736,19651034..19651138,19655265..19655398,
FT                   19658294..19658493,19669585..19669732,19684620..19684743,
FT                   19715131..19715318,19743112..19743435))
FT                   /gene="9130221D24Rik"
FT                   /locus_tag="mCG_123955"
FT                   /product="RIKEN cDNA 9130221D24, transcript variant
FT                   mCT125192"
FT                   /note="gene_id=mCG123955.1 transcript_id=mCT125192.1
FT                   created on 22-OCT-2002"
FT   CDS             complement(join(19627748..19627933,19635796..19636037,
FT                   19636144..19636342,19637350..19637493,19646141..19646452,
FT                   19649620..19649736,19651034..19651138,19655265..19655398,
FT                   19658294..19658493,19669585..19669732,19684620..19684743,
FT                   19715131..19715318,19743112..19743307))
FT                   /codon_start=1
FT                   /gene="9130221D24Rik"
FT                   /locus_tag="mCG_123955"
FT                   /product="RIKEN cDNA 9130221D24, isoform CRA_a"
FT                   /note="gene_id=mCG123955.1 transcript_id=mCT125192.1
FT                   protein_id=mCP89452.1 isoform=CRA_a"
FT                   /protein_id="EDL12182.1"
FT                   /translation="MEPREAAGKETMGSKKKNLTFLRSRLYMLERRKTDTVVDSSVSGD
FT                   HSGSLRRSQSDRTEYNQKLQEKMTPQAECSSAETPTPEDEQQVGRMMAKRAKIIRELIQ
FT                   TERDYLTDLELCLREVVQPLRSKQIDRLDVEGLFSNIESVHQISAKLLSLLEEATTDVE
FT                   PAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSVLESYEKEEELKQHLSHCLQSLKGKP
FT                   NLLDMGSLMIKPIQRVMKYPLLLCELRNSTPPSHPDYRALGEAFTAVKDINVNINELKR
FT                   RKDLVLKYKKNEEEESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREE
FT                   KLFRSLEKTVRLCVKNISSCLQHIEEATPFTLQSGAELREISYQDGEKNGTEPQDQASK
FT                   PYQDFAARSQRLILNPLSALLSLFPGPQKLIQKRYDKLLDYNSSLPRSATTESDLAKRE
FT                   YEALNAQLVEELQAFNQAAKTILLNCLCSFVTLLRDLMQVALQAYSTVKTVPLPVLGIS
FT                   EIQSRVLEEVHSLTFVKENSATFIERKLSFEKKKPAQILPEVPHQTDAHRSKLLSTYGA
FT                   EELYRAKRKCNATQEHDINLLEGELVAVLEQKDPLGSTSRWFVDTGCVKGYVYSSFLKP
FT                   HNPGKGQKVDADNRFCDDDFENISLFVSCRPAGDRVSISDSSSSLSGSCGKFETNGADA
FT                   DNFQEVDEQIFYAVHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYV
FT                   PANYLGKMTYA"
FT   assembly_gap    19633634..19633653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19638007..19638026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19639285..19642780
FT                   /estimated_length=3496
FT                   /gap_type="unknown"
FT   mRNA            complement(join(19681131..19681529,19684620..19684743,
FT                   19715131..19715318,19743112..19743435))
FT                   /gene="9130221D24Rik"
FT                   /locus_tag="mCG_123955"
FT                   /product="RIKEN cDNA 9130221D24, transcript variant
FT                   mCT174949"
FT                   /note="gene_id=mCG123955.1 transcript_id=mCT174949.0
FT                   created on 22-OCT-2002"
FT   CDS             complement(join(19681510..19681529,19684620..19684743,
FT                   19715131..19715318,19743112..19743307))
FT                   /codon_start=1
FT                   /gene="9130221D24Rik"
FT                   /locus_tag="mCG_123955"
FT                   /product="RIKEN cDNA 9130221D24, isoform CRA_b"
FT                   /note="gene_id=mCG123955.1 transcript_id=mCT174949.0
FT                   protein_id=mCP97868.0 isoform=CRA_b"
FT                   /db_xref="GOA:E0CXB4"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="MGI:MGI:1924919"
FT                   /db_xref="UniProtKB/TrEMBL:E0CXB4"
FT                   /protein_id="EDL12183.1"
FT                   /translation="MEPREAAGKETMGSKKKNLTFLRSRLYMLERRKTDTVVDSSVSGD
FT                   HSGSLRRSQSDRTEYNQKLQEKMTPQAECSSAETPTPEDEQQVGRMMAKRAKIIRELIQ
FT                   TERDYLTDLELCLREVVQPLRSKQIDRLDVEGLFSNIESVHQISAKLLSLLEEATTDVE
FT                   PAMQVIGGNYGK"
FT   assembly_gap    19733824..19734095
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    19772044..19772063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19780194..19780451
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    19806167..19806186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19808000..19808019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19809230..19809249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19811402..19811421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19812470..19812489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19813506..19813525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19817494..19817733
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   gene            <19820617..19888561
FT                   /gene="Ppa2"
FT                   /locus_tag="mCG_21575"
FT                   /note="gene_id=mCG21575.2"
FT   mRNA            join(<19820617..19820685,19820943..19821026,
FT                   19831638..19831702,19833274..19833318,19837350..19837403,
FT                   19841092..19841211,19858672..19858801,19878298..19878425,
FT                   19880859..19880944,19884102..19884171,19887028..19887067,
FT                   19888326..19888561)
FT                   /gene="Ppa2"
FT                   /locus_tag="mCG_21575"
FT                   /product="pyrophosphatase (inorganic) 2"
FT                   /note="gene_id=mCG21575.2 transcript_id=mCT19204.2 created
FT                   on 22-OCT-2002"
FT   CDS             join(<19820619..19820685,19820943..19821026,
FT                   19831638..19831702,19833274..19833318,19837350..19837403,
FT                   19841092..19841211,19858672..19858801,19878298..19878425,
FT                   19880859..19880944,19884102..19884171,19887028..19887067,
FT                   19888326..19888354)
FT                   /codon_start=1
FT                   /gene="Ppa2"
FT                   /locus_tag="mCG_21575"
FT                   /product="pyrophosphatase (inorganic) 2"
FT                   /note="gene_id=mCG21575.2 transcript_id=mCT19204.2
FT                   protein_id=mCP19223.2"
FT                   /protein_id="EDL12181.1"
FT                   /translation="RFSQTVRHARAAAAAERRPRVAPRPPRRVMSLYRTEELGHPRSQD
FT                   YRLFFKHVAGHYISPFHDIPLKADCKEEHDIPRKKARNDEYENLFNMVVEIPRWTNAKM
FT                   EIATEEPLNPIKQDIKNGKLRYTPNIFPHKGYIWNYGALPQKVLSRGDVVHVKILGTLA
FT                   LIDQSETDWKIIAINVNDPEAEKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENKF
FT                   AFNGEFKNKAFALDVINSAHERWKEMVMKKCDKGAISCVNVHICDSPFHCTMEEARSLV
FT                   ESVPTPSMNKESNVEEEVWHFLRN"
FT   assembly_gap    19820691..19820939
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    19849900..19850684
FT                   /estimated_length=785
FT                   /gap_type="unknown"
FT   assembly_gap    19862609..19864026
FT                   /estimated_length=1418
FT                   /gap_type="unknown"
FT   assembly_gap    19867727..19867775
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    19888641..19888690
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    19923184..19923203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19955937..19955956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19971360..19971379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19975790..19981734)
FT                   /locus_tag="mCG_123956"
FT                   /note="gene_id=mCG123956.1"
FT   mRNA            complement(join(19975790..19978107,19979193..19979556,
FT                   19981257..19981734))
FT                   /locus_tag="mCG_123956"
FT                   /product="mCG123956"
FT                   /note="gene_id=mCG123956.1 transcript_id=mCT125193.1
FT                   created on 21-OCT-2002"
FT   CDS             complement(join(19976654..19978107,19979193..19979556,
FT                   19981257..19981277))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123956"
FT                   /product="mCG123956"
FT                   /note="gene_id=mCG123956.1 transcript_id=mCT125193.1
FT                   protein_id=mCP89470.1"
FT                   /protein_id="EDL12180.1"
FT                   /translation="MPNGSTVVVTLNREDNREVGAKPEDEQFHVLPMYIIAPEDEFGST
FT                   EGQEKKIRMGSIEVLQSFRRRRVIRIGELPKSCKKKAEPKKAKTKKAARKRSSLENCSS
FT                   RTEKGKSSSHTKLMENASHMKQMTAQPQLSGPVIRQPPTLQRHLQQGQRPQQPQPPQPQ
FT                   PQTTPQPQPQPQHIMPGNSQSVGSHCSGSTSVYTRQPTPHSPYPSSAHTSDIYGDTNHV
FT                   NFYPTSSHASGSYLNPSNYMNPYLGLLNQNNQYAPFPYNGSVPVDNGSPFLGSYSPQAQ
FT                   SRDLHRYPNQDHLTNQNLPPIHTLHQQTFGDSPSKYLSYGNQNMQRDAFTTNSTLKPNV
FT                   HHLATFSPYPTPKMDSHFMGAASRSPYSHPHTDYKTSEHHLPSHTIYSYTAAASGSSSS
FT                   HAFHNKENDNIANGLSRVLPGFNHDRTASAQELLYSLTGSSQEKQPEVSGQDAAAVQEI
FT                   EYWSDSEHNFQDPCIGGVAIAPTHGSILIECAKCEVHATTKVNDPDRNHPTRISLVLYR
FT                   HKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLR
FT                   FIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV"
FT   assembly_gap    19996322..19996366
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(<19996651..20054439)
FT                   /locus_tag="mCG_21578"
FT                   /note="gene_id=mCG21578.2"
FT   mRNA            complement(join(<19996651..19998592,20024132..20024276,
FT                   20054347..20054439))
FT                   /locus_tag="mCG_21578"
FT                   /product="mCG21578"
FT                   /note="gene_id=mCG21578.2 transcript_id=mCT19538.2 created
FT                   on 21-OCT-2002"
FT   CDS             complement(<19996651..19998546)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21578"
FT                   /product="mCG21578"
FT                   /note="gene_id=mCG21578.2 transcript_id=mCT19538.2
FT                   protein_id=mCP19254.2"
FT                   /protein_id="EDL12179.1"
FT                   /translation="MEQDRTTHAEGTRLSPFLIAPPSPISHTEPLAVKLQNGSPLAERP
FT                   HPEVNGDTKWQSSQSCYGISHMKGSQSSHESPHEDRGYSRCLQNGGIKRTVSEPSLSGL
FT                   HPNKILKLDQKAKGESNIFEESQERNHGKSSRQPNVSGLSDNGEPVTSTTQESSGADAF
FT                   PTRNYNGVEIQVLNEQEGEKGRSVTLLKNKIVLMPNGATVSAHSEENTRGELLEKTQCY
FT                   PDCVSIAVQSTASHVNTPSSQAAIELSHEIPQPSLTSAQINFSQTSSLQLPPEPAAMVT
FT                   KACDADNASKPAIVPGTCPFQKAEHQQKSALDIGPSRAENKTIQGSMELFAEEYYPSSD
FT                   RNLQASHGSSEQYSKQKETNGAYFRQSSKFPKDSISPTTVTPPSQSLLAPRLVLQPPLE
FT                   GKGALNDVALEEHHDYPNRSNRTLLREGKIDHQPKTSSSQSLNPSVHTPNPPLMLPEQH
FT                   QNDCGSPSPEKSRKMSEYLMYYLPNHGHSGGLQEHSQYLMGHREQEIPKDANGKQTQGS
FT                   VQAAPGWIELKAPNLHEALHQTKRKDISLHSVLHSQTGPVNQMSSKQSTGNVNMPGGFQ
FT                   RLPYLQKTAQPEQKAQMYQVQVNQGPSPGMGDQHLQFQKALYQECIPRTDPSSEAH"
FT   assembly_gap    20002759..20003154
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    20022312..20023327
FT                   /estimated_length=1016
FT                   /gap_type="unknown"
FT   assembly_gap    20048774..20048793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20061165..20061271
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    20070366..20070504
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    20081131..20081344
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    20082964..20083049
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    20088022..20088041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20098757..20098822
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    20104682..20104701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20139069..20139633
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    20140629..20141163
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    20146400..20152400
FT                   /estimated_length=6001
FT                   /gap_type="unknown"
FT   assembly_gap    20173585..20173630
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    20186756..20186775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20241548..20241567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20263953..20264181
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    20282344..20282561
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    20286403..20286422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20299654..20301999)
FT                   /locus_tag="mCG_21580"
FT                   /note="gene_id=mCG21580.2"
FT   mRNA            complement(join(20299654..20299837,20301304..20301447,
FT                   20301808..20301999))
FT                   /locus_tag="mCG_21580"
FT                   /product="mCG21580"
FT                   /note="gene_id=mCG21580.2 transcript_id=mCT19540.2 created
FT                   on 11-SEP-2002"
FT   CDS             complement(join(20299764..20299837,20301304..20301447,
FT                   20301808..20301865))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21580"
FT                   /product="mCG21580"
FT                   /note="gene_id=mCG21580.2 transcript_id=mCT19540.2
FT                   protein_id=mCP19267.1"
FT                   /protein_id="EDL12178.1"
FT                   /translation="MKFLVFLVLICASTILVFCFPSGRKSVDESNYVAEEQLIRTVKGK
FT                   GSSQEPEDSQESSMNSGGNVFDRAEMVLRGIIDCYNLISRRRGLNL"
FT   assembly_gap    20299894..20299913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20314841..20314860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20318466..20318485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20325902..20325956
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    20340572..20340591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20365809..20368324
FT                   /estimated_length=2516
FT                   /gap_type="unknown"
FT   assembly_gap    20380085..20380110
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    20390041..20390511
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   assembly_gap    20405662..20405681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20433124..20433497
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    20449414..20449819
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   gene            complement(20464278..20743860)
FT                   /locus_tag="mCG_146129"
FT                   /note="gene_id=mCG146129.0"
FT   mRNA            complement(join(20464278..20467319,20467336..20468267,
FT                   20605116..20605224,20743763..20743860))
FT                   /locus_tag="mCG_146129"
FT                   /product="mCG146129"
FT                   /note="gene_id=mCG146129.0 transcript_id=mCT186232.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(20465672..20466022)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146129"
FT                   /product="mCG146129"
FT                   /note="gene_id=mCG146129.0 transcript_id=mCT186232.0
FT                   protein_id=mCP107718.0"
FT                   /protein_id="EDL12176.1"
FT                   /translation="MANFFVLLQQGSPSKALPPSFSLYPSNWGIKSIPAFRYKLIKFVS
FT                   FSTSQKNFTKMKGDGNVCHGTWKDSLKPLLDGGWVWLRFNLITISQSHFSPLCTHPTLQ
FT                   SLLFLHVLKYCL"
FT   assembly_gap    20468865..20469014
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    20470874..20470946
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    20472743..20472801
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    20546403..20546457
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    20598039..20598353
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    20627085..20627104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20669347..20669518
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            <20703583..20716721
FT                   /locus_tag="mCG_145187"
FT                   /note="gene_id=mCG145187.0"
FT   mRNA            join(<20703583..20703800,20712620..20712793,
FT                   20715169..20716721)
FT                   /locus_tag="mCG_145187"
FT                   /product="mCG145187"
FT                   /note="gene_id=mCG145187.0 transcript_id=mCT184611.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<20712732..20712793,20715169..20715493)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145187"
FT                   /product="mCG145187"
FT                   /note="gene_id=mCG145187.0 transcript_id=mCT184611.0
FT                   protein_id=mCP106184.0"
FT                   /protein_id="EDL12177.1"
FT                   /translation="EKETVSCPGLLPGVALHILTRTVLQSTESLNHSWLPPAFIFCCLE
FT                   DGEKIFSNFSQNSSPPSCFLSEVFCYFQSIHCSPAYSHSSRGNRFHFTLYLLLLEEEMK
FT                   HDGGGRGQISINLGQQTGKIGWEK"
FT   gene            20742427..>20762680
FT                   /gene="Cxxc4"
FT                   /locus_tag="mCG_21044"
FT                   /note="gene_id=mCG21044.2"
FT   mRNA            join(20742427..20742858,20762536..>20762680)
FT                   /gene="Cxxc4"
FT                   /locus_tag="mCG_21044"
FT                   /product="CXXC finger 4, transcript variant mCT173052"
FT                   /note="gene_id=mCG21044.2 transcript_id=mCT173052.0 created
FT                   on 11-SEP-2002"
FT   CDS             join(20742746..20742858,20762536..>20762680)
FT                   /codon_start=1
FT                   /gene="Cxxc4"
FT                   /locus_tag="mCG_21044"
FT                   /product="CXXC finger 4, isoform CRA_a"
FT                   /note="gene_id=mCG21044.2 transcript_id=mCT173052.0
FT                   protein_id=mCP95971.0 isoform=CRA_a"
FT                   /protein_id="EDL12174.1"
FT                   /translation="MIVMQTTRLENVGAFCGVCGGVARAAVYLFLIFFWCSSWTTILPQ
FT                   SLMEHPLLPSPFLPLEAFFSLKQGHSVRNFIKTRQPIPHSH"
FT   assembly_gap    20743043..20743578
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   mRNA            join(<20743580..20744079,20761215..20761837)
FT                   /gene="Cxxc4"
FT                   /locus_tag="mCG_21044"
FT                   /product="CXXC finger 4, transcript variant mCT19028"
FT                   /note="gene_id=mCG21044.2 transcript_id=mCT19028.2 created
FT                   on 11-SEP-2002"
FT   CDS             join(<20743582..20744079,20761215..20761259)
FT                   /codon_start=1
FT                   /gene="Cxxc4"
FT                   /locus_tag="mCG_21044"
FT                   /product="CXXC finger 4, isoform CRA_b"
FT                   /note="gene_id=mCG21044.2 transcript_id=mCT19028.2
FT                   protein_id=mCP19182.2 isoform=CRA_b"
FT                   /protein_id="EDL12175.1"
FT                   /translation="PSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPER
FT                   VGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSS
FT                   SGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGT
FT                   SLERTPVPSAEAFRWFF"
FT   assembly_gap    20755548..20758229
FT                   /estimated_length=2682
FT                   /gap_type="unknown"
FT   assembly_gap    20799888..20799907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20816516..20816610
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    20829181..20830009
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    20831762..20831832
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    20835135..20835424
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    20838932..20839032
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    20860672..20860691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20868752..20869247)
FT                   /pseudo
FT                   /locus_tag="mCG_1045583"
FT                   /note="gene_id=mCG1045583.1"
FT   mRNA            complement(20868752..20869247)
FT                   /pseudo
FT                   /locus_tag="mCG_1045583"
FT                   /note="gene_id=mCG1045583.1 transcript_id=mCT163287.1
FT                   created on 29-OCT-2002"
FT   assembly_gap    20871073..20871192
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    20887561..20887747
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    20892850..20893473
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   gene            complement(20907280..>20926774)
FT                   /locus_tag="mCG_123705"
FT                   /note="gene_id=mCG123705.1"
FT   mRNA            complement(join(20907280..20907456,20907955..20908040,
FT                   20909016..20909112,20922591..20922648,20922778..20922885,
FT                   20923165..20923347,20924078..20924160,20925624..20925709,
FT                   20926682..>20926774))
FT                   /locus_tag="mCG_123705"
FT                   /product="mCG123705"
FT                   /note="gene_id=mCG123705.1 transcript_id=mCT124939.1
FT                   created on 11-SEP-2002"
FT   CDS             complement(join(20907978..20908040,20909016..20909112,
FT                   20922591..20922648,20922778..>20922826))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123705"
FT                   /product="mCG123705"
FT                   /note="gene_id=mCG123705.1 transcript_id=mCT124939.1
FT                   protein_id=mCP89736.1"
FT                   /protein_id="EDL12173.1"
FT                   /translation="WSPRNFKCPYNSSAHRVLEALAFACPMKLLPKLTDRWRRKSTHAC
FT                   MHISNKVQNAKASVHHHTCLRTKDCVHAALEILVVPDVSSHSM"
FT   assembly_gap    20940250..20940424
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    20950522..20950541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20954736..20958104
FT                   /estimated_length=3369
FT                   /gap_type="unknown"
FT   assembly_gap    20987568..20987617
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    21004036..21004390
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    21009697..21009716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21034395..21034414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21038814..21038949
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    21047650..21054019
FT                   /estimated_length=6370
FT                   /gap_type="unknown"
FT   assembly_gap    21056565..21056584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21065031..21065050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21083159..21083204
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    21096664..21096683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21116669..21116688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21133957..21133976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21157602..21157986
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    21159799..21159818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21188122..21188141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21189260..21190041
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    21198215..21198274
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    21203345..21203690
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    21216531..21216550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21287650..21287669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21295632..21295651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21310255..21310274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21315526..21315997
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    21317467..21317924
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   gene            21325592..>21430315
FT                   /gene="Tacr3"
FT                   /locus_tag="mCG_21041"
FT                   /note="gene_id=mCG21041.2"
FT   mRNA            join(21325592..21326324,21352852..21353040,
FT                   21359107..21359257,21427759..21427955,21430003..>21430315)
FT                   /gene="Tacr3"
FT                   /locus_tag="mCG_21041"
FT                   /product="tachykinin receptor 3"
FT                   /note="gene_id=mCG21041.2 transcript_id=mCT19025.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(21325816..21326324,21352852..21353040,
FT                   21359107..21359257,21427759..21427955,21430003..21430315)
FT                   /codon_start=1
FT                   /gene="Tacr3"
FT                   /locus_tag="mCG_21041"
FT                   /product="tachykinin receptor 3"
FT                   /note="gene_id=mCG21041.2 transcript_id=mCT19025.2
FT                   protein_id=mCP19273.1"
FT                   /protein_id="EDL12172.1"
FT                   /translation="MASVPTGENWTDGTAGVGSHTGNLSAALGITEWLALQAGNFSSAL
FT                   GLPVTSQAPSQVRANLTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMR
FT                   TVTNYFLVNLAFSDASVAAFNTLVNFIYGVHSEWYFGANYCRFQNFFPITAVFASIYSM
FT                   TAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYV
FT                   QWPEGPKQHFTYHIIVIILVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAK
FT                   RKVVKMMIIVVVTFAICWLPYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNP
FT                   IIYCCLNKRFRAGFKRAFRWCPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVL
FT                   YDPSEGDPAKSSRKKRAVPRDPSANGCSHREFKSASTTSSFISSPYTSVDEYS"
FT   assembly_gap    21327047..21327066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21343658..21343677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21347893..21348156
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    21382100..21385351
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   assembly_gap    21419258..21419277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21438222..21438241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21451351..21451370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21453810..21453829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21455005..21455024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <21463335..21463891
FT                   /locus_tag="mCG_51015"
FT                   /note="gene_id=mCG51015.2"
FT   mRNA            <21463335..21463891
FT                   /locus_tag="mCG_51015"
FT                   /product="mCG51015"
FT                   /note="gene_id=mCG51015.2 transcript_id=mCT51198.2 created
FT                   on 29-OCT-2002"
FT   CDS             <21463335..21463775
FT                   /codon_start=1
FT                   /locus_tag="mCG_51015"
FT                   /product="mCG51015"
FT                   /note="gene_id=mCG51015.2 transcript_id=mCT51198.2
FT                   protein_id=mCP39677.2"
FT                   /protein_id="EDL12171.1"
FT                   /translation="DHCCGDPGGCGHHFILLFSRQEKLWLQKCYTMLPDKERKITWDII
FT                   QTVLSRGHRTSCFIDWKELKLVYKRYASLHFCCAIENQDNELLTLEIVHRYVELLDKYF
FT                   GNVCELDIIFNFEKAHFILDEFIIGGEIQETSKKTAVKAIEY"
FT   gene            21471707..21472197
FT                   /pseudo
FT                   /locus_tag="mCG_1045582"
FT                   /note="gene_id=mCG1045582.0"
FT   mRNA            21471707..21472197
FT                   /pseudo
FT                   /locus_tag="mCG_1045582"
FT                   /note="gene_id=mCG1045582.0 transcript_id=mCT163286.1
FT                   created on 29-OCT-2002"
FT   assembly_gap    21485478..21485497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21512866..21513263
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    21533506..21533525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21538122..21538290
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    21543259..21543428
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    21545927..21545946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21556510..21557160
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    21558264..21558283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21589264..21589454
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    21592007..21592118
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    21594079..21594098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21599601..21601506
FT                   /estimated_length=1906
FT                   /gap_type="unknown"
FT   gene            21623872..21624397
FT                   /pseudo
FT                   /locus_tag="mCG_1045581"
FT                   /note="gene_id=mCG1045581.1"
FT   mRNA            21623872..21624397
FT                   /pseudo
FT                   /locus_tag="mCG_1045581"
FT                   /note="gene_id=mCG1045581.1 transcript_id=mCT163285.1
FT                   created on 04-DEC-2002"
FT   assembly_gap    21658793..21661492
FT                   /estimated_length=2700
FT                   /gap_type="unknown"
FT   assembly_gap    21662582..21662797
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    21684411..21685098
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    21708762..21708997
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    21710654..21710709
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            21711845..21773613
FT                   /gene="Cenpe"
FT                   /locus_tag="mCG_21038"
FT                   /note="gene_id=mCG21038.2"
FT   mRNA            join(21711845..21711916,21714306..21714397,
FT                   21715534..21715623,21715748..21715866,21716455..21716574,
FT                   21717235..21717316,21717676..21717743,21717826..21717891,
FT                   21719482..21719533,21721430..21721517,21722371..21722500,
FT                   21724184..21724303,21727986..21728144,21729277..21729433,
FT                   21730594..21730682,21732126..21732293,21732957..21733031,
FT                   21733201..21733320,21734063..21734185,21734296..21734452,
FT                   21734687..21734841,21736733..21737047,21737157..21737429,
FT                   21737545..21737700,21738988..21739179,21740167..21740325,
FT                   21741281..21741571,21741695..21741850,21742818..21743096,
FT                   21745706..21745864,21746038..21746322,21746559..21746846,
FT                   21747291..21747449,21747603..21747884,21748878..21749036,
FT                   21749571..21749729,21751559..21751819,21755560..21755661,
FT                   21756566..21756784,21759281..21759475,21760068..21760271,
FT                   21761608..21761835,21764397..21764509,21766000..21766097,
FT                   21769029..21769209,21770765..21771051,21773242..21773613)
FT                   /gene="Cenpe"
FT                   /locus_tag="mCG_21038"
FT                   /product="centromere protein E, transcript variant
FT                   mCT19022"
FT                   /note="gene_id=mCG21038.2 transcript_id=mCT19022.2 created
FT                   on 11-SEP-2002"
FT   mRNA            join(<21711861..21711916,21714306..21714397,
FT                   21715534..21715623,21715748..21715866,21716455..21716574,
FT                   21717235..21717316,21717676..21717743,21717826..21717891,
FT                   21719482..21719533,21721430..21721517,21722371..21722500,
FT                   21724184..21724303,21727986..21728144,21729277..21729433,
FT                   21730594..21730682,21732126..21732293,21732957..21733031,
FT                   21733201..21733320,21734063..21734185,21734296..21734452,
FT                   21734687..21734841,21736733..21737047,21737157..21737429,
FT                   21737545..21737700,21738988..21739179,21740167..21740325,
FT                   21741281..21741571,21741695..21741858,21742818..21743096,
FT                   21745706..21745864,21746038..21746322,21746559..21746846,
FT                   21747291..21747449,21747603..21747884,21748878..21749036,
FT                   21751559..21751819,21755560..21755661,21756566..21756784,
FT                   21759281..21759475,21760068..21760271,21761608..21761835,
FT                   21764397..21764509,21766000..21766097,21769029..21769209,
FT                   21770765..21771051,21773242..21773330)
FT                   /gene="Cenpe"
FT                   /locus_tag="mCG_21038"
FT                   /product="centromere protein E, transcript variant
FT                   mCT190559"
FT                   /note="gene_id=mCG21038.2 transcript_id=mCT190559.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(21711861..21711916,21714306..21714397,
FT                   21715534..21715623,21715748..21715866,21716455..21716574,
FT                   21717235..21717316,21717676..21717743,21717826..21717891,
FT                   21719482..21719533,21721430..21721517,21722371..21722500,
FT                   21724184..21724303,21727986..21728144,21729277..21729433,
FT                   21730594..21730682,21732126..21732293,21732957..21733031,
FT                   21733201..21733320,21734063..21734185,21734296..21734452,
FT                   21734687..21734841,21736733..21737047,21737157..21737429,
FT                   21737545..21737700,21738988..21739179,21740167..21740325,
FT                   21741281..21741571,21741695..21741850,21742818..21743096,
FT                   21745706..21745864,21746038..21746322,21746559..21746846,
FT                   21747291..21747449,21747603..21747884,21748878..21749036,
FT                   21749571..21749729,21751559..21751819,21755560..21755661,
FT                   21756566..21756784,21759281..21759475,21760068..21760271,
FT                   21761608..21761835,21764397..21764509,21766000..21766097,
FT                   21769029..21769209,21770765..21771051,21773242..21773330)
FT                   /codon_start=1
FT                   /gene="Cenpe"
FT                   /locus_tag="mCG_21038"
FT                   /product="centromere protein E, isoform CRA_a"
FT                   /note="gene_id=mCG21038.2 transcript_id=mCT19022.2
FT                   protein_id=mCP19197.2 isoform=CRA_a"
FT                   /protein_id="EDL12169.1"
FT                   /translation="MAEEASVAVCVRVRPLNSREEELGEATHIYWKTDKNAIYQSDGGK
FT                   SFQFDRVFDSNETTKNVYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSEDCLG
FT                   VIPRAIHDIFQRIKKFPEREFLLRVSYMEIYNETITDLLCNAQKMKPLIIREDTNRTVY
FT                   VSDLTEEVVYTAEMALKWLATGEKNRHYGITKMNQRSSRSHTIFRMILESREKAEPSNC
FT                   DGSVKVSHLNLVDLAGSERAAQTGAEGVRLKEGCFINRNLFILGQVIKKLSDGQVGGFI
FT                   NYRDSKLTRILQNSLGGNAKTRIICTITPASLDETLTTLQFASTAKYMKNTPYVNEVSN
FT                   DEALLKRYRREIADLRKQLEEVNTKTRAQEMEKDQLAQLLDEKDLLQKVQDEKINNLKR
FT                   MLVTSSSIALQQELEIKRKRRVTWCYGKMKDSNYEKEFKVPTSITTRKRKTSVTSLREN
FT                   SLMKFGESAASSEFEMLNNTLESLAEVEWSSATTLLSEENVESELNSLNAQYNDLVLDY
FT                   EQLRRENEDLKLKLKEKNELEEFELLEQKEERDQEMQLMHEVSNLKNLIKHAEEYNQDL
FT                   ENDLSSKVKLLKEKEEQIKNLQEYIDAQKSEKMKIDLSYTSDATEDLKQAMRTLSDLDT
FT                   VALDAKKESAFLRSENLELKEKINELSDSRKQMESDIQMYQRQLEAKKKMQTDLDKELQ
FT                   LAFQEISKLSALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSELKSLP
FT                   SEVETLRRELYEKSEELHIITTEREKLFSEMAHKDSRIQGLLEEIGNTRDDLATSQLSR
FT                   RGSDGEWQALESLHAELEHRHAGVLEERERLKQEIGALSKEAESLAFSLDSVKAELSHK
FT                   TQELEQKTVEGQERLNKMEALREELESRDSSLQSVEKEKVLLTEKLQQALKEVKALTQE
FT                   KKNLKQLQESLQTERDQLRSDIQDTVNMNIDTQEQLLNALESLKQHQETINMLKMKAAE
FT                   ELSDNLHVKDRGGARDEAQQKMDGIDEQNESAHTLLGGGKDNEVTEEQRKIDSLMQENS
FT                   GLQQTLESVRAEKEQLKMDLKENIEMSIENQEELRILRDELKRQQEVAAQEKDHATEKT
FT                   QELSRTQERLAKTEEKLEEKNQKLQETQQQLLSTQEAMSKLQAKVIDMESLQNEFRNQG
FT                   LALERVETEKLELAQRLHESYEEVKSITKERNDLKELQESFEIEKKQLKEYAREIEAAG
FT                   LQTKEELNIAHANLKEYQEIITELRGSISENEAQGASTQDTAKSAPELQGEVPEQELLP
FT                   VVKEARHSAEKVNGLEPVGAHSRTVHSMTMEGIEIENLRLTKKLEESQMEISCLTRERE
FT                   DLRRTQETLQVECTQLKEDARRTLANHLETEEELNLARCCLKEQENKIDTLITSLSQRE
FT                   TELSSVRGQLALTTAELERKVQELCEKQEELTRKETSEAQGKMSELEQLTELLLAQASA
FT                   LQNAESDRLRLNTQLEESQEEMKTLREEREELRRMQEALHVESEQQKESMKEISSKLQE
FT                   LQNKEYECLAMKTINETQGSRCEMDHLNQQLEAQKSTLEKVEMENVNLTQRLHETLEEM
FT                   RSVAKERDELWSMEERLTVERDQLKKSLEETVTKGMEKEEELRVAHVHLEEHQETINKL
FT                   RKMVSDYTDEISHTQGDLKHTNAVVEAQNQDLREKEHQLSQVKADLRETVDQMEQLKKK
FT                   LEAQSSTLESREIEKLELTQQLNENLKKITLVTKENDSLKIMDEALREERDQLRKSLQQ
FT                   TEARDLENQEKLRIAHMNLKEHQETIDRLMETMSEKTEEISNMKMELENVNMKLQEKDL
FT                   ENQEKLRIAHMNLKEHQETIDRLMETMSEKTEEISNMKMELENVNMKLQEKVQELKTSE
FT                   RQRVKLKADASEAKKELKEQGLTLSKIEMENLNLAQKIHENLEEMKSVRKERDDLKKLE
FT                   EILRMERDQLKDNLREAMLKAHQNHEETMKCGKGLLCAGEYCTGRLREKCFRIEKLLKR
FT                   YSEMANDYECLNKVSLDLERETKTQKELSVTVRTKLSLPHTQTKEMEKLLTANQRCSLE
FT                   FHRALKRLKYVLSSIARIKEEQHESINKREMAFIQEVEKQNELQIQIQSLSQTYRIPAR
FT                   DLQIKLSQEMDLHIEEMLKDFSENDFLTIKTEVQQVLNNRKEITEFLGKWLNTLFDTEN
FT                   LKSTIQKENKSIGLVNNFYHSRITAMINESTEFEERSATRSKDLDQYLKSLKETTEQLS
FT                   EVYQTLTASQSVVHLHPTVQPSTRDSERPQAASGAEQLTSKNKIALGAVPYKEEIEDLK
FT                   MQLVKSDLEKKATAKEFDKKILSLKATVEHQEEMIRLLRENLRGHQQAQDTSMISEQDS
FT                   QLLSKPLTCGGGSGIVQSTKALILKSEYKRMGSEISKLKQQNEQLRKQNNQLLSDNSQL
FT                   SNEVKTWEERTLKRDSYRETTCENSPKSPKVTRTDSKRRQNTTSQCRAQNLQDPVPKDS
FT                   PKSWFFDNRSKSLPAPHPIRYFDNSSLGLCPEPDDVENVEPKTDLCQASLEKDVSQCKT
FT                   Q"
FT   CDS             join(21711861..21711916,21714306..21714397,
FT                   21715534..21715623,21715748..21715866,21716455..21716574,
FT                   21717235..21717316,21717676..21717743,21717826..21717891,
FT                   21719482..21719533,21721430..21721517,21722371..21722500,
FT                   21724184..21724303,21727986..21728144,21729277..21729433,
FT                   21730594..21730682,21732126..21732293,21732957..21733031,
FT                   21733201..21733320,21734063..21734185,21734296..21734452,
FT                   21734687..21734841,21736733..21737047,21737157..21737429,
FT                   21737545..21737700,21738988..21739179,21740167..21740325,
FT                   21741281..21741571,21741695..21741858,21742818..21742878)
FT                   /codon_start=1
FT                   /gene="Cenpe"
FT                   /locus_tag="mCG_21038"
FT                   /product="centromere protein E, isoform CRA_b"
FT                   /note="gene_id=mCG21038.2 transcript_id=mCT190559.0
FT                   protein_id=mCP111552.0 isoform=CRA_b"
FT                   /protein_id="EDL12170.1"
FT                   /translation="MAEEASVAVCVRVRPLNSREEELGEATHIYWKTDKNAIYQSDGGK
FT                   SFQFDRVFDSNETTKNVYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSEDCLG
FT                   VIPRAIHDIFQRIKKFPEREFLLRVSYMEIYNETITDLLCNAQKMKPLIIREDTNRTVY
FT                   VSDLTEEVVYTAEMALKWLATGEKNRHYGITKMNQRSSRSHTIFRMILESREKAEPSNC
FT                   DGSVKVSHLNLVDLAGSERAAQTGAEGVRLKEGCFINRNLFILGQVIKKLSDGQVGGFI
FT                   NYRDSKLTRILQNSLGGNAKTRIICTITPASLDETLTTLQFASTAKYMKNTPYVNEVSN
FT                   DEALLKRYRREIADLRKQLEEVNTKTRAQEMEKDQLAQLLDEKDLLQKVQDEKINNLKR
FT                   MLVTSSSIALQQELEIKRKRRVTWCYGKMKDSNYEKEFKVPTSITTRKRKTSVTSLREN
FT                   SLMKFGESAASSEFEMLNNTLESLAEVEWSSATTLLSEENVESELNSLNAQYNDLVLDY
FT                   EQLRRENEDLKLKLKEKNELEEFELLEQKEERDQEMQLMHEVSNLKNLIKHAEEYNQDL
FT                   ENDLSSKVKLLKEKEEQIKNLQEYIDAQKSEKMKIDLSYTSDATEDLKQAMRTLSDLDT
FT                   VALDAKKESAFLRSENLELKEKINELSDSRKQMESDIQMYQRQLEAKKKMQTDLDKELQ
FT                   LAFQEISKLSALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSELKSLP
FT                   SEVETLRRELYEKSEELHIITTEREKLFSEMAHKDSRIQGLLEEIGNTRDDLATSQLSR
FT                   RGSDGEWQALESLHAELEHRHAGVLEERERLKQEIGALSKEAESLAFSLDSVKAELSHK
FT                   TQELEQKTVEGQERLNKMEALREELESRDSSLQSVEKEKVLLTEKLQQALKEVKALTQE
FT                   KKNLKQLQESLQTERDQLRSDIQDTVNMNIDTQEQLLNALESLKQHQETINMLKMKAAE
FT                   ELSDNLHVKDRGGARDEAQQKMDGIDEQNESAHTLLGGGKDNEVTEEQRKIDSLMQENS
FT                   GLQQTLESVRAEKEQLKMDLKENIEMSIENQEELRILRDELKRQQEVAAQEKDHATEKT
FT                   QELSRTQERLAKTEEKLEEKNQKLQETQQQLLSTQEAMSKLQAKVIDMESLQNEFRNQG
FT                   LALERVETEKLELAQRLHESYEEVKSITKERNDLKELQESFEIEKKQLKEYAREIEAAG
FT                   LQTKEELNIAHANLKEYQEIITELRGSISENEAQGASTQDTAKSAPELQGEVSMFQSKS
FT                   CFLLSKKPGTVQKK"
FT   assembly_gap    21749356..21749375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21781317..21805094
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /note="gene_id=mCG22366.2"
FT   mRNA            join(21781317..21781459,21785607..21785759,
FT                   21788592..21788670,21789883..21789979,21791324..21791432,
FT                   21795558..21795618,21797148..21797261,21801345..21801403,
FT                   21802233..21802325,21804839..21805094)
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2,
FT                   transcript variant mCT21802"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT21802.2 created
FT                   on 11-SEP-2002"
FT   mRNA            join(21781318..21781459,21785680..21785759,
FT                   21788592..21788670,21789883..21789979,21791324..21791432,
FT                   21795558..21795618,21797148..21797261,21801345..21801403,
FT                   21802233..21802325,21804839..21805094)
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2,
FT                   transcript variant mCT173059"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT173059.0 created
FT                   on 11-SEP-2002"
FT   CDS             join(21785658..21785759,21788592..21788670,
FT                   21789883..21789979,21791324..21791432,21795558..21795618,
FT                   21797148..21797261,21801345..21801403,21802233..21802325,
FT                   21804839..21804892)
FT                   /codon_start=1
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT21802.2
FT                   protein_id=mCP19186.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWD3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="MGI:MGI:1917022"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWD3"
FT                   /protein_id="EDL12167.1"
FT                   /translation="MSLDCAAGSTMGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIA
FT                   TDINESKLQELESYRGIQTRVLDVTKKRQIDQFASEIERIDVLFNVAGFVHHGTILDCE
FT                   EKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAA
FT                   VIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRFA
FT                   SAEEVALLCVYLASDESAYVTGNPVIIDGGWSL"
FT   CDS             join(21785688..21785759,21788592..21788670,
FT                   21789883..21789979,21791324..21791432,21795558..21795618,
FT                   21797148..21797261,21801345..21801403,21802233..21802325,
FT                   21804839..21804892)
FT                   /codon_start=1
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT173059.0
FT                   protein_id=mCP95978.0 isoform=CRA_c"
FT                   /protein_id="EDL12168.1"
FT                   /translation="MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQE
FT                   LESYRGIQTRVLDVTKKRQIDQFASEIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNL
FT                   NVRSMFLMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAA
FT                   DFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCV
FT                   YLASDESAYVTGNPVIIDGGWSL"
FT   assembly_gap    21785908..21786148
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   mRNA            join(<21788988..21789018,21789883..21789979,
FT                   21791324..21791432,21795558..21795618,21797148..21797261,
FT                   21801345..21801403,21802233..21802325,21804839..21805094)
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2,
FT                   transcript variant mCT173058"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT173058.0 created
FT                   on 11-SEP-2002"
FT   CDS             join(<21788988..21789018,21789883..21789979,
FT                   21791324..21791432,21795558..21795618,21797148..21797261,
FT                   21801345..21801403,21802233..21802325,21804839..21804892)
FT                   /codon_start=1
FT                   /gene="Bdh2"
FT                   /locus_tag="mCG_22366"
FT                   /product="3-hydroxybutyrate dehydrogenase, type 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22366.2 transcript_id=mCT173058.0
FT                   protein_id=mCP95977.0 isoform=CRA_a"
FT                   /protein_id="EDL12166.1"
FT                   /translation="SLGAALAQVTGIQTRVLDVTKKRQIDQFASEIERIDVLFNVAGFV
FT                   HHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVASSIKGVENR
FT                   CVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFL
FT                   NRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIIDGGWSL"
FT   assembly_gap    21799559..21800262
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   gene            21808371..21843727
FT                   /gene="C80638"
FT                   /locus_tag="mCG_125953"
FT                   /note="gene_id=mCG125953.1"
FT   mRNA            join(21808371..21808452,21816523..21816592,
FT                   21817696..21817835,21818922..21819102,21823212..21823382,
FT                   21824955..21825097,21825835..21825962,21827420..21827595,
FT                   21830318..21830424,21831094..21831243,21831909..21832017,
FT                   21833742..21833878,21837546..21837766,21843462..21843727)
FT                   /gene="C80638"
FT                   /locus_tag="mCG_125953"
FT                   /product="expressed sequence C80638, transcript variant
FT                   mCT127218"
FT                   /note="gene_id=mCG125953.1 transcript_id=mCT127218.1
FT                   created on 11-SEP-2002"
FT   mRNA            join(21808371..21808452,21823212..21823382,
FT                   21824955..21825097,21827420..21827595,21830318..21830424,
FT                   21831094..21831243,21831909..21832017,21833742..21833878,
FT                   21837546..21837766,21843462..21843727)
FT                   /gene="C80638"
FT                   /locus_tag="mCG_125953"
FT                   /product="expressed sequence C80638, transcript variant
FT                   mCT173048"
FT                   /note="gene_id=mCG125953.1 transcript_id=mCT173048.0
FT                   created on 11-SEP-2002"
FT   assembly_gap    21819847..21819866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(21825874..21825962,21827420..21827595,
FT                   21830318..21830424,21831094..21831243,21831909..21832017,
FT                   21833742..21833878,21837546..21837766,21843462..21843492)
FT                   /codon_start=1
FT                   /gene="C80638"
FT                   /locus_tag="mCG_125953"
FT                   /product="expressed sequence C80638, isoform CRA_a"
FT                   /note="gene_id=mCG125953.1 transcript_id=mCT127218.1
FT                   protein_id=mCP89654.1 isoform=CRA_a"
FT                   /protein_id="EDL12164.1"
FT                   /translation="MGPCIVEACASAILSHFLMGLPWQWGFILGFVVGAVSPAVVVPSM
FT                   LLLQEGGYGVGKGIPTLLMAAGSFDDILAITGFNTCLGVAFSTGSTVFNIFRGILEVVI
FT                   GVAAGSFLGFFIQYFPSRDQDNLVWKRAFLVLGFAVLAVFSSVYFSFPGSGGLCTLVMA
FT                   FLAGMRWTDKKSEVEKVIAVTWDVFQPLLFGLIGAEVSIVSLRAETVGLCVATLSIAVL
FT                   IRILTTFLMVCFAGFNIKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMD
FT                   VLTVAFLAILITAPIGSLLIGLLGPRVLQKSEHRTEEEVQGETSAHIQRKPEDSITEA"
FT   CDS             join(21827463..21827595,21830318..21830424,
FT                   21831094..21831243,21831909..21832017,21833742..21833878,
FT                   21837546..21837766,21843462..21843492)
FT                   /codon_start=1
FT                   /gene="C80638"
FT                   /locus_tag="mCG_125953"
FT                   /product="expressed sequence C80638, isoform CRA_b"
FT                   /note="gene_id=mCG125953.1 transcript_id=mCT173048.0
FT                   protein_id=mCP95967.0 isoform=CRA_b"
FT                   /protein_id="EDL12165.1"
FT                   /translation="MLLLQEGGYGVGKGIPTLLMAAGSFDDILAITGFNTCLGVAFSTG
FT                   STVFNIFRGILEVVIGVAAGSFLGFFIQYFPSRDQDNLVWKRAFLVLGFAVLAVFSSVY
FT                   FSFPGSGGLCTLVMAFLAGMRWTDKKSEVEKVIAVTWDVFQPLLFGLIGAEVSIVSLRA
FT                   ETVGLCVATLSIAVLIRILTTFLMVCFAGFNIKEKIFISFAWLPKATVQAAIGSVALDT
FT                   ARSHGEKQLEDYGMDVLTVAFLAILITAPIGSLLIGLLGPRVLQKSEHRTEEEVQGETS
FT                   AHIQRKPEDSITEA"
FT   assembly_gap    21835146..21835165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21849225..>21899036
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /note="gene_id=mCG22365.2"
FT   mRNA            join(21849225..21849317,21849522..21849968,
FT                   21856206..21856266,21858652..21858949,21873041..21873211,
FT                   21874315..21874457,21875470..21875597,21883906..21884081,
FT                   21891650..21891756,21893328..21893477,21895188..21895296,
FT                   21896072..21896208,21898824..>21899036)
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, transcript variant
FT                   mCT173054"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173054.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(21849225..21849317,21849522..21849968,
FT                   21856206..21856266,21858652..21858949,21873041..21873211,
FT                   21874315..21874457,21875470..21875597,21883906..21884081,
FT                   21891650..21891756,21893389..21893477,21893925..21894310)
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, transcript variant
FT                   mCT21980"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT21980.2 created
FT                   on 10-SEP-2002"
FT   mRNA            join(21849225..21849317,21849522..21849968,
FT                   21856206..21856266,21858652..21858949,21873041..21873211,
FT                   21874315..21874457,21875470..21875874)
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, transcript variant
FT                   mCT173055"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173055.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(21849225..21849317,21849522..21849968,
FT                   21856206..21856266,21858652..21858816,21873044..21873211,
FT                   21874315..21874457,21875470..21875670)
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, transcript variant
FT                   mCT173057"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173057.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(21849238..21849292,21849525..21849968,
FT                   21856206..21856266,21858652..21859501)
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, transcript variant
FT                   mCT173056"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173056.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(21849964..21849968,21856206..21856266,
FT                   21858652..21858949,21873041..21873211,21874315..21874457,
FT                   21875470..21875597,21883906..21884081,21891650..21891756,
FT                   21893328..21893477,21895188..21895296,21896072..21896208,
FT                   21898824..21899036)
FT                   /codon_start=1
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, isoform CRA_a"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173054.0
FT                   protein_id=mCP95973.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8I2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="MGI:MGI:1921696"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8I2"
FT                   /protein_id="EDL12159.1"
FT                   /translation="MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPE
FT                   PKEPEPKEPERKEPERKEPERKEPERKEPERKVPGRRETQTKETQTTEIERKETKKKRG
FT                   TNSYCPPQGTINKTITDGAALIALWTLLWALIGQEVLPGGNLFGLVVIFYSAFLGGKIL
FT                   EFIRIPVVPPLPPLIGMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLG
FT                   LDPQALKHLKGVCLRLSFGPCFLEACSAALFSHFIMNFPWQWGFLLGFVLGAVSPAVVV
FT                   PNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSGSVISNILSSLRD
FT                   VLIGVLVGIVMGVFVQYFPSGDQERLTQRRAFLVLSMCISAVLGCQHIGLHGSGGLVTL
FT                   VLSFMAAKRWAEEKVGIQKIVANTWNVFQPLLFGLVGTEVSVESLESKTIGMCLATLGL
FT                   ALSVRILSTFVLMSFANFRFKEKVFIALSWIPKATVQAVLGPLALETARVMAPHLEGYA
FT                   KAVMTVAFLAILITAPNGALLIGILGPKILEQSEVTFPLKVELSNFHH"
FT   CDS             join(21849964..21849968,21856206..21856266,
FT                   21858652..21858949,21873041..21873211,21874315..21874457,
FT                   21875470..21875597,21883906..21884081,21891650..21891756,
FT                   21893389..21893436)
FT                   /codon_start=1
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, isoform CRA_d"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT21980.2
FT                   protein_id=mCP19242.1 isoform=CRA_d"
FT                   /protein_id="EDL12162.1"
FT                   /translation="MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPE
FT                   PKEPEPKEPERKEPERKEPERKEPERKEPERKVPGRRETQTKETQTTEIERKETKKKRG
FT                   TNSYCPPQGTINKTITDGAALIALWTLLWALIGQEVLPGGNLFGLVVIFYSAFLGGKIL
FT                   EFIRIPVVPPLPPLIGMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLG
FT                   LDPQALKHLKGVCLRLSFGPCFLEACSAALFSHFIMNFPWQWGFLLGFVLGAVSPAVVV
FT                   PNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSGSVISNILSSLRD
FT                   VLIGVLVGIVMGVFVQYFPSGDQAASTLAYMDLEDWSH"
FT   CDS             join(21849964..21849968,21856206..21856266,
FT                   21858652..21858949,21873041..21873211,21874315..21874457,
FT                   21875470..21875601)
FT                   /codon_start=1
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, isoform CRA_b"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173055.0
FT                   protein_id=mCP95974.0 isoform=CRA_b"
FT                   /protein_id="EDL12160.1"
FT                   /translation="MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPE
FT                   PKEPEPKEPERKEPERKEPERKEPERKEPERKVPGRRETQTKETQTTEIERKETKKKRG
FT                   TNSYCPPQGTINKTITDGAALIALWTLLWALIGQEVLPGGNLFGLVVIFYSAFLGGKIL
FT                   EFIRIPVVPPLPPLIGMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLG
FT                   LDPQALKHLKGVCLRLSFGPCFLEACSAALFSHFIMNFPWQWGFLLG"
FT   CDS             join(21849964..21849968,21856206..21856266,
FT                   21858652..21858816,21873044..21873085)
FT                   /codon_start=1
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, isoform CRA_e"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173057.0
FT                   protein_id=mCP95976.0 isoform=CRA_e"
FT                   /protein_id="EDL12163.1"
FT                   /translation="MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPE
FT                   PKEPEPKEPERKEPERKEPERKEPERKEPERKLHSLHYGLYSGPL"
FT   CDS             join(21849964..21849968,21856206..21856266,
FT                   21858652..21859023)
FT                   /codon_start=1
FT                   /gene="4933425K02Rik"
FT                   /locus_tag="mCG_22365"
FT                   /product="RIKEN cDNA 4933425K02, isoform CRA_c"
FT                   /note="gene_id=mCG22365.2 transcript_id=mCT173056.0
FT                   protein_id=mCP95975.0 isoform=CRA_c"
FT                   /protein_id="EDL12161.1"
FT                   /translation="MSEHDVESNKKDDGFQSSVTVEMSKDPDSFHEETVEPKPELKEPE
FT                   PKEPEPKEPERKEPERKEPERKEPERKEPERKVPGRRETQTKETQTTEIERKETKKKRG
FT                   TNSYCPPQGTINKTITDGMSNKKCTWGENEKYKMQMIRLTV"
FT   gene            complement(21907643..21924618)
FT                   /gene="1500009M05Rik"
FT                   /locus_tag="mCG_22363"
FT                   /note="gene_id=mCG22363.2"
FT   mRNA            complement(join(21907643..21910129,21912250..21912464,
FT                   21924479..21924618))
FT                   /gene="1500009M05Rik"
FT                   /locus_tag="mCG_22363"
FT                   /product="RIKEN cDNA 1500009M05, transcript variant
FT                   mCT21800"
FT                   /note="gene_id=mCG22363.2 transcript_id=mCT21800.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(21910040..21910129,21912250..21912464,
FT                   21924479..21924581))
FT                   /codon_start=1
FT                   /gene="1500009M05Rik"
FT                   /locus_tag="mCG_22363"
FT                   /product="RIKEN cDNA 1500009M05, isoform CRA_a"
FT                   /note="gene_id=mCG22363.2 transcript_id=mCT21800.2
FT                   protein_id=mCP19241.1 isoform=CRA_a"
FT                   /protein_id="EDL12157.1"
FT                   /translation="MVLDSVARIVKVQLPAYLKQLPVPDSITGFARLTVSDWLRLLPFL
FT                   GVLALLGYLAVRPFFPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRS
FT                   KTFPACDGSHNKHNELTGDNVGPLILKKKEV"
FT   mRNA            complement(join(21911249..21912464,21924479..21924618))
FT                   /gene="1500009M05Rik"
FT                   /locus_tag="mCG_22363"
FT                   /product="RIKEN cDNA 1500009M05, transcript variant
FT                   mCT173053"
FT                   /note="gene_id=mCG22363.2 transcript_id=mCT173053.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(21912241..21912464,21924479..21924581))
FT                   /codon_start=1
FT                   /gene="1500009M05Rik"
FT                   /locus_tag="mCG_22363"
FT                   /product="RIKEN cDNA 1500009M05, isoform CRA_b"
FT                   /note="gene_id=mCG22363.2 transcript_id=mCT173053.0
FT                   protein_id=mCP95972.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z3X4"
FT                   /db_xref="InterPro:IPR019610"
FT                   /db_xref="MGI:MGI:1914256"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3X4"
FT                   /protein_id="EDL12158.1"
FT                   /translation="MVLDSVARIVKVQLPAYLKQLPVPDSITGFARLTVSDWLRLLPFL
FT                   GVLALLGYLAVRPFFPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRS
FT                   KTVR"
FT   assembly_gap    21917068..21917253
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            complement(21926457..21929152)
FT                   /locus_tag="mCG_141962"
FT                   /note="gene_id=mCG141962.0"
FT   mRNA            complement(21926457..21929152)
FT                   /locus_tag="mCG_141962"
FT                   /product="mCG141962"
FT                   /note="gene_id=mCG141962.0 transcript_id=mCT178114.0
FT                   created on 02-JAN-2003"
FT   CDS             complement(21926920..21927249)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141962"
FT                   /product="mCG141962"
FT                   /note="gene_id=mCG141962.0 transcript_id=mCT178114.0
FT                   protein_id=mCP101036.0"
FT                   /protein_id="EDL12156.1"
FT                   /translation="MHQLLYRRPGFESQHLHRGLQQSVTPVPRYLMPFLVFITTRHACG
FT                   TQTYMQAKHRHTKRRNLKRKEVKQDINSDGTIRLSFNIARAIQQKQLIYDPYFSKFQGK
FT                   KVLGI"
FT   gene            complement(21929383..21932949)
FT                   /locus_tag="mCG_147422"
FT                   /note="gene_id=mCG147422.0"
FT   mRNA            complement(join(21929383..21932731,21932757..21932949))
FT                   /locus_tag="mCG_147422"
FT                   /product="mCG147422"
FT                   /note="gene_id=mCG147422.0 transcript_id=mCT187685.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(21931704..21931874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147422"
FT                   /product="mCG147422"
FT                   /note="gene_id=mCG147422.0 transcript_id=mCT187685.0
FT                   protein_id=mCP109646.0"
FT                   /protein_id="EDL12155.1"
FT                   /translation="MFLKDRESKISGSHLVKVFLLYLNMAERPANTRKTQRKGTGYKLH
FT                   LLRTNPLTGCL"
FT   gene            complement(21937475..21939010)
FT                   /locus_tag="mCG_147409"
FT                   /note="gene_id=mCG147409.0"
FT   mRNA            complement(join(21937475..21937655,21937784..21939010))
FT                   /locus_tag="mCG_147409"
FT                   /product="mCG147409"
FT                   /note="gene_id=mCG147409.0 transcript_id=mCT187672.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(21938299..21938499)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147409"
FT                   /product="mCG147409"
FT                   /note="gene_id=mCG147409.0 transcript_id=mCT187672.0
FT                   protein_id=mCP109634.0"
FT                   /protein_id="EDL12154.1"
FT                   /translation="MLILFSRPEIILTTSSQVIEITSSEPFSELVNPQYLPRALRDTSD
FT                   FLLPEQPIVLSWLTSRHKAKS"
FT   gene            21939544..21969438
FT                   /locus_tag="mCG_22362"
FT                   /note="gene_id=mCG22362.2"
FT   mRNA            join(21939544..21939600,21940896..21941050,
FT                   21956433..21956496,21956593..21956624,21960045..21960122,
FT                   21961222..21961327,21964197..21964290,21966442..21969438)
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, transcript variant mCT170973"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT170973.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(21939791..21939946,21940896..21941050,
FT                   21956433..21956496,21956593..21956624,21960045..21960122,
FT                   21961222..21961327,21964197..21964290,21966442..21969438)
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, transcript variant mCT178135"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT178135.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(21939791..21939946,21940913..21941050,
FT                   21956433..21956496,21956593..21956624,21960045..21960122,
FT                   21961222..21961327,21964197..21964290,21966442..21969438)
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, transcript variant mCT178134"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT178134.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(21939826..21940088,21940896..21941050,
FT                   21956433..21956496,21956593..21956624,21960045..21960122,
FT                   21961222..21961327,21964197..21964290,21966442..21969438)
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, transcript variant mCT21799"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT21799.2 created
FT                   on 03-JAN-2003"
FT   assembly_gap    21940089..21940664
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   mRNA            join(21940665..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21969438)
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, transcript variant mCT170972"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT170972.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(21941027..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21966487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, isoform CRA_a"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT170973.0
FT                   protein_id=mCP93891.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4QQL2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1913355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QQL2"
FT                   /protein_id="EDL12149.1"
FT                   /translation="MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM"
FT   CDS             join(21941027..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21966487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, isoform CRA_a"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT178134.0
FT                   protein_id=mCP101056.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4QQL2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1913355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QQL2"
FT                   /protein_id="EDL12150.1"
FT                   /translation="MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM"
FT   CDS             join(21941027..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21966487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, isoform CRA_a"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT178135.0
FT                   protein_id=mCP101057.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4QQL2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1913355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QQL2"
FT                   /protein_id="EDL12151.1"
FT                   /translation="MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM"
FT   CDS             join(21941027..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21966487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, isoform CRA_a"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT170972.0
FT                   protein_id=mCP93890.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4QQL2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1913355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QQL2"
FT                   /protein_id="EDL12152.1"
FT                   /translation="MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM"
FT   CDS             join(21941027..21941050,21956433..21956496,
FT                   21956593..21956624,21960045..21960122,21961222..21961327,
FT                   21964197..21964290,21966442..21966487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22362"
FT                   /product="mCG22362, isoform CRA_a"
FT                   /note="gene_id=mCG22362.2 transcript_id=mCT21799.2
FT                   protein_id=mCP19204.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4QQL2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1913355"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QQL2"
FT                   /protein_id="EDL12153.1"
FT                   /translation="MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM"
FT   assembly_gap    21978254..21978329
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    21982644..21982663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21986927..22078452
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /note="gene_id=mCG125948.1"
FT   mRNA            join(21986927..21987179,22013640..22013734,
FT                   22017837..22017942,22018665..22018835,22024777..22024900,
FT                   22029865..22030040,22031390..22031500,22049057..22049208,
FT                   22051471..22051588,22054281..22054367,22055923..22056090,
FT                   22058024..22058242,22061923..22062087,22070350..22070494,
FT                   22073633..22073736,22074515..22074772,22077266..22078452)
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, transcript
FT                   variant mCT127213"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT127213.1
FT                   created on 23-JUL-2002"
FT   mRNA            join(<21986935..21987179,22013640..22013734,
FT                   22017837..22017942,22018665..22018835,22019220..22019321,
FT                   22024777..22024900,22029865..22030040,22031390..22031500,
FT                   22049057..22049208,22051471..22051588,22054281..22054367,
FT                   22055923..22056090,22058024..22058242,22061923..22062729)
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, transcript
FT                   variant mCT190568"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT190568.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<21986940..21987179,22013640..22013734,
FT                   22017837..22017942,22018665..22018835,22024777..22024900,
FT                   22029865..22030040,22031390..22031500,22049057..22049208,
FT                   22051471..22051588,22054281..22054367,22055923..22056090,
FT                   22058024..22058242,22061923..22062690)
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, transcript
FT                   variant mCT190567"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT190567.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<21986940..21987179,22013640..22013734,
FT                   22017837..22017942,22018665..22018835,22024777..22024900,
FT                   22029865..22030040,22031390..22031500,22049057..22049208,
FT                   22051471..22051588,22054281..22054367,22055923..22056090,
FT                   22058024..22058242,22061923..22062102)
FT                   /codon_start=1
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, isoform CRA_b"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT190567.0
FT                   protein_id=mCP111541.0 isoform=CRA_b"
FT                   /protein_id="EDL12145.1"
FT                   /translation="QRPGLGKAWATLPGSCLRAVSMHLHLLLILALFRAGCVVAGPSYS
FT                   LSGSWRVSNGNGSLELPATVPGYVHSALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTE
FT                   FKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDVTNVVKDVNSLKL
FT                   QFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGI
FT                   WKDVRIEAYNIAHLDYLTFLPVYDNASQAWNIEIEASFDVASSKSVSGQVTVAIPQLKT
FT                   QQTNDIELQQEQRIVKLLVKIRKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAA
FT                   KVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQS
FT                   VVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVT
FT                   YQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSE
FT                   DKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEY
FT                   GYQSWPSFSTLEKVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRT
FT                   FKDTIYLTQVSHF"
FT   CDS             join(21987003..21987179,22013640..22013734,
FT                   22017837..22017942,22018665..22018835,22024777..22024900,
FT                   22029865..22030040,22031390..22031500,22049057..22049208,
FT                   22051471..22051588,22054281..22054367,22055923..22056090,
FT                   22058024..22058242,22061923..22062087,22070350..22070494,
FT                   22073633..22073736,22074515..22074772,22077266..22077490)
FT                   /codon_start=1
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, isoform CRA_a"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT127213.1
FT                   protein_id=mCP89550.1 isoform=CRA_a"
FT                   /protein_id="EDL12144.1"
FT                   /translation="MHLHLLLILALFRAGCVVAGPSYSLSGSWRVSNGNGSLELPATVP
FT                   GYVHSALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVD
FT                   TVAEILFNNVTIGKTDNMFTGYSFDVTNVVKDVNSLKLQFRSAVQYAECQSKAHTSYRV
FT                   PPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYNIAHLDYLTFLP
FT                   VYDNASQAWNIEIEASFDVASSKSVSGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKI
FT                   RKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLS
FT                   FYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDE
FT                   FYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNEN
FT                   EVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEG
FT                   WISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLEKVSSQEDWA
FT                   YNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRTFKDTIYLTQVMQAQCIKTETE
FT                   FYLRSRSEIVDGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPV
FT                   GFEDEGVFYVYGVRLHHWSSPKPLCSLVNSSIVVKAGEAVVLFQMPVSELLKRCRGCTR
FT                   ETCVVSFYFSTDKELFSPTNYHFLSSLKDAKGLLEANITVNISQKGNVFVFDLETSAVA
FT                   PFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKSELQQAFSVTSLTDTY"
FT   assembly_gap    21991004..21991726
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    21999196..22001915
FT                   /estimated_length=2720
FT                   /gap_type="unknown"
FT   assembly_gap    22003361..22003380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22004410..22004429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22006078..22006097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22007326..22007345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<22019271..22019321,22024777..22024900,
FT                   22029865..22030040,22031390..22031500,22049057..22049208,
FT                   22051471..22051588,22054281..22054367,22055923..22056090,
FT                   22058024..22058242,22061923..22062102)
FT                   /codon_start=1
FT                   /gene="Manba"
FT                   /locus_tag="mCG_125948"
FT                   /product="mannosidase, beta A, lysosomal, isoform CRA_c"
FT                   /note="gene_id=mCG125948.1 transcript_id=mCT190568.0
FT                   protein_id=mCP111542.0 isoform=CRA_c"
FT                   /protein_id="EDL12146.1"
FT                   /translation="PPISNPSPTSLQSAEFKAQCSFSWDWGPSFPSQGIWKDVRIEAYN
FT                   IAHLDYLTFLPVYDNASQAWNIEIEASFDVASSKSVSGQVTVAIPQLKTQQTNDIELQQ
FT                   EQRIVKLLVKIRKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLI
FT                   EEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQSVVDANMNTLR
FT                   VWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHP
FT                   SIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASS
FT                   PTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFST
FT                   LEKVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRTFKDTIYLTQV
FT                   SHF"
FT   gene            complement(22031760..>22033547)
FT                   /locus_tag="mCG_22376"
FT                   /note="gene_id=mCG22376.2"
FT   mRNA            complement(22031760..>22033547)
FT                   /locus_tag="mCG_22376"
FT                   /product="mCG22376"
FT                   /note="gene_id=mCG22376.2 transcript_id=mCT21990.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(22032835..>22033308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22376"
FT                   /product="mCG22376"
FT                   /note="gene_id=mCG22376.2 transcript_id=mCT21990.2
FT                   protein_id=mCP19190.1"
FT                   /protein_id="EDL12148.1"
FT                   /translation="DAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGKPH
FT                   IVHFQYEVTQVKVSSWDAVLSSESLFVEIPDGLLADGSKEGLLTLLEFAEEKMKVNYVF
FT                   ICFRKSREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED"
FT   assembly_gap    22048627..22048646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22054440..22054478
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    22056674..22057234
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   assembly_gap    22061426..22061496
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            complement(22070799..>22072172)
FT                   /locus_tag="mCG_145184"
FT                   /note="gene_id=mCG145184.0"
FT   mRNA            complement(join(22070799..22071084,22071125..22071747,
FT                   22071773..>22072172))
FT                   /locus_tag="mCG_145184"
FT                   /product="mCG145184"
FT                   /note="gene_id=mCG145184.0 transcript_id=mCT184608.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(22071573..22071747,22071773..>22071807))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145184"
FT                   /product="mCG145184"
FT                   /note="gene_id=mCG145184.0 transcript_id=mCT184608.0
FT                   protein_id=mCP106180.0"
FT                   /protein_id="EDL12147.1"
FT                   /translation="RSHSQRFLFSRFLFVFRDRVSLCSPGCPGTHSVDQAGLELRNSSA
FT                   SASQVLGLKACATTPGLVPVFLKQ"
FT   assembly_gap    22073739..22073758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22091725..22198638)
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /note="gene_id=mCG22374.2"
FT   mRNA            complement(join(22091725..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22098946,
FT                   22112446..22112623,22113950..22114039,22115530..22115673,
FT                   22119795..22119933,22121032..22121123,22121288..22121392,
FT                   22122654..22122812,22126181..22126344,22133975..22134123,
FT                   22163002..22163100,22166530..22166567,22170417..22170495,
FT                   22175268..22175307,22176785..22176854,22198528..22198638))
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, transcript variant mCT167824"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167824.0 created
FT                   on 10-APR-2002"
FT   mRNA            complement(join(22091728..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22099055,
FT                   22101215..22101317,22101593..22101762,22102249..22102450,
FT                   22108804..22108918,22111088..22111192,22112431..22112623,
FT                   22115530..22115673,22119795..22119933,22121032..22121123,
FT                   22121288..22121392,22122654..22122782,22126181..22126344,
FT                   22133975..22134123,22163002..22163100,22166530..22166567,
FT                   22170417..22170495,22175268..22175307,22176785..22176854,
FT                   22198528..22198638))
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, transcript variant mCT167821"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167821.0 created
FT                   on 10-APR-2002"
FT   mRNA            complement(join(22091765..22092180,22101674..22101762,
FT                   22102249..22102450,22108804..22108918,22111088..22111229,
FT                   22112435..22112623,22113950..22114039,22115530..22115673,
FT                   22119795..22119933,22121032..22121123,22121288..22121392,
FT                   22122654..22122812,22126181..22126344,22133975..22134123,
FT                   22163002..22163100,22166530..22166567,22170417..22170495,
FT                   22175268..22175307,22176785..22176854,22198528..22198638))
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, transcript variant mCT167823"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167823.0 created
FT                   on 10-APR-2002"
FT   mRNA            complement(join(22091765..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22099055,
FT                   22101215..22101317,22101593..22101762,22102249..22102450,
FT                   22108804..22108918,22111088..22111229,22112435..22112623,
FT                   22113950..22114039,22115530..22115673,22119795..22119933,
FT                   22121032..22121123,22121288..22121392,22122654..22122812,
FT                   22126181..22126344,22133975..22134123,22163002..22163100,
FT                   22166530..22166567,22170417..22170495,22175268..22175307,
FT                   22176785..22176854,22198528..22198638))
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, transcript variant mCT21989"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT21989.1 created
FT                   on 10-APR-2002"
FT   CDS             complement(join(22091995..22092180,22101674..22101762,
FT                   22102249..22102450,22108804..22108918,22111088..22111229,
FT                   22112435..22112623,22113950..22114039,22115530..22115673,
FT                   22119795..22119933,22121032..22121123,22121288..22121392,
FT                   22122654..22122812,22126181..22126344,22133975..22134123,
FT                   22163002..22163100,22166530..22166567,22170417..22170495,
FT                   22175268..22175300))
FT                   /codon_start=1
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, isoform CRA_c"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167823.0
FT                   protein_id=mCP90764.0 isoform=CRA_c"
FT                   /protein_id="EDL12141.1"
FT                   /translation="MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQIL
FT                   EQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNI
FT                   HLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGY
FT                   NPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDST
FT                   GSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIR
FT                   FYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETS
FT                   EPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPG
FT                   PGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEK
FT                   ETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAV
FT                   TGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRND
FT                   LYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRK
FT                   AAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQVQCLELSLLLLDHICFVL
FT                   LLLSLRWVPAVIKRCRCPHPVSFLAIYCKLCIQIKIKEKHIFK"
FT   CDS             complement(join(22092428..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22099055,
FT                   22101215..22101317,22101593..22101762,22102249..22102450,
FT                   22108804..22108918,22111088..22111192,22112431..22112623,
FT                   22115530..22115673,22119795..22119933,22121032..22121123,
FT                   22121288..22121392,22122654..22122782,22126181..22126344,
FT                   22133975..22134123,22163002..22163100,22166530..22166567,
FT                   22170417..22170495,22175268..22175300))
FT                   /codon_start=1
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, isoform CRA_a"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167821.0
FT                   protein_id=mCP90765.0 isoform=CRA_a"
FT                   /protein_id="EDL12139.1"
FT                   /translation="MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQIL
FT                   EQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNI
FT                   HLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGY
FT                   NPGLLVHSDLAYLQAEGGGDRQLTAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPV
FT                   VSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGV
FT                   WEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
FT                   IKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGTINTKFKN
FT                   GPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQGRRHA
FT                   NALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISD
FT                   DIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRIL
FT                   SILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALH
FT                   LAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVEN
FT                   FEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDM
FT                   KQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGG
FT                   TIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELR
FT                   DSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI"
FT   CDS             complement(join(22092428..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22098946,
FT                   22112446..22112623,22113950..22114039,22115530..22115673,
FT                   22119795..22119933,22121032..22121123,22121288..22121392,
FT                   22122654..22122812,22126181..22126344,22133975..22134123,
FT                   22163002..22163100,22166530..22166567,22170417..22170495,
FT                   22175268..22175300))
FT                   /codon_start=1
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, isoform CRA_d"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167824.0
FT                   protein_id=mCP90766.0 isoform=CRA_d"
FT                   /protein_id="EDL12142.1"
FT                   /translation="MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQIL
FT                   EQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNI
FT                   HLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGY
FT                   NPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDST
FT                   GSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIR
FT                   FYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETS
FT                   EPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPG
FT                   PGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEK
FT                   ETEGEGPSLPMACTKTEPIALASTMEDKEQDMAANWQVFDILNGKPYEPVFTSDDILPQ
FT                   GDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEV
FT                   SGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHID
FT                   ELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI"
FT   CDS             complement(join(22092428..22092588,22096668..22096845,
FT                   22097690..22097862,22098157..22098223,22098931..22099055,
FT                   22101215..22101317,22101593..22101762,22102249..22102450,
FT                   22108804..22108918,22111088..22111229,22112435..22112623,
FT                   22113950..22114039,22115530..22115673,22119795..22119933,
FT                   22121032..22121123,22121288..22121392,22122654..22122812,
FT                   22126181..22126344,22133975..22134123,22163002..22163100,
FT                   22166530..22166567,22170417..22170495,22175268..22175300))
FT                   /codon_start=1
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, isoform CRA_e"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT21989.1
FT                   protein_id=mCP19275.2 isoform=CRA_e"
FT                   /db_xref="GOA:P25799"
FT                   /db_xref="InterPro:IPR000451"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011539"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:97312"
FT                   /db_xref="PDB:1BFS"
FT                   /db_xref="PDB:1IKN"
FT                   /db_xref="PDB:1LE5"
FT                   /db_xref="PDB:1LE9"
FT                   /db_xref="PDB:1LEI"
FT                   /db_xref="PDB:1NFK"
FT                   /db_xref="PDB:1OOA"
FT                   /db_xref="PDB:1U36"
FT                   /db_xref="PDB:1U3J"
FT                   /db_xref="PDB:1U3Y"
FT                   /db_xref="PDB:1U3Z"
FT                   /db_xref="PDB:1U41"
FT                   /db_xref="PDB:1U42"
FT                   /db_xref="PDB:1VKX"
FT                   /db_xref="PDB:2I9T"
FT                   /db_xref="PDB:2V2T"
FT                   /db_xref="PDB:3JV4"
FT                   /protein_id="EDL12143.1"
FT                   /translation="MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQIL
FT                   EQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNI
FT                   HLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGY
FT                   NPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDST
FT                   GSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIR
FT                   FYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETS
FT                   EPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPG
FT                   PGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEK
FT                   ETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAV
FT                   TGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRND
FT                   LYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRK
FT                   AAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNI
FT                   SLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLD
FT                   DSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTR
FT                   LQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEA
FT                   LQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDS
FT                   GVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI"
FT   assembly_gap    22095189..22095208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22096993..22097057
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   mRNA            complement(join(22119409..22119933,22121032..22121123,
FT                   22121288..22121392,22122654..22122812,22126181..22126344,
FT                   22133975..22134123,22163002..22163100,22166530..22166567,
FT                   22170417..22170495,22175268..22175307,22176785..22176854,
FT                   22198528..22198638))
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, transcript variant mCT167822"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167822.0 created
FT                   on 10-APR-2002"
FT   CDS             complement(join(22119778..22119933,22121032..22121123,
FT                   22121288..22121392,22122654..22122812,22126181..22126344,
FT                   22133975..22134123,22163002..22163100,22166530..22166567,
FT                   22170417..22170495,22175268..22175300))
FT                   /codon_start=1
FT                   /gene="Nfkb1"
FT                   /locus_tag="mCG_22374"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells 1, p105, isoform CRA_b"
FT                   /note="gene_id=mCG22374.2 transcript_id=mCT167822.0
FT                   protein_id=mCP90763.0 isoform=CRA_b"
FT                   /protein_id="EDL12140.1"
FT                   /translation="MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQIL
FT                   EQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNI
FT                   HLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGY
FT                   NPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDST
FT                   GSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIR
FT                   FYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETS
FT                   EPKPFLYYPEIKGTWVV"
FT   assembly_gap    22139283..22139302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22145592..22145805
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    22198117..22198236
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    22198639..22198944
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    22200055..22200100
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    22214768..22214873
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    22215232..22216611
FT                   /estimated_length=1380
FT                   /gap_type="unknown"
FT   assembly_gap    22220681..22220851
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    22234546..22234565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22245213..22245334
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    22307495..22307514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22308935..22309976
FT                   /estimated_length=1042
FT                   /gap_type="unknown"
FT   assembly_gap    22322115..22322134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22332655..22399648
FT                   /gene="Slc39a8"
FT                   /locus_tag="mCG_22372"
FT                   /note="gene_id=mCG22372.2"
FT   mRNA            join(22332655..22332910,22333633..22334083,
FT                   22360178..22360340,22367151..22367320,22368729..22368851,
FT                   22369317..22369487,22395454..22395661,22395859..22396043,
FT                   22398062..22399648)
FT                   /gene="Slc39a8"
FT                   /locus_tag="mCG_22372"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 8, transcript variant mCT21987"
FT                   /note="gene_id=mCG22372.2 transcript_id=mCT21987.1 created
FT                   on 23-JUL-2002"
FT   mRNA            join(<22333481..22334083,22360178..22360340,
FT                   22367151..22367320,22368729..22368851,22369317..22369487,
FT                   22395454..22395661,22395859..22396043,22398062..22399648)
FT                   /gene="Slc39a8"
FT                   /locus_tag="mCG_22372"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 8, transcript variant mCT190584"
FT                   /note="gene_id=mCG22372.2 transcript_id=mCT190584.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<22333763..22334083,22360178..22360340,
FT                   22367151..22367320,22368729..22368851,22369317..22369487,
FT                   22395454..22395661,22395859..22396043,22398062..22398211)
FT                   /codon_start=1
FT                   /gene="Slc39a8"
FT                   /locus_tag="mCG_22372"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 8, isoform CRA_a"
FT                   /note="gene_id=mCG22372.2 transcript_id=mCT190584.0
FT                   protein_id=mCP111555.0 isoform=CRA_a"
FT                   /protein_id="EDL12136.1"
FT                   /translation="RGTGAPSHPHPNGTDTGAPARVPASASSGAARSTMAPGRAVAGLL
FT                   LLAATSLGHPSEGPELAFSEDVLSVFGANRSLSAAQLGRLLERLGAASQQGALDLGQLH
FT                   FNQCLSAEDIFSLHGFSNVTQITSSNFSAICPAILQQLNFHPCEDLRKHNAKPSLSEVW
FT                   GYGFLSVTIINLASLLGLILTPLIKKSYFPKILTYFVGLAIGTLFSNAIFQLIPEAFGF
FT                   NPKIDNYVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKEKTHQPKT
FT                   LPLPAVNGVTCYANPAVTEPNGHIHFDTVSVVSLQDGKTEPSSCTCLKGPKLSEIGTIA
FT                   WMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTR
FT                   QALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLREK
FT                   VTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGDIELQ"
FT   CDS             join(22333865..22334083,22360178..22360340,
FT                   22367151..22367320,22368729..22368851,22369317..22369487,
FT                   22395454..22395661,22395859..22396043,22398062..22398211)
FT                   /codon_start=1
FT                   /gene="Slc39a8"
FT                   /locus_tag="mCG_22372"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 8, isoform CRA_b"
FT                   /note="gene_id=mCG22372.2 transcript_id=mCT21987.1
FT                   protein_id=mCP19263.1 isoform=CRA_b"
FT                   /protein_id="EDL12137.1"
FT                   /translation="MAPGRAVAGLLLLAATSLGHPSEGPELAFSEDVLSVFGANRSLSA
FT                   AQLGRLLERLGAASQQGALDLGQLHFNQCLSAEDIFSLHGFSNVTQITSSNFSAICPAI
FT                   LQQLNFHPCEDLRKHNAKPSLSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILT
FT                   YFVGLAIGTLFSNAIFQLIPEAFGFNPKIDNYVEKAVAVFGGFYMLFFVERTLKMLLKT
FT                   YGQNDHTHFRNDDFGSKEKTHQPKTLPLPAVNGVTCYANPAVTEPNGHIHFDTVSVVSL
FT                   QDGKTEPSSCTCLKGPKLSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSI
FT                   AILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFA
FT                   LAGGMFLYISLADMFPEMNDMLREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGD
FT                   IELQ"
FT   gene            complement(22341094..>22351429)
FT                   /locus_tag="mCG_144628"
FT                   /note="gene_id=mCG144628.0"
FT   mRNA            complement(join(22341094..22341508,22342173..22342275,
FT                   22349435..22349479,22350790..>22351429))
FT                   /locus_tag="mCG_144628"
FT                   /product="mCG144628"
FT                   /note="gene_id=mCG144628.0 transcript_id=mCT184052.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    22345512..22345531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22349362..22349381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(22349461..22349479,22350790..>22351109))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144628"
FT                   /product="mCG144628"
FT                   /note="gene_id=mCG144628.0 transcript_id=mCT184052.0
FT                   protein_id=mCP106162.0"
FT                   /protein_id="EDL12138.1"
FT                   /translation="CGAPSLDPNHLKCSFESNYREVSSNLEEKRSFHRFISSRVTDRCH
FT                   KVWLVAYRHDTTGTFEAGVDEKTADLSAVMTGLPNSVTRHLGVPPFTRLQLAVYQPLPS
FT                   LPLFLHGG"
FT   assembly_gap    22402923..22402942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <22415505..22440293
FT                   /locus_tag="mCG_22364"
FT                   /note="gene_id=mCG22364.2"
FT   mRNA            join(<22415505..22415699,22416612..22416677,
FT                   22439536..22439642,22440047..22440293)
FT                   /locus_tag="mCG_22364"
FT                   /product="mCG22364"
FT                   /note="gene_id=mCG22364.2 transcript_id=mCT21801.2 created
FT                   on 10-SEP-2002"
FT   CDS             join(<22416634..22416677,22439536..22439642,
FT                   22440047..22440150)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22364"
FT                   /product="mCG22364"
FT                   /note="gene_id=mCG22364.2 transcript_id=mCT21801.2
FT                   protein_id=mCP19256.2"
FT                   /protein_id="EDL12135.1"
FT                   /translation="RSPAACQTPAVKQPGCLKFQMQDRRHADRIMGVNYDYLACCALHA
FT                   DKHRKGSPFFWVITMPGRGSQGSVSELPDWGPCSKQEWS"
FT   assembly_gap    22422105..22422225
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    22425693..22425892
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    22428416..22428435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22467695..22469795
FT                   /estimated_length=2101
FT                   /gap_type="unknown"
FT   gene            complement(22471444..>22474360)
FT                   /locus_tag="mCG_22370"
FT                   /note="gene_id=mCG22370.2"
FT   mRNA            complement(join(22471444..22472252,22473360..>22474360))
FT                   /locus_tag="mCG_22370"
FT                   /product="mCG22370"
FT                   /note="gene_id=mCG22370.2 transcript_id=mCT21984.2 created
FT                   on 11-SEP-2002"
FT   assembly_gap    22472715..22472734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(22474003..>22474359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22370"
FT                   /product="mCG22370"
FT                   /note="gene_id=mCG22370.2 transcript_id=mCT21984.2
FT                   protein_id=mCP19262.0"
FT                   /protein_id="EDL12134.1"
FT                   /translation="ATRPGASYPFRLLPALQTQDRSLKSLCSRAGSLLPKMMNADMNAV
FT                   DAENQVELEEKTQLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSA
FT                   SSVFQTIDTKSKRR"
FT   assembly_gap    22481143..22481315
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    22489408..22490970
FT                   /estimated_length=1563
FT                   /gap_type="unknown"
FT   assembly_gap    22502369..22502414
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    22529675..22531744
FT                   /estimated_length=2070
FT                   /gap_type="unknown"
FT   assembly_gap    22541868..22541887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22560260..22562285)
FT                   /pseudo
FT                   /locus_tag="mCG_141728"
FT                   /note="gene_id=mCG141728.0"
FT   mRNA            complement(22560260..22562285)
FT                   /pseudo
FT                   /locus_tag="mCG_141728"
FT                   /note="gene_id=mCG141728.0 transcript_id=mCT176628.0
FT                   created on 04-DEC-2002"
FT   gene            complement(22564110..22838786)
FT                   /gene="Bank1"
FT                   /locus_tag="mCG_141092"
FT                   /note="gene_id=mCG141092.0"
FT   mRNA            complement(join(22564110..22564851,22565111..22565175,
FT                   22566455..22566507,22568101..22568130,22574818..22574881,
FT                   22577031..22577209,22593876..22593944,22604002..22604307,
FT                   22611001..22611309,22614495..22614573,22727298..22727494,
FT                   22748099..22748204,22756424..22756563,22761080..22761218,
FT                   22768313..22768464,22797109..22797507,22838663..22838786))
FT                   /gene="Bank1"
FT                   /locus_tag="mCG_141092"
FT                   /product="B-cell scaffold protein with ankyrin repeats 1"
FT                   /note="gene_id=mCG141092.0 transcript_id=mCT173065.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(22565116..22565175,22566455..22566507,
FT                   22568101..22568130,22574818..22574881,22577031..22577209,
FT                   22593876..22593944,22604002..22604307,22611001..22611309,
FT                   22614495..22614573,22727298..22727494,22748099..22748204,
FT                   22756424..22756563,22761080..22761218,22768313..22768464,
FT                   22797109..22797507,22838663..22838732))
FT                   /codon_start=1
FT                   /gene="Bank1"
FT                   /locus_tag="mCG_141092"
FT                   /product="B-cell scaffold protein with ankyrin repeats 1"
FT                   /note="gene_id=mCG141092.0 transcript_id=mCT173065.0
FT                   protein_id=mCP95984.0"
FT                   /protein_id="EDL12133.1"
FT                   /translation="MLPVASGTRGSTQDLFQVGLAPPGNAKDILLLYEEDAEEWALYLR
FT                   EIFMRVVEREAILLYPLHSFSSSHLEMLNLYAYKCKLLIISNSLLKDLTPKKCQFLEKI
FT                   LHSTGNVVTLLCGMESSDPFYQLLSIPRKRWEISTEQDPDGYISVIRQILDQGPEDYLE
FT                   VSIPTDSRAKYPEDTSGQKGTDVLASLRPSVPRVLVLPGEIPCEKPGEIFILLKDELIG
FT                   EILEVEFISTNKRLRARPARWNKSVWHMKAADFPAGSVTVNIHCDGIIKATTEIKYCSA
FT                   AKATESPFRVSDPGKSLCQKSIEELDNVLASIFKREIPYYEFKHLQAETYPQKERTHTT
FT                   ELPTLLHCAAKFGLKNLALHLLQCSGATRAARMKMTDGSDLLHIAERHGHEELKEVFED
FT                   FLSQNTGRNSKQENDYEEDVISFSTYSPSMPSPASLHELRKTHRRNTDRSEEPERSVEM
FT                   KEEEAGAEARRSLSEGERESSENQYDDLYVFIPGFDTEGNSEEPLPHCRPPLLPPRPGT
FT                   AASQLERPHFTSQGKVLEDQMERSQNWNDLNARPETREESSREEKKEEAQEEEEEEENP
FT                   YAFAETEDNEYDLILASKSVKKRTGNRSFIINRPPAPTPRPTHIPPKEETTPYIAQVFQ
FT                   QKAARRQSDGDKFYSLPKKPDKTRMEGPTFPSTRDYLTTGQEELILLQERVKNGKMSVD
FT                   EALEKFKHWQMGKSGLEMIQQEKLRQLRDNIIGKRPEDENAYDKLTIVHHPSGNTAHNE
FT                   NMLYNSPFNSKFPARIQVEKEFGFCCKKDH"
FT   assembly_gap    22613888..22614125
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    22623229..22624422
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    22629902..22629921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22631665..22631684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22632787..22632806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22653195..22657328
FT                   /estimated_length=4134
FT                   /gap_type="unknown"
FT   assembly_gap    22658864..22659211
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    22660252..22660271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22664029..22664048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22666934..22666953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22670114..22670133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22672490..22672509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22716972..22716991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22725968..22726105
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    22779761..22780533
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    22799439..22799494
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            22844292..22845787
FT                   /pseudo
FT                   /locus_tag="mCG_60292"
FT                   /note="gene_id=mCG60292.2"
FT   mRNA            22844292..22845787
FT                   /pseudo
FT                   /locus_tag="mCG_60292"
FT                   /note="gene_id=mCG60292.2 transcript_id=mCT60475.2 created
FT                   on 10-SEP-2002"
FT   assembly_gap    22904755..22907759
FT                   /estimated_length=3005
FT                   /gap_type="unknown"
FT   assembly_gap    22921608..22921771
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            complement(22945382..22959162)
FT                   /locus_tag="mCG_147426"
FT                   /note="gene_id=mCG147426.0"
FT   mRNA            complement(join(22945382..22945664,22947730..22947787,
FT                   22953773..22953906,22958267..22958377,22958771..22959162))
FT                   /locus_tag="mCG_147426"
FT                   /product="mCG147426"
FT                   /note="gene_id=mCG147426.0 transcript_id=mCT187689.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22945410..22945601)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147426"
FT                   /product="mCG147426"
FT                   /note="gene_id=mCG147426.0 transcript_id=mCT187689.0
FT                   protein_id=mCP109650.0"
FT                   /protein_id="EDL12132.1"
FT                   /translation="MIYSNSRRTSTEQISVRDLLASNSDTRRTSVPGSLCRDVITPVVV
FT                   TPESNVIQVVFLPKSMYY"
FT   assembly_gap    22954446..22955341
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    22958458..22958704
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    22979417..22979436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22982364..22982481
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    22990354..22990652
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    22992364..22992383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22993773..22993792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23022545..23022564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23024451..23024920
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    23026405..23026424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23031426..23031545
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    23065183..23070211
FT                   /estimated_length=5029
FT                   /gap_type="unknown"
FT   assembly_gap    23071914..23071933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23073260..23073279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23076658..23076677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23080585..23081220
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    23088600..23088619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23104557..23104916
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    23124949..23125392
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    23133080..23133099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23141382..23141401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23156329..23156348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23164324..23164470
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    23177146..23177471
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   gene            23177517..23446340
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /note="gene_id=mCG16625.2"
FT   mRNA            join(23177517..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384441,23385871..23386016,
FT                   23389605..23389744,23395990..23396067,23398477..23398571,
FT                   23411140..23411265,23413336..23413410,23430422..23430506,
FT                   23437130..23437227,23440621..23440650,23443641..23446340)
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, transcript variant mCT19203"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT19203.2 created
FT                   on 10-SEP-2002"
FT   mRNA            join(23177517..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384441,23385871..23386016,
FT                   23389605..23389744,23395990..23396067,23398477..23398571,
FT                   23411140..23411265,23413336..23413410,23430422..23430506,
FT                   23437130..23437227,23443641..23446340)
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, transcript variant mCT173050"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173050.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(23177517..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384387,23437190..23437227,
FT                   23443641..23446340)
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, transcript variant mCT173049"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173049.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(23177895..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384441,23385871..23386016,
FT                   23389605..23389744,23395990..23396067,23398477..23398571,
FT                   23411140..23411265,23413336..23413410,23430422..23430506,
FT                   23437130..23437227,23440621..23440650,23443641..23443837)
FT                   /codon_start=1
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, isoform CRA_b"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT19203.2
FT                   protein_id=mCP19191.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RRX2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:107164"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRX2"
FT                   /protein_id="EDL12129.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAI
FT                   KGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNS
FT                   SNIQ"
FT   CDS             join(23177895..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384441,23385871..23386016,
FT                   23389605..23389744,23395990..23396067,23398477..23398571,
FT                   23411140..23411265,23413336..23413410,23430422..23430506,
FT                   23437130..23437227,23443641..23443837)
FT                   /codon_start=1
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, isoform CRA_a"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173050.0
FT                   protein_id=mCP95970.0 isoform=CRA_a"
FT                   /protein_id="EDL12128.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKIT
FT                   SFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ"
FT   CDS             join(23177895..23177952,23304610..23304810,
FT                   23376840..23376964,23384330..23384387,23437190..23437227,
FT                   23443641..23443700)
FT                   /codon_start=1
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, isoform CRA_c"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173049.0
FT                   protein_id=mCP95968.0 isoform=CRA_c"
FT                   /protein_id="EDL12130.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLPECSLAGNRLCKAPSK
FT                   DFHHNIRSLASRRPRA"
FT   assembly_gap    23178224..23178243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23179206..23179249
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   mRNA            join(23180534..23180763,23304610..23304810,
FT                   23376840..23376964,23384330..23384441,23385871..23386016,
FT                   23389605..23389744,23395990..23396067,23398477..23398571,
FT                   23411140..23411265,23413336..23413410,23430422..23430506,
FT                   23437130..23437227,23440621..23440650,23443641..23446340)
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, transcript variant mCT173051"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173051.0 created
FT                   on 10-SEP-2002"
FT   assembly_gap    23184489..23184537
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    23196906..23197189
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    23202631..23202823
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    23220878..23220956
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    23235252..23235271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23248920..23249176
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    23253140..23253189
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   CDS             join(23304702..23304810,23376840..23376964,
FT                   23384330..23384441,23385871..23386016,23389605..23389744,
FT                   23395990..23396067,23398477..23398571,23411140..23411265,
FT                   23413336..23413410,23430422..23430506,23437130..23437227,
FT                   23440621..23440650,23443641..23443837)
FT                   /codon_start=1
FT                   /gene="Ppp3ca"
FT                   /locus_tag="mCG_16625"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform, isoform CRA_d"
FT                   /note="gene_id=mCG16625.2 transcript_id=mCT173051.0
FT                   protein_id=mCP95969.0 isoform=CRA_d"
FT                   /protein_id="EDL12131.1"
FT                   /translation="MKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQF
FT                   FDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECR
FT                   HLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIR
FT                   KLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHN
FT                   NLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNI
FT                   RQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAA
FT                   ARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATV
FT                   EAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETN
FT                   GTDSNGSNSSNIQ"
FT   assembly_gap    23312280..23312299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23315280..23315299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23337626..23337645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23339946..23340165
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    23341983..23343388
FT                   /estimated_length=1406
FT                   /gap_type="unknown"
FT   assembly_gap    23392093..23392169
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    23399146..23399165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23424845..23424864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23427495..23427514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23454105..23454124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            23456036..23456410
FT                   /pseudo
FT                   /locus_tag="mCG_16623"
FT                   /note="gene_id=mCG16623.0"
FT   mRNA            23456036..23456410
FT                   /pseudo
FT                   /locus_tag="mCG_16623"
FT                   /note="gene_id=mCG16623.0 transcript_id=mCT19201.0 created
FT                   on 10-SEP-2002"
FT   gene            complement(23460244..>23462547)
FT                   /locus_tag="mCG_60293"
FT                   /note="gene_id=mCG60293.1"
FT   mRNA            complement(join(23460244..23460494,23462190..>23462547))
FT                   /locus_tag="mCG_60293"
FT                   /product="mCG60293"
FT                   /note="gene_id=mCG60293.1 transcript_id=mCT60476.1 created
FT                   on 10-JAN-2003"
FT   CDS             complement(23462272..>23462547)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60293"
FT                   /product="mCG60293"
FT                   /note="gene_id=mCG60293.1 transcript_id=mCT60476.1
FT                   protein_id=mCP39667.1"
FT                   /protein_id="EDL12127.1"
FT                   /translation="LRFQAPVSGKVARCSIPCRVFYWVSGASFTQPKQAVFHGPTAYHL
FT                   AGIKKGSSLLFRIKLIHLETLFFTVWLLKYATFTLSKICFEPVFEV"
FT   assembly_gap    23463618..23463637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23464884..23464903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23472354..23472373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23527044..23527063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23651194..23651725
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    23657736..23657755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23659928..23659947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23667154..23667173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23688722..23688741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23740277..23740296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23747136..23747658
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    23750761..23750780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23762702..23762868
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    23767412..23767519
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    23769334..23769353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23809051..23809070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23816626..23816645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23833843..23833903
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            23857416..23946467
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /note="gene_id=mCG4115.2"
FT   mRNA            join(23857416..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23919921..23919959,
FT                   23932114..23932203,23932439..23932492,23934389..23934484,
FT                   23937652..23937676,23938822..23938883,23942704..23942777,
FT                   23945995..23946467)
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, transcript variant mCT170979"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT170979.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(23857416..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23932114..23932203,
FT                   23932439..23932492,23934389..23934484,23937652..23937676,
FT                   23938822..23938883,23942704..23942777,23945995..23946467)
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, transcript variant mCT3229"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT3229.2 created on
FT                   03-JAN-2003"
FT   mRNA            join(23857416..23857626,23888669..23888791,
FT                   23895773..23895847,23919921..23919959,23932114..23932203,
FT                   23932439..23932492,23934389..23934484,23937652..23937676,
FT                   23938822..23938883,23942704..23942777,23945995..23946467)
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, transcript variant mCT178147"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT178147.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(23857416..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23919921..23919963,
FT                   23946205..23946447)
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, transcript variant mCT170980"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT170980.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(23857554..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23919921..23919963,
FT                   23946205..23946286)
FT                   /codon_start=1
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, isoform CRA_b"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT170980.0
FT                   protein_id=mCP93897.0 isoform=CRA_b"
FT                   /protein_id="EDL12124.1"
FT                   /translation="MRLLQATVLFFLLSNSLCHSEDGKDVQNDSIPTPAETSTTKASVT
FT                   IPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEVGTTTEGPLRNESS
FT                   TMKITVPNTPTSNANSTLPGSQNKTENQSSIRTTEISGKNCDPPSPGRWVPGKHAVVEF
FT                   RLSRFS"
FT   CDS             join(23857554..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23919921..23919959,
FT                   23932114..23932203,23932439..23932492,23934389..23934484,
FT                   23937652..23937676,23938822..23938883,23942704..23942738)
FT                   /codon_start=1
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, isoform CRA_a"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT170979.0
FT                   protein_id=mCP93898.0 isoform=CRA_a"
FT                   /protein_id="EDL12123.1"
FT                   /translation="MRLLQATVLFFLLSNSLCHSEDGKDVQNDSIPTPAETSTTKASVT
FT                   IPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEVGTTTEGPLRNESS
FT                   TMKITVPNTPTSNANSTLPGSQNKTENQSSIRTTEISVTTQLLDALPKITATSSASLTT
FT                   AHTMSLLQDTEDRKIATTPSTTPSYSSIILPVVIALVVITLLVFTLVGLYRICWKRDPG
FT                   TPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN"
FT   CDS             join(23857554..23857626,23888669..23888791,
FT                   23895773..23895847,23907527..23907640,23932114..23932203,
FT                   23932439..23932492,23934389..23934484,23937652..23937676,
FT                   23938822..23938883,23942704..23942738)
FT                   /codon_start=1
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, isoform CRA_d"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT3229.2
FT                   protein_id=mCP19286.2 isoform=CRA_d"
FT                   /protein_id="EDL12126.1"
FT                   /translation="MRLLQATVLFFLLSNSLCHSEDGKDVQNDSIPTPAETSTTKASVT
FT                   IPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEVGTTTEGPLRNESS
FT                   TMKITVPNTPTSNANSTLPGSQNKITTQLLDALPKITATSSASLTTAHTMSLLQDTEDR
FT                   KIATTPSTTPSYSSIILPVVIALVVITLLVFTLVGLYRICWKRDPGTPENGNDQPQSDK
FT                   ESVKLLTVKTISHESGEHSAQGKTKN"
FT   CDS             join(23857554..23857626,23888669..23888791,
FT                   23895773..23895847,23919921..23919959,23932114..23932203,
FT                   23932439..23932492,23934389..23934484,23937652..23937676,
FT                   23938822..23938883,23942704..23942738)
FT                   /codon_start=1
FT                   /gene="Emcn"
FT                   /locus_tag="mCG_4115"
FT                   /product="endomucin, isoform CRA_c"
FT                   /note="gene_id=mCG4115.2 transcript_id=mCT178147.0
FT                   protein_id=mCP101069.0 isoform=CRA_c"
FT                   /protein_id="EDL12125.1"
FT                   /translation="MRLLQATVLFFLLSNSLCHSEDGKDVQNDSIPTPAETSTTKASVT
FT                   IPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEAENQSSIRTTEISV
FT                   TTQLLDALPKITATSSASLTTAHTMSLLQDTEDRKIATTPSTTPSYSSIILPVVIALVV
FT                   ITLLVFTLVGLYRICWKRDPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTK
FT                   N"
FT   assembly_gap    23859652..23859671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23860690..23861708
FT                   /estimated_length=1019
FT                   /gap_type="unknown"
FT   assembly_gap    23874666..23876026
FT                   /estimated_length=1361
FT                   /gap_type="unknown"
FT   assembly_gap    23924711..23925090
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    23954213..23955140
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    23958773..23958991
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    23967847..23971064
FT                   /estimated_length=3218
FT                   /gap_type="unknown"
FT   assembly_gap    23997294..23997413
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    24034219..24034238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24049725..24049820
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            complement(24064987..>24067565)
FT                   /gene="9230109N16"
FT                   /locus_tag="mCG_145176"
FT                   /note="gene_id=mCG145176.0"
FT   mRNA            complement(join(24064987..24065675,24067055..24067227,
FT                   24067470..>24067565))
FT                   /gene="9230109N16"
FT                   /locus_tag="mCG_145176"
FT                   /product="hypothetical protein 9230109N16"
FT                   /note="gene_id=mCG145176.0 transcript_id=mCT184600.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(24065465..24065675,24067055..>24067218))
FT                   /codon_start=1
FT                   /gene="9230109N16"
FT                   /locus_tag="mCG_145176"
FT                   /product="hypothetical protein 9230109N16"
FT                   /note="gene_id=mCG145176.0 transcript_id=mCT184600.0
FT                   protein_id=mCP106172.0"
FT                   /protein_id="EDL12122.1"
FT                   /translation="LSTLSRVFLSQHLTSVQAMNTLCSIPVSLLTLVAGQNWIYHIRKK
FT                   RMSAAKVQNQNLSGMEWKASRRGKCWRTDTGLRKATLVFTLVILGTYVSDSLLLVLRLG
FT                   TGRACWSRTTEPPPSHRFCF"
FT   assembly_gap    24070828..24070847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24072364..24072383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24084386..24084481
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    24102458..24102931
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    24110480..24110731
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   gene            24129088..24134391
FT                   /gene="Ddit4l"
FT                   /locus_tag="mCG_4113"
FT                   /note="gene_id=mCG4113.3"
FT   mRNA            join(24129088..24129199,24131693..24131834,
FT                   24132875..24132955)
FT                   /gene="Ddit4l"
FT                   /locus_tag="mCG_4113"
FT                   /product="DNA-damage-inducible transcript 4-like,
FT                   transcript variant mCT173063"
FT                   /note="gene_id=mCG4113.3 transcript_id=mCT173063.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(24131230..24131444,24131693..24131834,
FT                   24133522..24134391)
FT                   /gene="Ddit4l"
FT                   /locus_tag="mCG_4113"
FT                   /product="DNA-damage-inducible transcript 4-like,
FT                   transcript variant mCT3239"
FT                   /note="gene_id=mCG4113.3 transcript_id=mCT3239.3 created on
FT                   12-JUN-2003"
FT   CDS             join(24131744..24131834,24133522..24134012)
FT                   /codon_start=1
FT                   /gene="Ddit4l"
FT                   /locus_tag="mCG_4113"
FT                   /product="DNA-damage-inducible transcript 4-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4113.3 transcript_id=mCT3239.3
FT                   protein_id=mCP19211.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RVG4"
FT                   /db_xref="InterPro:IPR012918"
FT                   /db_xref="MGI:MGI:1920534"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVG4"
FT                   /protein_id="EDL12121.1"
FT                   /translation="MVATGSLSSKNPASISELLDGGYHPGSLLSDFDYWDYVVPEPNLN
FT                   EVVFEETTCQNLVKMLENCLSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLR
FT                   GCVMHVNLEIENVCKKLDRIVCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSG
FT                   LKRTLILSSGFRLVKKKLYSLIGTTVIEEC"
FT   CDS             join(24131744..24131834,24132875..24132888)
FT                   /codon_start=1
FT                   /gene="Ddit4l"
FT                   /locus_tag="mCG_4113"
FT                   /product="DNA-damage-inducible transcript 4-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4113.3 transcript_id=mCT173063.1
FT                   protein_id=mCP95982.1 isoform=CRA_a"
FT                   /protein_id="EDL12120.1"
FT                   /translation="MVATGSLSSKNPASISELLDGGYHPGSLLSAKKN"
FT   assembly_gap    24137124..24137682
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   gene            complement(24151925..24152694)
FT                   /pseudo
FT                   /locus_tag="mCG_4111"
FT                   /note="gene_id=mCG4111.1"
FT   mRNA            complement(24151925..24152694)
FT                   /pseudo
FT                   /locus_tag="mCG_4111"
FT                   /note="gene_id=mCG4111.1 transcript_id=mCT3238.1 created on
FT                   10-SEP-2002"
FT   assembly_gap    24166174..24166224
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    24167285..24168573
FT                   /estimated_length=1289
FT                   /gap_type="unknown"
FT   assembly_gap    24181304..24181348
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    24203052..24203767
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    24208188..24209849
FT                   /estimated_length=1662
FT                   /gap_type="unknown"
FT   assembly_gap    24211916..24211935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24213041..24213060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24220971..24221748
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    24246977..24246996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24252259..24252296
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    24297883..24297936
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    24309068..24309087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24326822..24327103
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    24334390..24334546
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    24335905..24335924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24362732..24363379
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   gene            <24363701..24365429
FT                   /locus_tag="mCG_4120"
FT                   /note="gene_id=mCG4120.3"
FT   mRNA            join(<24363701..24363778,24364088..24364201,
FT                   24364893..24365429)
FT                   /locus_tag="mCG_4120"
FT                   /product="mCG4120"
FT                   /note="gene_id=mCG4120.3 transcript_id=mCT3224.3 created on
FT                   01-JUL-2003"
FT   CDS             join(<24363701..24363778,24364088..24364201,
FT                   24364893..24364922)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4120"
FT                   /product="mCG4120"
FT                   /note="gene_id=mCG4120.3 transcript_id=mCT3224.3
FT                   protein_id=mCP19268.3"
FT                   /protein_id="EDL12119.1"
FT                   /translation="AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGR
FT                   VGATAAVYSAAILEYLTAEVSSHTSTNR"
FT   assembly_gap    24364483..24364620
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    24366218..24366391
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            <24366392..24406987
FT                   /locus_tag="mCG_4118"
FT                   /note="gene_id=mCG4118.2"
FT   mRNA            join(<24366392..24366409,24383406..24383577,
FT                   24391023..24391168,24400245..24400430,24401941..24402035,
FT                   24402803..24402912,24403943..24404115,24406403..24406987)
FT                   /locus_tag="mCG_4118"
FT                   /product="mCG4118, transcript variant mCT3223"
FT                   /note="gene_id=mCG4118.2 transcript_id=mCT3223.2 created on
FT                   09-SEP-2002"
FT   CDS             join(<24366394..24366409,24383406..24383577,
FT                   24391023..24391168,24400245..24400430,24401941..24402035,
FT                   24402803..24402912,24403943..24404115,24406403..24406527)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4118"
FT                   /product="mCG4118, isoform CRA_b"
FT                   /note="gene_id=mCG4118.2 transcript_id=mCT3223.2
FT                   protein_id=mCP19248.1 isoform=CRA_b"
FT                   /protein_id="EDL12118.1"
FT                   /translation="LPAARALLEIIMKNGSTAGSSTHCRKPPGSSDQSKPSCGKDGTSG
FT                   AGEGGKVYTKDQVEGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAP
FT                   GATDAFKKIGNAYAVLSNPEKRKQYDLTGSEEQACNHQNNGRFNFHRGCEADITPEDLF
FT                   NIFFGGGFPSGSVHSFSNGRAAYSHQHQHRHSGHEREEERADGGFSVFIQLMPIIVLIL
FT                   VSLLSQLMVSNPPYSLYPRSGSGQTIKMQTENLGVVYYVSKDFKSEYKGTLLQKVEKSV
FT                   EEDYVTNIRNNCWKERQQKTDMQYAAKVYRDEQLRRKADALSMENCKELERLTSLYKGG
FT                   "
FT   mRNA            join(<24366534..24366779,24383406..24383577,
FT                   24391023..24391168,24400245..24400430,24401941..24402035,
FT                   24402803..24402912,24403943..24404115,24406403..24406987)
FT                   /locus_tag="mCG_4118"
FT                   /product="mCG4118, transcript variant mCT173064"
FT                   /note="gene_id=mCG4118.2 transcript_id=mCT173064.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(<24366755..24366779,24383406..24383577,
FT                   24391023..24391168,24400245..24400430,24401941..24402035,
FT                   24402803..24402912,24403943..24404115,24406403..24406527)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4118"
FT                   /product="mCG4118, isoform CRA_a"
FT                   /note="gene_id=mCG4118.2 transcript_id=mCT173064.0
FT                   protein_id=mCP95983.0 isoform=CRA_a"
FT                   /protein_id="EDL12117.1"
FT                   /translation="IVSGLIWHPLLEIIMKNGSTAGSSTHCRKPPGSSDQSKPSCGKDG
FT                   TSGAGEGGKVYTKDQVEGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKN
FT                   HAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGSEEQACNHQNNGRFNFHRGCEADITPE
FT                   DLFNIFFGGGFPSGSVHSFSNGRAAYSHQHQHRHSGHEREEERADGGFSVFIQLMPIIV
FT                   LILVSLLSQLMVSNPPYSLYPRSGSGQTIKMQTENLGVVYYVSKDFKSEYKGTLLQKVE
FT                   KSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYRDEQLRRKADALSMENCKELERLTSLY
FT                   KGG"
FT   assembly_gap    24389724..24389877
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    24397905..24397924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24416102..24426516
FT                   /locus_tag="mCG_4114"
FT                   /note="gene_id=mCG4114.3"
FT   mRNA            join(24416102..24416224,24416470..24416515,
FT                   24417519..24417553,24422735..24422793,24424431..24424564,
FT                   24424969..24425032,24425567..24426516)
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, transcript variant mCT180904"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180904.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(24416117..24416246,24416470..24416515,
FT                   24417519..24417553,24422735..24422793,24424431..24424564,
FT                   24424969..24425032,24425567..24426516)
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, transcript variant mCT180903"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180903.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(24416121..24416260,24416470..24416515,
FT                   24417519..24417553,24422735..24422793,24424431..24424564,
FT                   24424969..24425032,24425567..24426516)
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, transcript variant mCT3228"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT3228.2 created on
FT                   05-MAR-2003"
FT   mRNA            join(24416179..24416515,24417519..24417553,
FT                   24422735..24422793,24424431..24424564,24424969..24425032,
FT                   24425567..24426516)
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, transcript variant mCT180905"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180905.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(24416507..24416515,24417519..24417553,
FT                   24422735..24422793,24424431..24424564,24424969..24425032,
FT                   24425567..24425640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, isoform CRA_a"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180903.0
FT                   protein_id=mCP103827.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542I7"
FT                   /db_xref="InterPro:IPR015019"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I7"
FT                   /protein_id="EDL12113.1"
FT                   /translation="MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHAL
FT                   RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIV
FT                   SLEKELAPLFEELIKVVEVS"
FT   CDS             join(24416507..24416515,24417519..24417553,
FT                   24422735..24422793,24424431..24424564,24424969..24425032,
FT                   24425567..24425640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, isoform CRA_a"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180904.0
FT                   protein_id=mCP103825.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542I7"
FT                   /db_xref="InterPro:IPR015019"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I7"
FT                   /protein_id="EDL12114.1"
FT                   /translation="MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHAL
FT                   RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIV
FT                   SLEKELAPLFEELIKVVEVS"
FT   CDS             join(24416507..24416515,24417519..24417553,
FT                   24422735..24422793,24424431..24424564,24424969..24425032,
FT                   24425567..24425640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, isoform CRA_a"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT180905.0
FT                   protein_id=mCP103826.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542I7"
FT                   /db_xref="InterPro:IPR015019"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I7"
FT                   /protein_id="EDL12115.1"
FT                   /translation="MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHAL
FT                   RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIV
FT                   SLEKELAPLFEELIKVVEVS"
FT   CDS             join(24416507..24416515,24417519..24417553,
FT                   24422735..24422793,24424431..24424564,24424969..24425032,
FT                   24425567..24425640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4114"
FT                   /product="mCG4114, isoform CRA_a"
FT                   /note="gene_id=mCG4114.3 transcript_id=mCT3228.2
FT                   protein_id=mCP19271.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542I7"
FT                   /db_xref="InterPro:IPR015019"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I7"
FT                   /protein_id="EDL12116.1"
FT                   /translation="MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHAL
FT                   RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIV
FT                   SLEKELAPLFEELIKVVEVS"
FT   gene            complement(24428615..24479440)
FT                   /gene="Dapp1"
FT                   /locus_tag="mCG_123437"
FT                   /note="gene_id=mCG123437.1"
FT   mRNA            complement(join(24428615..24430809,24433228..24433315,
FT                   24435380..24435465,24436784..24436846,24438475..24438522,
FT                   24447272..24447402,24459144..24459277,24463591..24463713,
FT                   24479235..24479440))
FT                   /gene="Dapp1"
FT                   /locus_tag="mCG_123437"
FT                   /product="dual adaptor for phosphotyrosine and
FT                   3-phosphoinositides 1"
FT                   /note="gene_id=mCG123437.1 transcript_id=mCT124669.1
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(24430741..24430809,24433228..24433315,
FT                   24435380..24435465,24436784..24436846,24438475..24438522,
FT                   24447272..24447402,24459144..24459277,24463591..24463713,
FT                   24479235..24479335))
FT                   /codon_start=1
FT                   /gene="Dapp1"
FT                   /locus_tag="mCG_123437"
FT                   /product="dual adaptor for phosphotyrosine and
FT                   3-phosphoinositides 1"
FT                   /note="gene_id=mCG123437.1 transcript_id=mCT124669.1
FT                   protein_id=mCP89548.1"
FT                   /db_xref="GOA:Q3UK44"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001720"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1347063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UK44"
FT                   /protein_id="EDL12112.1"
FT                   /translation="MGRAELLGGNMSTQDPSELWGRADGGTDLLQDLGWYHGNLTRHAA
FT                   EALLLSNGRDGSYLLRDSNEQTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEYSSLKD
FT                   FVKHFANQPLIGSETGTLMVLKHPYPREVEEPCIYESVRVHTAMQTGRTENDLVPTAPS
FT                   LGTKEGYLTKQGGLVKTWKTRWFTLQRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQ
FT                   ERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSKIRKQLDQGEDTVRSRSFIFK"
FT   assembly_gap    24451077..24451096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24462058..24462077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24468880..24469013
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    24476861..24477136
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    24493276..24493431
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    24513530..24513549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24519325..24519344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24533429..24533462
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(24547008..>24565646)
FT                   /gene="D830013H12"
FT                   /locus_tag="mCG_145181"
FT                   /note="gene_id=mCG145181.0"
FT   mRNA            complement(join(24547008..24547945,24550694..24550824,
FT                   24552544..24552676,24565181..>24565646))
FT                   /gene="D830013H12"
FT                   /locus_tag="mCG_145181"
FT                   /product="hypothetical protein D830013H12"
FT                   /note="gene_id=mCG145181.0 transcript_id=mCT184605.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(24547734..24547945,24550694..24550824,
FT                   24552544..>24552611))
FT                   /codon_start=1
FT                   /gene="D830013H12"
FT                   /locus_tag="mCG_145181"
FT                   /product="hypothetical protein D830013H12"
FT                   /note="gene_id=mCG145181.0 transcript_id=mCT184605.0
FT                   protein_id=mCP106175.0"
FT                   /protein_id="EDL12111.1"
FT                   /translation="SPGKLARTAQECPPLSLPAWICGKMDVFGADAAIHRAHVLSISAF
FT                   SRDFYLPFVKMLRNAGCCRTCAETAVWSWKKVGGDEGRWGCGVSGVPWASPAGPCAFCA
FT                   RELCSARPTGQRWTDSAFNCHRSPNDLSCFPG"
FT   assembly_gap    24560739..24560798
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    24572524..24572543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24579766..24579907
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    24583859..24584460
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    24586084..24586103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24589796..24629147)
FT                   /gene="Mttp"
FT                   /locus_tag="mCG_4110"
FT                   /note="gene_id=mCG4110.2"
FT   mRNA            complement(join(24589796..24591166,24592515..24592685,
FT                   24594887..24595011,24600648..24600875,24602249..24602370,
FT                   24602526..24602623,24604718..24604926,24606569..24606781,
FT                   24609255..24609362,24610073..24610241,24611677..24611834,
FT                   24612875..24613025,24613711..24613850,24614137..24614253,
FT                   24616052..24616159,24621480..24621623,24622805..24622992,
FT                   24629013..24629147))
FT                   /gene="Mttp"
FT                   /locus_tag="mCG_4110"
FT                   /product="microsomal triglyceride transfer protein"
FT                   /note="gene_id=mCG4110.2 transcript_id=mCT3237.2 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(24590992..24591166,24592515..24592685,
FT                   24594887..24595011,24600648..24600875,24602249..24602370,
FT                   24602526..24602623,24604718..24604926,24606569..24606781,
FT                   24609255..24609362,24610073..24610241,24611677..24611834,
FT                   24612875..24613025,24613711..24613850,24614137..24614253,
FT                   24616052..24616159,24621480..24621623,24622805..24622992,
FT                   24629013..24629073))
FT                   /codon_start=1
FT                   /gene="Mttp"
FT                   /locus_tag="mCG_4110"
FT                   /product="microsomal triglyceride transfer protein"
FT                   /note="gene_id=mCG4110.2 transcript_id=mCT3237.2
FT                   protein_id=mCP19234.2"
FT                   /db_xref="GOA:O08601"
FT                   /db_xref="InterPro:IPR001747"
FT                   /db_xref="InterPro:IPR011030"
FT                   /db_xref="InterPro:IPR015816"
FT                   /db_xref="InterPro:IPR015819"
FT                   /db_xref="MGI:MGI:106926"
FT                   /protein_id="EDL12110.1"
FT                   /translation="MILLAVLFLCFFSSYSASVKGHTTGLSLNNERLYKLTYSTEVFLD
FT                   GGKGKPQDSVGYKISSDVDVVLLWRNPDGDDDQVIQVTITAVNVENAGQQRGEKSIFQG
FT                   KSTPKIIGKDNLEALQRPMLLHLVRGKVKEFYSYENEPVGIENLKRGLASLFQMQLSSG
FT                   TTNEVDISGDCKVTYQAQQDKVVKIKALDTCKIERSGFTTANQVLGVSSKATSVTTYKI
FT                   EDSFVTAVLAEETRAFALNFQQTIAGKIVSKQKLELKTTEAGPRMIPGKQVAGVIKAVD
FT                   SKYKAIPIVGQVLERVCKGCPSLAEHWKSIRKNLEPENLSKAEAVQSFLAFIQHLRTSR
FT                   REEILQILKAEKKEVLPQLVDAVTSAQTPDSLEAILDFLDFKSDSSIILQERFLYACGF
FT                   ATHPDEELLRALLSKFKGSFASNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLIL
FT                   GGLEKPEKKEDTTMYLLALKNALLPEGIPLLLKYAEAGEGPVSHLATTVLQRYDVSFIT
FT                   DEVKKTLNRIYHQNRKVHEKTVRTTAAAVILKNPSYMDVKNILLSIGELPKEMNKYMLT
FT                   VVQDILHFEMPASKMIRRVLKEMAVHNYDRFSKSGSSSAYTGYVERSPRAASTYSLDIL
FT                   YSGSGILRRSNLNIFQYIGKAELHGSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAI
FT                   LFDVQLRPVTFFNGYSDLMSKMLSASGDPVSVVKGLILLIDHSQDIQLQSGLKANMEIQ
FT                   GGLAIDISGSMEFSLWYRESKTRVKNRVAVVITSDVTVDASFVKAGLESRAETEAGLEF
FT                   ISTVQFSQYPFLVCMQMDKAEAPLRQFETKYERLSTGRGYVSRRRKESLVAGCELPLHQ
FT                   ENSEMCNVVFPPQPESDNSGGWF"
FT   assembly_gap    24612758..24612777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24632360..24632438
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    24638482..24638501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24641324..24656095
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /note="gene_id=mCG4109.2"
FT   mRNA            join(24641324..24641434,24645228..24645423,
FT                   24646207..24646366,24647312..24647383,24648261..24648335,
FT                   24650050..24650199,24652551..24652656,24654563..24656095)
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, transcript variant mCT3236"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT3236.2 created on
FT                   04-SEP-2002"
FT   mRNA            join(24641746..24641833,24643604..24643778,
FT                   24645228..24645423,24646207..24646366,24647312..24647383,
FT                   24648261..24648335,24650050..24650199,24652551..24652656,
FT                   24654563..24656095)
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, transcript variant mCT173060"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173060.0 created
FT                   on 04-SEP-2002"
FT   mRNA            join(24641746..24641833,24644140..24644246,
FT                   24645228..24645423,24646207..24646366,24647312..24647383,
FT                   24648261..24648335,24650050..24650199,24652551..24652656,
FT                   24654563..24656095)
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, transcript variant mCT173061"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173061.0 created
FT                   on 04-SEP-2002"
FT   mRNA            join(24641746..24641833,24645228..24645423,
FT                   24646207..24646366,24647312..24647383,24648261..24648335,
FT                   24650050..24650199,24652551..24652656,24654563..24656095)
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, transcript variant mCT173062"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173062.0 created
FT                   on 04-SEP-2002"
FT   CDS             join(24645233..24645423,24646207..24646366,
FT                   24647312..24647383,24648261..24648335,24650050..24650199,
FT                   24652551..24652656,24654563..24654801)
FT                   /codon_start=1
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173060.0
FT                   protein_id=mCP95979.0 isoform=CRA_a"
FT                   /protein_id="EDL12106.1"
FT                   /translation="MNMSSEMLPASIESPNVEEKLGTSDGEEERQEPRVDAGAEPISKR
FT                   QLKKLMKQKQWEEQREQRKEKRKEKRKRKKLERRQLESNSDGNDRKRVRRDVARSSLRL
FT                   VIDCSFDDLMVLKDIKKLHKQIQRCYAENRRASHPVQFYLTSHGGQLKKNMDENDQGWV
FT                   NWKDIHIKSEHYSELIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQ
FT                   ATSYGIEHAQLPLADFVKMNSRKVLAVNHVFEIILEFLETRDWQEAFFTILPQRKGAVP
FT                   AHKACESSPQDHQSLPEGWDSASEGESCRDNPDSPQKDEQGQQSSPVLQ"
FT   CDS             join(24645233..24645423,24646207..24646366,
FT                   24647312..24647383,24648261..24648335,24650050..24650199,
FT                   24652551..24652656,24654563..24654801)
FT                   /codon_start=1
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173061.0
FT                   protein_id=mCP95981.0 isoform=CRA_a"
FT                   /protein_id="EDL12107.1"
FT                   /translation="MNMSSEMLPASIESPNVEEKLGTSDGEEERQEPRVDAGAEPISKR
FT                   QLKKLMKQKQWEEQREQRKEKRKEKRKRKKLERRQLESNSDGNDRKRVRRDVARSSLRL
FT                   VIDCSFDDLMVLKDIKKLHKQIQRCYAENRRASHPVQFYLTSHGGQLKKNMDENDQGWV
FT                   NWKDIHIKSEHYSELIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQ
FT                   ATSYGIEHAQLPLADFVKMNSRKVLAVNHVFEIILEFLETRDWQEAFFTILPQRKGAVP
FT                   AHKACESSPQDHQSLPEGWDSASEGESCRDNPDSPQKDEQGQQSSPVLQ"
FT   CDS             join(24645233..24645423,24646207..24646366,
FT                   24647312..24647383,24648261..24648335,24650050..24650199,
FT                   24652551..24652656,24654563..24654801)
FT                   /codon_start=1
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT173062.0
FT                   protein_id=mCP95980.0 isoform=CRA_a"
FT                   /protein_id="EDL12108.1"
FT                   /translation="MNMSSEMLPASIESPNVEEKLGTSDGEEERQEPRVDAGAEPISKR
FT                   QLKKLMKQKQWEEQREQRKEKRKEKRKRKKLERRQLESNSDGNDRKRVRRDVARSSLRL
FT                   VIDCSFDDLMVLKDIKKLHKQIQRCYAENRRASHPVQFYLTSHGGQLKKNMDENDQGWV
FT                   NWKDIHIKSEHYSELIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQ
FT                   ATSYGIEHAQLPLADFVKMNSRKVLAVNHVFEIILEFLETRDWQEAFFTILPQRKGAVP
FT                   AHKACESSPQDHQSLPEGWDSASEGESCRDNPDSPQKDEQGQQSSPVLQ"
FT   CDS             join(24645233..24645423,24646207..24646366,
FT                   24647312..24647383,24648261..24648335,24650050..24650199,
FT                   24652551..24652656,24654563..24654801)
FT                   /codon_start=1
FT                   /gene="Rg9mtd2"
FT                   /locus_tag="mCG_4109"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG4109.2 transcript_id=mCT3236.2
FT                   protein_id=mCP19277.2 isoform=CRA_a"
FT                   /protein_id="EDL12109.1"
FT                   /translation="MNMSSEMLPASIESPNVEEKLGTSDGEEERQEPRVDAGAEPISKR
FT                   QLKKLMKQKQWEEQREQRKEKRKEKRKRKKLERRQLESNSDGNDRKRVRRDVARSSLRL
FT                   VIDCSFDDLMVLKDIKKLHKQIQRCYAENRRASHPVQFYLTSHGGQLKKNMDENDQGWV
FT                   NWKDIHIKSEHYSELIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQ
FT                   ATSYGIEHAQLPLADFVKMNSRKVLAVNHVFEIILEFLETRDWQEAFFTILPQRKGAVP
FT                   AHKACESSPQDHQSLPEGWDSASEGESCRDNPDSPQKDEQGQQSSPVLQ"
FT   assembly_gap    24660770..24660789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24663000..24663019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24663073..>24679726)
FT                   /locus_tag="mCG_4116"
FT                   /note="gene_id=mCG4116.2"
FT   mRNA            complement(join(24663073..24663529,24664822..24664865,
FT                   24666544..24666745,24667734..24667815,24669480..24669623,
FT                   24672518..24672582,24676601..24676807,24679274..>24679726))
FT                   /locus_tag="mCG_4116"
FT                   /product="mCG4116"
FT                   /note="gene_id=mCG4116.2 transcript_id=mCT3230.2 created on
FT                   04-SEP-2002"
FT   CDS             complement(join(24663360..24663529,24664822..24664865,
FT                   24666544..24666745,24667734..24667815,24669480..24669623,
FT                   24672518..24672582,24676601..24676807,24679274..>24679346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4116"
FT                   /product="mCG4116"
FT                   /note="gene_id=mCG4116.2 transcript_id=mCT3230.2
FT                   protein_id=mCP19200.2"
FT                   /protein_id="EDL12105.1"
FT                   /translation="SQTPIIELITQSYSHLFILSTKTWRLNNIPICTVNDDDTCPRSLY
FT                   ISDQFSPSERNETSVAKFTNPPSTASPESLRVGGLSPAPAKLPARPQSEPCRKSSQCFK
FT                   TSKDNPLVKNKVEHKAKRPLPSARMCSAAAFQSSDAMSNRMDGNENTVHIPNYLDQEIK
FT                   ILAKLSEILHTDSLAEVLNWLLQASNKEKEWVSALVHSELAEINLLTRHRANTPTEPAA
FT                   EPRKPYTSGTPTTKLLQNSRAKLKALTGSRERQLHRTSSQGSKGNKPVSHGAETPLFIR
FT                   RNKKQTPVTEYLNPESPLGSNSVASRSPNPGSARSAQGYSPQRVFYP"
FT   assembly_gap    24687991..24688010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24694247..24694266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24695797..24695816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24696367..24696386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24709685..24723951
FT                   /gene="Adh7"
FT                   /locus_tag="mCG_4121"
FT                   /note="gene_id=mCG4121.2"
FT   mRNA            join(24709685..24709833,24713633..24713734,
FT                   24714882..24715020,24715651..24715738,24715832..24716048,
FT                   24718108..24718368,24719825..24719960,24720695..24720833,
FT                   24723108..24723951)
FT                   /gene="Adh7"
FT                   /locus_tag="mCG_4121"
FT                   /product="alcohol dehydrogenase 7 (class IV), mu or sigma
FT                   polypeptide"
FT                   /note="gene_id=mCG4121.2 transcript_id=mCT3225.2 created on
FT                   12-APR-2002"
FT   CDS             join(24709816..24709833,24713633..24713734,
FT                   24714882..24715020,24715651..24715738,24715832..24716048,
FT                   24718108..24718368,24719825..24719960,24720695..24720833,
FT                   24723108..24723132)
FT                   /codon_start=1
FT                   /gene="Adh7"
FT                   /locus_tag="mCG_4121"
FT                   /product="alcohol dehydrogenase 7 (class IV), mu or sigma
FT                   polypeptide"
FT                   /note="gene_id=mCG4121.2 transcript_id=mCT3225.2
FT                   protein_id=mCP19216.2"
FT                   /db_xref="GOA:Q9D748"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028635"
FT                   /db_xref="MGI:MGI:87926"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D748"
FT                   /protein_id="EDL12104.1"
FT                   /translation="MGTAGKVIKCKAAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATG
FT                   ICRTDDHIIKGSMVSKFPVIVGHEAVGVVESVGEGVTTVRPGDKVIPLFLPQCRECNAC
FT                   LNPEGNLCIRSDLTGRGVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKVDGA
FT                   APPEKACLIGCGFSTGYGAAVKTAKVTPGSTCVVFGLGGVGLSVIMGCKAAGASRIIGI
FT                   DINKDKFQKALAVGATECISPKDSTKPISEVLSDMTGNTIQYTFEVIGRLETMVDALSS
FT                   CHMNYGTSVVVGAPPSAKMLTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKF
FT                   DLDQLITHTLPFNNINEGFELLYSGKSIRTVLTF"
FT   gene            complement(24720989..>24732371)
FT                   /locus_tag="mCG_145177"
FT                   /note="gene_id=mCG145177.0"
FT   mRNA            complement(join(24720989..24721866,24729567..24729679,
FT                   24731188..24731370,24731455..24731630,24732298..>24732371))
FT                   /locus_tag="mCG_145177"
FT                   /product="mCG145177"
FT                   /note="gene_id=mCG145177.0 transcript_id=mCT184601.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(24721846..24721866,24729567..24729679,
FT                   24731188..>24731269))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145177"
FT                   /product="mCG145177"
FT                   /note="gene_id=mCG145177.0 transcript_id=mCT184601.0
FT                   protein_id=mCP106174.0"
FT                   /protein_id="EDL12103.1"
FT                   /translation="TQTDSLEEKCILLIVEPSLQPPPTTTTGTTKRGGSACKHGDWSLK
FT                   TSRIHLNLSVVVHGSNPCLQACPRHP"
FT   assembly_gap    24732615..24732868
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   gene            24753129..24784655
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /note="gene_id=mCG4119.2"
FT   mRNA            join(24753129..24753336,24764031..24764123,
FT                   24773688..24773789,24774331..24774469,24776399..24776486,
FT                   24776578..24776797,24780655..24780915,24782712..24782847,
FT                   24783765..24783903,24784498..24784655)
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), transcript
FT                   variant mCT170982"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT170982.0 created
FT                   on 23-JUL-2002"
FT   assembly_gap    24759570..24759683
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   mRNA            join(24771581..24771672,24773688..24773789,
FT                   24774331..24774469,24776399..24776486,24776578..24776797,
FT                   24780655..24780915,24782712..24782847,24783765..24783903,
FT                   24784498..24784655)
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), transcript
FT                   variant mCT3231"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT3231.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(24771581..24771672,24773688..24773719,
FT                   24776408..24776486,24776578..24776797,24780655..24780915,
FT                   24782712..24782847,24783765..24783903,24784498..24784655)
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), transcript
FT                   variant mCT170981"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT170981.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(24771655..24771672,24773688..24773789,
FT                   24774331..24774469,24776399..24776486,24776578..24776797,
FT                   24780655..24780915,24782712..24782847,24783765..24783903,
FT                   24784498..24784522)
FT                   /codon_start=1
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), isoform CRA_c"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT3231.2
FT                   protein_id=mCP19199.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UKA4"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:87921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKA4"
FT                   /protein_id="EDL12102.1"
FT                   /translation="MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATG
FT                   VCRSDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRIC
FT                   KHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDG
FT                   ASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIA
FT                   VDINKDKFAKAKELGATECINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALL
FT                   SCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKK
FT                   FPLDPLITHVLPFEKINEAFDLLRSGKSIRTVLTF"
FT   CDS             join(24774331..24774469,24776399..24776486,
FT                   24776578..24776797,24780655..24780915,24782712..24782847,
FT                   24783765..24783903,24784498..24784522)
FT                   /codon_start=1
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), isoform CRA_b"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT170982.0
FT                   protein_id=mCP93900.0 isoform=CRA_b"
FT                   /protein_id="EDL12101.1"
FT                   /translation="MVATGVCRSDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVK
FT                   PGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFIST
FT                   STFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGG
FT                   VGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYSKPIQEVLQEMTDGG
FT                   VDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFG
FT                   GFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAFDLLRSGKSIRTVLTF"
FT   gene            complement(24775363..>24869312)
FT                   /locus_tag="mCG_146132"
FT                   /note="gene_id=mCG146132.0"
FT   mRNA            complement(join(24775363..24776625,24868836..24869047,
FT                   24869220..>24869312))
FT                   /locus_tag="mCG_146132"
FT                   /product="mCG146132"
FT                   /note="gene_id=mCG146132.0 transcript_id=mCT186235.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(24776371..24776625,24868836..>24869018))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146132"
FT                   /product="mCG146132"
FT                   /note="gene_id=mCG146132.0 transcript_id=mCT186235.0
FT                   protein_id=mCP107721.0"
FT                   /protein_id="EDL12097.1"
FT                   /translation="TQRGVLQLCISPYDLLTLWIINFCWSWHGISALSAFLEVAQRKDN
FT                   PVCSMRALEPLKQCSSENLLVPSRKVPRGISRLVGETQAYKGHETEQSSVPTQLCKKTI
FT                   RNVLASATKVAFRVLANPAFSTLRGKEWNDFITWMKKNKMT"
FT   CDS             join(24776585..24776797,24780655..24780915,
FT                   24782712..24782847,24783765..24783903,24784498..24784522)
FT                   /codon_start=1
FT                   /gene="Adh1"
FT                   /locus_tag="mCG_4119"
FT                   /product="alcohol dehydrogenase 1 (class I), isoform CRA_a"
FT                   /note="gene_id=mCG4119.2 transcript_id=mCT170981.0
FT                   protein_id=mCP93899.0 isoform=CRA_a"
FT                   /protein_id="EDL12100.1"
FT                   /translation="MPRGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDG
FT                   ASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIA
FT                   VDINKDKFAKAKELGATECINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALL
FT                   SCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKK
FT                   FPLDPLITHVLPFEKINEAFDLLRSGKSIRTVLTF"
FT   assembly_gap    24799873..24813060
FT                   /estimated_length=13188
FT                   /gap_type="unknown"
FT   gene            <24815331..24823566
FT                   /locus_tag="mCG_4117"
FT                   /note="gene_id=mCG4117.3"
FT   mRNA            join(<24815331..24815483,24817321..24817408,
FT                   24817542..24817761,24818357..24818617,24819811..24819946,
FT                   24821508..24822847)
FT                   /locus_tag="mCG_4117"
FT                   /product="mCG4117, transcript variant mCT190599"
FT                   /note="gene_id=mCG4117.3 transcript_id=mCT190599.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<24815332..24815483,24817321..24817408,
FT                   24817542..24817761,24818357..24818617,24819811..24819946,
FT                   24821508..24821646,24823388..24823566)
FT                   /locus_tag="mCG_4117"
FT                   /product="mCG4117, transcript variant mCT3227"
FT                   /note="gene_id=mCG4117.3 transcript_id=mCT3227.2 created on
FT                   04-SEP-2002"
FT   CDS             join(<24815333..24815483,24817321..24817408,
FT                   24817542..24817761,24818357..24818617,24819811..24819946,
FT                   24821508..24821646,24823388..24823412)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4117"
FT                   /product="mCG4117, isoform CRA_b"
FT                   /note="gene_id=mCG4117.3 transcript_id=mCT3227.2
FT                   protein_id=mCP19183.2 isoform=CRA_b"
FT                   /protein_id="EDL12099.1"
FT                   /translation="ISMQMISSGICGSDDHVLKGELVVNFPLIPGHEGAGIVESVGDGV
FT                   CSMKPGDKVLILIIPQCRECDACLYPKGNFCYKQDVLPCSGVMLDGTSRFSCRGQKIYH
FT                   SFRTSSFTEYTVVPEIAAVKIDDAAPMDKVCLISCGFPTGYGAAVNSAKVTPGSTCVVF
FT                   GLGGVGSAIVMGCKASGASRIIGVDINEEKFPRARALGVTDCLNPNKLEKPVQEVVMEM
FT                   TGVGVDFAFEAIGLVDTMVAAWNSCNNSYGVCLIAGLAPSDAQLSLEAPKILSGKTLKG
FT                   VCLGDYKTRDCIPQIVTDYLQNKINIDPLVTYQLPFNQLHEALELFHSGKAIRCVLLF"
FT   CDS             join(<24815333..24815483,24817321..24817408,
FT                   24817542..24817761,24818357..24818617,24819811..24819946,
FT                   24821508..24821650)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4117"
FT                   /product="mCG4117, isoform CRA_a"
FT                   /note="gene_id=mCG4117.3 transcript_id=mCT190599.0
FT                   protein_id=mCP111559.0 isoform=CRA_a"
FT                   /protein_id="EDL12098.1"
FT                   /translation="ISMQMISSGICGSDDHVLKGELVVNFPLIPGHEGAGIVESVGDGV
FT                   CSMKPGDKVLILIIPQCRECDACLYPKGNFCYKQDVLPCSGVMLDGTSRFSCRGQKIYH
FT                   SFRTSSFTEYTVVPEIAAVKIDDAAPMDKVCLISCGFPTGYGAAVNSAKVTPGSTCVVF
FT                   GLGGVGSAIVMGCKASGASRIIGVDINEEKFPRARALGVTDCLNPNKLEKPVQEVVMEM
FT                   TGVGVDFAFEAIGLVDTMVAAWNSCNNSYGVCLIAGLAPSDAQLSLEAPKILSGKTLKG
FT                   VCLGDYKTRDCIPQIVTDYLQNKINIDPLVTYQLPFNQLHEALELFHSGKA"
FT   assembly_gap    24825526..24825545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24867104..24867123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24875845..24875864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24881316..24881335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24892803..24892822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24923072..24940462
FT                   /gene="Adh4"
FT                   /locus_tag="mCG_21028"
FT                   /note="gene_id=mCG21028.1"
FT   mRNA            join(24923072..24923112,24926217..24926318,
FT                   24927268..24927406,24928707..24928794,24931731..24931962,
FT                   24933565..24933825,24937541..24937670,24938607..24938745,
FT                   24940295..24940462)
FT                   /gene="Adh4"
FT                   /locus_tag="mCG_21028"
FT                   /product="alcohol dehydrogenase 4 (class II), pi
FT                   polypeptide"
FT                   /note="gene_id=mCG21028.1 transcript_id=mCT19489.1 created
FT                   on 12-APR-2002"
FT   CDS             join(24923095..24923112,24926217..24926318,
FT                   24927268..24927406,24928707..24928794,24931731..24931962,
FT                   24933565..24933825,24937541..24937670,24938607..24938745,
FT                   24940295..24940319)
FT                   /codon_start=1
FT                   /gene="Adh4"
FT                   /locus_tag="mCG_21028"
FT                   /product="alcohol dehydrogenase 4 (class II), pi
FT                   polypeptide"
FT                   /note="gene_id=mCG21028.1 transcript_id=mCT19489.1
FT                   protein_id=mCP19270.2"
FT                   /db_xref="GOA:Q496S1"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028632"
FT                   /db_xref="MGI:MGI:1349472"
FT                   /db_xref="UniProtKB/TrEMBL:Q496S1"
FT                   /protein_id="EDL12096.1"
FT                   /translation="MGTQGKVIKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATC
FT                   VCPTDINATDPKKKALFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLC
FT                   LSPLTNLCGKLRNFKYPTIDQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLA
FT                   RVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGAS
FT                   RIIAIDINGEKFPKAKALGATDCLNPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLK
FT                   AAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKN
FT                   KKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF"
FT   assembly_gap    24925186..24925205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24952714..24965067
FT                   /gene="Adh5"
FT                   /locus_tag="mCG_21036"
FT                   /note="gene_id=mCG21036.2"
FT   mRNA            join(24952714..24952764,24954859..24954960,
FT                   24956652..24956793,24957421..24957508,24960468..24960687,
FT                   24960813..24961073,24963310..24963445,24964236..24964374,
FT                   24964653..24965067)
FT                   /gene="Adh5"
FT                   /locus_tag="mCG_21036"
FT                   /product="alcohol dehydrogenase 5 (class III), chi
FT                   polypeptide"
FT                   /note="gene_id=mCG21036.2 transcript_id=mCT19649.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(24952753..24952764,24954859..24954960,
FT                   24956652..24956793,24957421..24957508,24960468..24960687,
FT                   24960813..24961073,24963310..24963445,24964236..24964374,
FT                   24964653..24964677)
FT                   /codon_start=1
FT                   /gene="Adh5"
FT                   /locus_tag="mCG_21036"
FT                   /product="alcohol dehydrogenase 5 (class III), chi
FT                   polypeptide"
FT                   /note="gene_id=mCG21036.2 transcript_id=mCT19649.2
FT                   protein_id=mCP19259.2"
FT                   /db_xref="GOA:Q6P5I3"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:87929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P5I3"
FT                   /protein_id="EDL12095.1"
FT                   /translation="MANQVIRCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKILATAVC
FT                   HTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCL
FT                   NPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKSVFHFMGTSTFSEYTVVADISVAKIDPS
FT                   APLDKVCLLGCGISTGYGAAVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGI
FT                   DINKDKFAKAKEFGASECISPQDFSKSIQEVLVEMTDGGVDYSFECIGNVKVMRSALEA
FT                   AHKGWGVSVVVGVAASGEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKI
FT                   KVDEFVTGNLSFDQINQAFDLMHSGDSIRTVLKM"
FT   gene            complement(24968532..24998771)
FT                   /gene="Metap1"
FT                   /locus_tag="mCG_21030"
FT                   /note="gene_id=mCG21030.1"
FT   mRNA            complement(join(24968532..24970067,24971933..24971998,
FT                   24975782..24975925,24978388..24978519,24981636..24981774,
FT                   24983389..24983472,24984472..24984563,24988356..24988416,
FT                   24990062..24990174,24992433..24992484,24998624..24998771))
FT                   /gene="Metap1"
FT                   /locus_tag="mCG_21030"
FT                   /product="methionyl aminopeptidase 1"
FT                   /note="gene_id=mCG21030.1 transcript_id=mCT19643.2 created
FT                   on 12-APR-2002"
FT   CDS             complement(join(24969904..24970067,24971933..24971998,
FT                   24975782..24975925,24978388..24978519,24981636..24981774,
FT                   24983389..24983472,24984472..24984563,24988356..24988416,
FT                   24990062..24990174,24992433..24992484,24998624..24998737))
FT                   /codon_start=1
FT                   /gene="Metap1"
FT                   /locus_tag="mCG_21030"
FT                   /product="methionyl aminopeptidase 1"
FT                   /note="gene_id=mCG21030.1 transcript_id=mCT19643.2
FT                   protein_id=mCP19198.2"
FT                   /db_xref="GOA:Q4VAA9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="MGI:MGI:1922874"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAA9"
FT                   /protein_id="EDL12094.1"
FT                   /translation="MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSW
FT                   ATHKLLHKKAKDEKAKREVCSWTVEGDVNTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQ
FT                   RPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDIAAGMIKAGVTT
FT                   EEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDIT
FT                   LYRNGYHGDLNETFFVGDVDEGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQ
FT                   ANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETW
FT                   PDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSSRPHFMSQF"
FT   assembly_gap    24999056..25000589
FT                   /estimated_length=1534
FT                   /gap_type="unknown"
FT   assembly_gap    25007012..25007119
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            complement(<25012845..>25013216)
FT                   /locus_tag="mCG_141386"
FT                   /note="gene_id=mCG141386.0"
FT   mRNA            complement(<25012845..>25013216)
FT                   /locus_tag="mCG_141386"
FT                   /product="mCG141386"
FT                   /note="gene_id=mCG141386.0 transcript_id=mCT175084.0
FT                   created on 29-OCT-2002"
FT   CDS             complement(25012845..>25013216)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141386"
FT                   /product="mCG141386"
FT                   /note="gene_id=mCG141386.0 transcript_id=mCT175084.0
FT                   protein_id=mCP98003.0"
FT                   /protein_id="EDL12093.1"
FT                   /translation="VKPFRDRICRIFSHDNVLSFEDVLGMASLFSEQACPSLKIEYAFP
FT                   IYDFNENGVVDEEDLQKIVLGLLKSDDVSEDLLMDVMRHVLGESDLDNGGMLSLSEFEH
FT                   ALAKSPDFTNSFWIHFWGC"
FT   assembly_gap    25016133..25016260
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    25026643..25026981
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    25033437..25036621
FT                   /estimated_length=3185
FT                   /gap_type="unknown"
FT   gene            <25054976..25065843
FT                   /locus_tag="mCG_21035"
FT                   /note="gene_id=mCG21035.1"
FT   mRNA            join(<25054976..25055083,25056315..25056410,
FT                   25064573..25064865)
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, transcript variant mCT170965"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT170965.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(<25054977..25055083,25056315..25056410,
FT                   25058915..25058978,25059545..25059658,25062236..25062375,
FT                   25064040..25065843)
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, transcript variant mCT19648"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT19648.2 created
FT                   on 22-JUL-2002"
FT   mRNA            join(<25054977..25055083,25058915..25058978,
FT                   25059545..25059658,25062236..25062375,25064040..25065843)
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, transcript variant mCT170966"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT170966.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(<25054977..25055083,25056315..25056410,
FT                   25064573..25064591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, isoform CRA_b"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT170965.0
FT                   protein_id=mCP93883.0 isoform=CRA_b"
FT                   /protein_id="EDL12091.1"
FT                   /translation="ETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKND
FT                   KSKTWQANLRLISKFDTVEDFWALSTAF"
FT   CDS             join(<25054977..25055083,25056315..25056410,
FT                   25058915..25058978,25059545..25059658,25062236..25062375,
FT                   25064040..25064154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, isoform CRA_c"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT19648.2
FT                   protein_id=mCP19238.1 isoform=CRA_c"
FT                   /protein_id="EDL12092.1"
FT                   /translation="ETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKND
FT                   KSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRG
FT                   GRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTE
FT                   CENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV"
FT   CDS             join(<25054977..25055083,25058915..25058978,
FT                   25059545..25059658,25062236..25062375,25064040..25064154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21035"
FT                   /product="mCG21035, isoform CRA_a"
FT                   /note="gene_id=mCG21035.1 transcript_id=mCT170966.0
FT                   protein_id=mCP93884.0 isoform=CRA_a"
FT                   /protein_id="EDL12090.1"
FT                   /translation="ETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNSLYNHIQLSS
FT                   NLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESF
FT                   DDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHA
FT                   DTATKSGSTTKNRFVV"
FT   gene            complement(25067062..25068337)
FT                   /locus_tag="mCG_147425"
FT                   /note="gene_id=mCG147425.0"
FT   mRNA            complement(join(25067062..25067675,25067974..25068337))
FT                   /locus_tag="mCG_147425"
FT                   /product="mCG147425"
FT                   /note="gene_id=mCG147425.0 transcript_id=mCT187688.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(25067138..25067320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147425"
FT                   /product="mCG147425"
FT                   /note="gene_id=mCG147425.0 transcript_id=mCT187688.0
FT                   protein_id=mCP109648.0"
FT                   /protein_id="EDL12089.1"
FT                   /translation="MTTAGGEGMLQSGICMHWLSGILPQWDSFGFNVSRQGLCSLSCPR
FT                   TSIMDQAGLKVYSSI"
FT   assembly_gap    25075524..25075974
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    25080375..25080394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25082098..25082441
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   gene            complement(25089583..25090362)
FT                   /pseudo
FT                   /locus_tag="mCG_1045648"
FT                   /note="gene_id=mCG1045648.1"
FT   mRNA            complement(25089583..25090362)
FT                   /pseudo
FT                   /locus_tag="mCG_1045648"
FT                   /note="gene_id=mCG1045648.1 transcript_id=mCT163352.1
FT                   created on 25-NOV-2002"
FT   assembly_gap    25098628..25098828
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    25110908..25111071
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            25111072..25112378
FT                   /pseudo
FT                   /locus_tag="mCG_53156"
FT                   /note="gene_id=mCG53156.2"
FT   mRNA            25111072..25112378
FT                   /pseudo
FT                   /locus_tag="mCG_53156"
FT                   /note="gene_id=mCG53156.2 transcript_id=mCT53339.2 created
FT                   on 10-SEP-2002"
FT   assembly_gap    25112584..25112674
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(25114083..25114873)
FT                   /pseudo
FT                   /locus_tag="mCG_141679"
FT                   /note="gene_id=mCG141679.0"
FT   mRNA            complement(join(25114083..25114203,25114522..25114873))
FT                   /pseudo
FT                   /locus_tag="mCG_141679"
FT                   /note="gene_id=mCG141679.0 transcript_id=mCT176293.0
FT                   created on 25-NOV-2002"
FT   assembly_gap    25126706..25127907
FT                   /estimated_length=1202
FT                   /gap_type="unknown"
FT   assembly_gap    25133858..25133877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25135942..25135961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25137323..25137342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25147252..25147368
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    25156110..25156514
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    25165057..25165114
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    25176949..25176968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25195065..25196643
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   assembly_gap    25200126..25200243
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    25224528..25224795
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            complement(25225938..>25241362)
FT                   /locus_tag="mCG_55273"
FT                   /note="gene_id=mCG55273.2"
FT   mRNA            complement(join(25225938..25227075,25229341..25229448,
FT                   25229891..25229939,25241240..>25241362))
FT                   /locus_tag="mCG_55273"
FT                   /product="mCG55273"
FT                   /note="gene_id=mCG55273.2 transcript_id=mCT55456.2 created
FT                   on 04-SEP-2002"
FT   CDS             complement(25226472..>25226708)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55273"
FT                   /product="mCG55273"
FT                   /note="gene_id=mCG55273.2 transcript_id=mCT55456.2
FT                   protein_id=mCP39707.2"
FT                   /protein_id="EDL12088.1"
FT                   /translation="KMHPPIYKTCSELHTICCMSWFLHTSHAIYLFTVNTSNGSRSLGM
FT                   VTQSHTGQVSRSLPMVALYAALYDKAPDFDPYH"
FT   assembly_gap    25250757..25251009
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    25256257..25256822
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   gene            <25256823..25418885
FT                   /gene="Tspan5"
FT                   /locus_tag="mCG_21033"
FT                   /note="gene_id=mCG21033.3"
FT   mRNA            join(<25256823..25257012,25382239..25382289,
FT                   25404661..25404807,25408273..25408443,25411309..25411370,
FT                   25412569..25412616,25412723..25412839,25416839..25418885)
FT                   /gene="Tspan5"
FT                   /locus_tag="mCG_21033"
FT                   /product="tetraspanin 5, transcript variant mCT190600"
FT                   /note="gene_id=mCG21033.3 transcript_id=mCT190600.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(25256823..25257012,25382239..25382289,
FT                   25404661..25404807,25408273..25408443,25411245..25411370,
FT                   25412569..25412616,25412723..25412839,25416839..25418884)
FT                   /gene="Tspan5"
FT                   /locus_tag="mCG_21033"
FT                   /product="tetraspanin 5, transcript variant mCT19646"
FT                   /note="gene_id=mCG21033.3 transcript_id=mCT19646.2 created
FT                   on 22-JUL-2002"
FT   CDS             join(<25256923..25257012,25382239..25382289,
FT                   25404661..25404807,25408273..25408443,25411309..25411370,
FT                   25412569..25412616,25412723..25412744)
FT                   /codon_start=1
FT                   /gene="Tspan5"
FT                   /locus_tag="mCG_21033"
FT                   /product="tetraspanin 5, isoform CRA_a"
FT                   /note="gene_id=mCG21033.3 transcript_id=mCT190600.0
FT                   protein_id=mCP111551.0 isoform=CRA_a"
FT                   /protein_id="EDL12085.1"
FT                   /translation="TQRMSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWN
FT                   EKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGII
FT                   FFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYIPMQAESDAV
FT                   CHFPAALKTPRKMSSTLSVAMMPGRNQKLTNRL"
FT   CDS             join(25256932..25257012,25382239..25382289,
FT                   25404661..25404807,25408273..25408443,25411245..25411370,
FT                   25412569..25412616,25412723..25412839,25416839..25416904)
FT                   /codon_start=1
FT                   /gene="Tspan5"
FT                   /locus_tag="mCG_21033"
FT                   /product="tetraspanin 5, isoform CRA_b"
FT                   /note="gene_id=mCG21033.3 transcript_id=mCT19646.2
FT                   protein_id=mCP19221.2 isoform=CRA_b"
FT                   /protein_id="EDL12086.1"
FT                   /translation="MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKG
FT                   VLSNISSITDLGGFDPVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFL
FT                   ELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWN
FT                   LNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCV
FT                   PQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW"
FT   assembly_gap    25266184..25267033
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    25281328..25281618
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    25302403..25302523
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    25335047..25335251
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   gene            complement(25342510..>25343080)
FT                   /locus_tag="mCG_21034"
FT                   /note="gene_id=mCG21034.2"
FT   mRNA            complement(25342510..>25343080)
FT                   /locus_tag="mCG_21034"
FT                   /product="mCG21034"
FT                   /note="gene_id=mCG21034.2 transcript_id=mCT19647.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(25342569..>25343045)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21034"
FT                   /product="mCG21034"
FT                   /note="gene_id=mCG21034.2 transcript_id=mCT19647.2
FT                   protein_id=mCP19236.1"
FT                   /protein_id="EDL12087.1"
FT                   /translation="NTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMRT
FT                   VKKGMPHKCYHGKTVRVYNVIQHAVGITVNKQVKGKILAKRINVRIEHIKHSKSRDSFL
FT                   KWVKENDQKKKEAKEKGTWVQLKRQPVPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   assembly_gap    25404379..25404398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25408815..25408834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25424470..25424489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(25440443..>25565656)
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /note="gene_id=mCG122953.1"
FT   mRNA            complement(join(25440443..25442248,25456236..25456364,
FT                   25460168..25460294,25469797..25469936,25470669..25470794,
FT                   25471885..25472019,25473029..25473160,25473511..25473654,
FT                   25478293..25478418,25480334..25480462,25529833..25529958,
FT                   25536082..25536204,25565544..>25565656))
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1,
FT                   transcript variant mCT127101"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT127101.1
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(25440443..25442248,25456236..25456364,
FT                   25460168..25460294,25469797..25469936,25470669..25470794,
FT                   25471885..25472019,25473029..25473160,25473511..25473654,
FT                   25478293..25478418,25480334..25480462,25497981..25498127,
FT                   25529833..25529958,25536082..25536204,25565544..>25565656))
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1,
FT                   transcript variant mCT124179"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT124179.1
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(25440450..25440539,25440564..25442248,
FT                   25456236..25456364,25460168..25460294,25469797..25469936,
FT                   25470669..25470794,25471885..25472019,25473029..25473160,
FT                   25473511..25473654,25478293..25478418,25480334..25480462,
FT                   25529833..25529958,25536082..25536204,25565544..>25565656))
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1,
FT                   transcript variant mCT190576"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT190576.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(25442121..25442248,25456236..25456364,
FT                   25460168..25460294,25469797..25469936,25470669..25470794,
FT                   25471885..25472019,25473029..25473160,25473511..25473654,
FT                   25478293..25478418,25480334..25480462,25529833..25529958,
FT                   25536082..25536204,25565544..>25565655))
FT                   /codon_start=1
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT190576.0
FT                   protein_id=mCP111539.0 isoform=CRA_a"
FT                   /protein_id="EDL12081.1"
FT                   /translation="TDNLSDTLKKLKITAADRTEGSLEGCLDCLLQALAQNNAETSEKI
FT                   QGSGILQLFANLLTPQASCTAKVADIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQE
FT                   VLLQTGRALGNICYDSHSLQAQLISMGVIPTLVKLLGIHCHNAALTEMCLVAFGNLAEL
FT                   ESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLL
FT                   EIVQQKVNSNKEDDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNH
FT                   QLQLAGALAIANFARNDGNCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLA
FT                   IPVVNKAKMLSAGVTETVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVE
FT                   RLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHVIMQ
FT                   NEALVALALIAALELGPAEKDLASAQLVQILHRLLADERSAPEIKYNSMVLICALMGSE
FT                   SLYKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES"
FT   CDS             complement(join(25442121..25442248,25456236..25456364,
FT                   25460168..25460294,25469797..25469936,25470669..25470794,
FT                   25471885..25472019,25473029..25473160,25473511..25473654,
FT                   25478293..25478418,25480334..25480462,25529833..25529958,
FT                   25536082..25536204,25565544..>25565649))
FT                   /codon_start=1
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT127101.1
FT                   protein_id=mCP89618.1 isoform=CRA_d"
FT                   /protein_id="EDL12084.1"
FT                   /translation="NLSDTLKKLKITAADRTEGSLEGCLDCLLQALAQNNAETSEKIQG
FT                   SGILQLFANLLTPQASCTAKVADIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVL
FT                   LQTGRALGNICYDSHSLQAQLISMGVIPTLVKLLGIHCHNAALTEMCLVAFGNLAELES
FT                   SKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEI
FT                   VQQKVNSNKEDDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQL
FT                   QLAGALAIANFARNDGNCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIP
FT                   VVNKAKMLSAGVTETVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVERL
FT                   VEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHVIMQNE
FT                   ALVALALIAALELGPAEKDLASAQLVQILHRLLADERSAPEIKYNSMVLICALMGSESL
FT                   YKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES"
FT   CDS             complement(join(25442121..25442248,25456236..25456364,
FT                   25460168..25460294,25469797..25469936,25470669..25470794,
FT                   25471885..25472019,25473029..25473160,25473511..25473654,
FT                   25478293..25478418,25480334..25480462,25497981..25498127,
FT                   25529833..25529958,25536082..25536204,25565544..>25565649))
FT                   /codon_start=1
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT124179.1
FT                   protein_id=mCP89213.1 isoform=CRA_c"
FT                   /protein_id="EDL12083.1"
FT                   /translation="NLSDTLKKLKITAADRTEGSLEGCLDCLLQALAQNNAETSEKIQG
FT                   SGILQLFANLLTPQASCTAKVADIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVL
FT                   LQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHLRSLCGRTDPASEKLMTVFCGMLMNY
FT                   SNENDSLQAQLISMGVIPTLVKLLGIHCHNAALTEMCLVAFGNLAELESSKEQFASTNI
FT                   AEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVNSNKE
FT                   DDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIAN
FT                   FARNDGNCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVVNKAKMLSA
FT                   GVTETVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVERLVEWCEAKDHA
FT                   GVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHVIMQNEALVALALIAA
FT                   LELGPAEKDLASAQLVQILHRLLADERSAPEIKYNSMVLICALMGSESLYKEVQDLAFL
FT                   DVVSKLRSHENKSVAQQASLTEQRLTVES"
FT   gene            complement(25451010..25453976)
FT                   /pseudo
FT                   /locus_tag="mCG_140803"
FT                   /note="gene_id=mCG140803.0"
FT   mRNA            complement(25451010..25453976)
FT                   /pseudo
FT                   /locus_tag="mCG_140803"
FT                   /note="gene_id=mCG140803.0 transcript_id=mCT171601.0
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(25455282..25456364,25460168..25460294,
FT                   25469797..25469936,25470669..25470794,25471885..25472019,
FT                   25473029..25473160,25473511..25473654,25478293..25478418,
FT                   25480334..25480462,25529833..25529958,25536082..25536204,
FT                   25565544..>25565656))
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1,
FT                   transcript variant mCT190577"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT190577.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(25456066..25456364,25460168..25460294,
FT                   25469797..25469936,25470669..25470794,25471885..25472019,
FT                   25473029..25473160,25473511..25473654,25478293..25478418,
FT                   25480334..25480462,25529833..25529958,25536082..25536204,
FT                   25565544..>25565655))
FT                   /codon_start=1
FT                   /gene="Rap1gds1"
FT                   /locus_tag="mCG_122953"
FT                   /product="RAP1, GTP-GDP dissociation stimulator 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG122953.1 transcript_id=mCT190577.0
FT                   protein_id=mCP111540.0 isoform=CRA_b"
FT                   /protein_id="EDL12082.1"
FT                   /translation="TDNLSDTLKKLKITAADRTEGSLEGCLDCLLQALAQNNAETSEKI
FT                   QGSGILQLFANLLTPQASCTAKVADIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQE
FT                   VLLQTGRALGNICYDSHSLQAQLISMGVIPTLVKLLGIHCHNAALTEMCLVAFGNLAEL
FT                   ESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLL
FT                   EIVQQKVNSNKEDDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNH
FT                   QLQLAGALAIANFARNDGNCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLA
FT                   IPVVNKAKMLSAGVTETVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVE
FT                   RLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHLVTMATSEHVIMQ
FT                   NEALVALALIAALELGPAEKDLASAQLVQILHRLLADERSAPEIKYNSMVLICALMGSG
FT                   KASSCRSVSMWLSSDVKRWIINDNKGLKRSSKSFERGYRGQNGVSDNCSHNHRQF"
FT   assembly_gap    25461771..25461790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25522016..25522035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25574023..25574042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25589790..25590433
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   gene            complement(<25642455..>25642892)
FT                   /locus_tag="mCG_49497"
FT                   /note="gene_id=mCG49497.2"
FT   mRNA            complement(<25642455..>25642892)
FT                   /locus_tag="mCG_49497"
FT                   /product="mCG49497"
FT                   /note="gene_id=mCG49497.2 transcript_id=mCT49680.2 created
FT                   on 29-OCT-2002"
FT   CDS             complement(<25642455..>25642892)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49497"
FT                   /product="mCG49497"
FT                   /note="gene_id=mCG49497.2 transcript_id=mCT49680.2
FT                   protein_id=mCP39636.2"
FT                   /protein_id="EDL12080.1"
FT                   /translation="LASLKHNFIAIKLDGVQHGLVGGIIKHFKEKRFCPTAVKFLWASE
FT                   EHLKQRYVDWKDHPFFPGLLKHLNSGPIGAMVWEGLNLVKRGRVMLRETNPADSKPGTI
FT                   RGESCIQGGRNITYSSDSVESLWFKPEELVDYKSCAHDWGYE"
FT   assembly_gap    25644701..25644724
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    25672197..25672216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25678746..25678765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25687377..25688105
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    25688862..25689459
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   assembly_gap    25698160..25698195
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    25699837..25702959
FT                   /estimated_length=3123
FT                   /gap_type="unknown"
FT   assembly_gap    25704537..25705362
FT                   /estimated_length=826
FT                   /gap_type="unknown"
FT   gene            25725601..26215972
FT                   /gene="B930007M17Rik"
FT                   /locus_tag="mCG_142771"
FT                   /note="gene_id=mCG142771.0"
FT   mRNA            join(25725601..25725716,25731943..25732055,
FT                   25734951..25735079,25737902..25738066,25751913..25752025,
FT                   25762790..25762901,25817966..25818073,25825711..25825867,
FT                   25828649..25828810,25836983..25837072,25935418..25935577,
FT                   26045620..26045738,26210324..26210472,26214850..26215972)
FT                   /gene="B930007M17Rik"
FT                   /locus_tag="mCG_142771"
FT                   /product="RIKEN cDNA B930007M17"
FT                   /note="gene_id=mCG142771.0 transcript_id=mCT182146.0
FT                   created on 20-MAY-2003"
FT   CDS             join(25725608..25725716,25731943..25732055,
FT                   25734951..25735079,25737902..25738066,25751913..25752025,
FT                   25762790..25762901,25817966..25818073,25825711..25825867,
FT                   25828649..25828698)
FT                   /codon_start=1
FT                   /gene="B930007M17Rik"
FT                   /locus_tag="mCG_142771"
FT                   /product="RIKEN cDNA B930007M17"
FT                   /note="gene_id=mCG142771.0 transcript_id=mCT182146.0
FT                   protein_id=mCP105066.0"
FT                   /protein_id="EDL12079.1"
FT                   /translation="MYDRAPRWLDCANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSL
FT                   SSKTSACVVSSDAGQAVPGPAHYNVSQAQYNIRGGRSLQNREKRFKKLISDGPGPGSYN
FT                   WPYLGTLCITTRQKTPRTPAVSRNIDIPSIPSSGKSHGYHLNDDDTIMRRTPPPSDNTI
FT                   GPAYYNPQFDYPKASLKYKGVNFGNATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIK
FT                   REQEHNYYTYVPRLYEAIILQEEKKGVPGPGKYNIKSEFDMIKSMSALVNSPSFIFFSE
FT                   TERFEPIKSCTPAPGTYNEIRTAFKCPKKRFGLSLPFNQSAARFTEDSKAQKLPGPGFY
FT                   DISTNHCKSPG"
FT   assembly_gap    25731485..25731713
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    25741231..25741262
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    25786034..25786070
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    25793153..25793365
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    25796769..25796788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25817779..25817798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25839615..25839634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25852577..25852959
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    25860886..25861466
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    25877269..25877288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25879444..25883120
FT                   /estimated_length=3677
FT                   /gap_type="unknown"
FT   assembly_gap    25888606..25888625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25889698..25890548
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    25891916..25892441
FT                   /estimated_length=526
FT                   /gap_type="unknown"
FT   assembly_gap    25895105..25895307
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    25904105..25907207
FT                   /estimated_length=3103
FT                   /gap_type="unknown"
FT   assembly_gap    25922186..25922460
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    25923828..25923847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25929668..25931593
FT                   /estimated_length=1926
FT                   /gap_type="unknown"
FT   assembly_gap    25936640..25937087
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    25970047..25970066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25971234..25971253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25974036..25974055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25978301..25978572
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    26004208..26006925
FT                   /estimated_length=2718
FT                   /gap_type="unknown"
FT   assembly_gap    26009563..26009582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26010957..26010976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26014950..26014969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26016056..26016669
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    26018560..26018579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26020801..26020820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26041374..26041393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26052985..26053309
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    26093644..26093663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26101272..26101609
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   gene            26153732..26154981
FT                   /pseudo
FT                   /locus_tag="mCG_122952"
FT                   /note="gene_id=mCG122952.1"
FT   mRNA            26153732..26154981
FT                   /pseudo
FT                   /locus_tag="mCG_122952"
FT                   /note="gene_id=mCG122952.1 transcript_id=mCT124178.1
FT                   created on 20-MAY-2003"
FT   assembly_gap    26154520..26154539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26162338..26162357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26163975..26163994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26165012..26165031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26170562..26170581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26171606..26171625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26234007..26234026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26263676..26263991
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    26282259..26282278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26283280..26283299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26284848..>26288457)
FT                   /locus_tag="mCG_145186"
FT                   /note="gene_id=mCG145186.0"
FT   mRNA            complement(join(26284848..26286984,26288018..26288121,
FT                   26288291..>26288457))
FT                   /locus_tag="mCG_145186"
FT                   /product="mCG145186"
FT                   /note="gene_id=mCG145186.0 transcript_id=mCT184610.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(26286234..>26286503)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145186"
FT                   /product="mCG145186"
FT                   /note="gene_id=mCG145186.0 transcript_id=mCT184610.0
FT                   protein_id=mCP106183.0"
FT                   /protein_id="EDL12078.1"
FT                   /translation="ALMESIIQTQGTLRNIYPKWLCQGLHASDEHFPLTMHGAQDCYDR
FT                   QREAGRQRYQPLQLLLGSFPIYDALFINVYFIHPLFSSSSVKEE"
FT   assembly_gap    26292500..26292758
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    26294309..26294328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26295340..26295359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26311809..26311828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26315246..26315265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26324631..26328316
FT                   /estimated_length=3686
FT                   /gap_type="unknown"
FT   assembly_gap    26337472..26338250
FT                   /estimated_length=779
FT                   /gap_type="unknown"
FT   assembly_gap    26341090..26341109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26366609..26366628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26387388..26387407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26388602..26388621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26390264..26390283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26394343..26397110
FT                   /estimated_length=2768
FT                   /gap_type="unknown"
FT   assembly_gap    26410272..26410291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            26448708..26467410
FT                   /locus_tag="mCG_140801"
FT                   /note="gene_id=mCG140801.0"
FT   mRNA            join(26448708..26448806,26466896..26467410)
FT                   /locus_tag="mCG_140801"
FT                   /product="mCG140801"
FT                   /note="gene_id=mCG140801.0 transcript_id=mCT171598.0
FT                   created on 07-AUG-2002"
FT   assembly_gap    26453298..26453450
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    26463247..26463295
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   CDS             26466955..26467122
FT                   /codon_start=1
FT                   /locus_tag="mCG_140801"
FT                   /product="mCG140801"
FT                   /note="gene_id=mCG140801.0 transcript_id=mCT171598.0
FT                   protein_id=mCP94517.0"
FT                   /protein_id="EDL12077.1"
FT                   /translation="MCFSETRAEKHVETAAGTELGALHHAIRESSTARDSDSQVLKEKA
FT                   PLGRSISLTA"
FT   assembly_gap    26505751..26505800
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    26515052..26515071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26516805..26516824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26518896..26518915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26534621..26534640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26543968..26543987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26573985..26574004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26608222..26608241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26630136..26630155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26632287..26632306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26644666..26646098
FT                   /estimated_length=1433
FT                   /gap_type="unknown"
FT   assembly_gap    26647195..26647214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26649535..26649554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26650483..>26652068)
FT                   /locus_tag="mCG_21424"
FT                   /note="gene_id=mCG21424.1"
FT   mRNA            complement(26650483..>26652068)
FT                   /locus_tag="mCG_21424"
FT                   /product="mCG21424"
FT                   /note="gene_id=mCG21424.1 transcript_id=mCT21744.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(26650539..>26651465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21424"
FT                   /product="mCG21424"
FT                   /note="gene_id=mCG21424.1 transcript_id=mCT21744.2
FT                   protein_id=mCP19261.2"
FT                   /protein_id="EDL12076.1"
FT                   /translation="AIENSRAGVESWKYKAKNSLMYYPKGVPDIKQLFKEPLQVVHKNT
FT                   RFLQDPFSQVLSKSQLQQAAALNAQHKLGNVGPDGKELIPQESPRVNGFGFVATPSPAP
FT                   GMNESPLMVWGQVENTPLLIEGSESPYVDRTLGPVFKISEPGPRERLGLKIANEAASKN
FT                   RAMKHKALQRVTGNLTSLTRKGLSPAMSPALHRPVSRTASRYTDLALWASHTPSPACST
FT                   HLKNPTAGPQTPTSIPALTGTPLTQDPASITDNLLQFPRPAQSFRLLLEPGLAGLVDVL
FT                   CDTLWSIWGQFLLLRGLQALETQNTGS"
FT   assembly_gap    26652683..26652918
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    26661391..26661410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            26675022..26675519
FT                   /pseudo
FT                   /locus_tag="mCG_53502"
FT                   /note="gene_id=mCG53502.2"
FT   mRNA            26675022..26675519
FT                   /pseudo
FT                   /locus_tag="mCG_53502"
FT                   /note="gene_id=mCG53502.2 transcript_id=mCT53685.2 created
FT                   on 22-NOV-2002"
FT   assembly_gap    26681161..26681180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26689803..26690038
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    26691845..26692618
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    26694076..26694095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26697052..26697071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26700746..26702560
FT                   /estimated_length=1815
FT                   /gap_type="unknown"
FT   assembly_gap    26722813..26722832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26817227..26817533
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    26819494..26819513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26821972..26822239
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    26827009..26827630
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    26828840..26829718
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    26839221..26841258
FT                   /estimated_length=2038
FT                   /gap_type="unknown"
FT   assembly_gap    26848022..26848197
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    26849367..26850689
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    26852398..26857462
FT                   /estimated_length=5065
FT                   /gap_type="unknown"
FT   assembly_gap    26858966..26858985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26860751..26860914
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    26863033..26863156
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    26882285..26882304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26883555..26883574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26887670..26887689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26896717..26896736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26916422..26916636
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    26934508..26934527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26943703..26945583
FT                   /estimated_length=1881
FT                   /gap_type="unknown"
FT   assembly_gap    26959304..26959846
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   assembly_gap    26965659..26965759
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    26974425..26974444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26975570..26975589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26978025..26978044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26979149..26979168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(27018673..27019224)
FT                   /pseudo
FT                   /locus_tag="mCG_1045646"
FT                   /note="gene_id=mCG1045646.1"
FT   mRNA            complement(27018673..27019224)
FT                   /pseudo
FT                   /locus_tag="mCG_1045646"
FT                   /note="gene_id=mCG1045646.1 transcript_id=mCT163350.1
FT                   created on 21-NOV-2002"
FT   assembly_gap    27026208..27026227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27058326..27058345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27074168..27074187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27075407..27075426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27077726..27077969
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    27090412..27090431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27099275..27099620
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    27121147..27121166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27138993..27139085
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    27145549..27145568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27195938..27195957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27197103..27197931
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    27199936..27199955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27213931..27219891
FT                   /estimated_length=5961
FT                   /gap_type="unknown"
FT   assembly_gap    27223979..27223998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27225245..27225264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27235263..27235649
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    27237079..27237098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27238264..27238283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27240349..27240368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27243628..27243647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27245428..27246279
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   assembly_gap    27247962..27247981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27249174..27249193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27250622..27250641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27251937..27251956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27264438..27264522
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    27278836..27278855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27342325..27342344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<27345281..>27345769)
FT                   /locus_tag="mCG_1045552"
FT                   /note="gene_id=mCG1045552.1"
FT   mRNA            complement(<27345281..>27345769)
FT                   /locus_tag="mCG_1045552"
FT                   /product="mCG1045552"
FT                   /note="gene_id=mCG1045552.1 transcript_id=mCT163256.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(<27345281..27345769)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045552"
FT                   /product="mCG1045552"
FT                   /note="gene_id=mCG1045552.1 transcript_id=mCT163256.1
FT                   protein_id=mCP89217.1"
FT                   /protein_id="EDL12075.1"
FT                   /translation="MVTPMQRFIDPRQAGANKQRVRYQKCLKFGHRAYECKGKRKYLHW
FT                   PSRTAELKKALEEKENIYCSKASETNIERKTEKRRSKDVTSSTSRSDSSACESSSENET
FT                   SASSSSEDSDPGASLSSSSSSSSSSSLSLDSDSDSSSSSSSSSSSSSSSSSSSSSNNNS
FT                   "
FT   assembly_gap    27373229..27373508
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    27391723..27391742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27399288..27399307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(27411803..>27424232)
FT                   /locus_tag="mCG_144632"
FT                   /note="gene_id=mCG144632.0"
FT   mRNA            complement(join(27411803..27412231,27415222..27415275,
FT                   27416574..27416669,27424068..>27424232))
FT                   /locus_tag="mCG_144632"
FT                   /product="mCG144632"
FT                   /note="gene_id=mCG144632.0 transcript_id=mCT184056.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(27415238..27415275,27416574..27416669,
FT                   27424068..>27424092))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144632"
FT                   /product="mCG144632"
FT                   /note="gene_id=mCG144632.0 transcript_id=mCT184056.0
FT                   protein_id=mCP106170.0"
FT                   /protein_id="EDL12074.1"
FT                   /translation="VYKASPDDFVVLAAVVTCNADVPCSPTSPLPPVCFSPLKEILKRH
FT                   CFLKSSL"
FT   assembly_gap    27441796..27441914
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    27449638..27449825
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            27458732..>27460107
FT                   /locus_tag="mCG_147421"
FT                   /note="gene_id=mCG147421.0"
FT   mRNA            join(27458732..27458770,27459307..>27460107)
FT                   /locus_tag="mCG_147421"
FT                   /product="mCG147421"
FT                   /note="gene_id=mCG147421.0 transcript_id=mCT187684.0
FT                   created on 13-JAN-2004"
FT   CDS             27459934..>27460107
FT                   /codon_start=1
FT                   /locus_tag="mCG_147421"
FT                   /product="mCG147421"
FT                   /note="gene_id=mCG147421.0 transcript_id=mCT187684.0
FT                   protein_id=mCP109645.0"
FT                   /protein_id="EDL12073.1"
FT                   /translation="MNLHCRTQANIFGFLPITIPLGIRLQVYFYNILCLQKFPHSPLRK
FT                   PSNVLNKSLASIY"
FT   assembly_gap    27463943..27464350
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    27472751..27472770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27483890..27483918
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    27493812..27493831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27498096..27498115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27529300..27529319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27545101..27545120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27548859..27548878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27552624..27552643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27560025..27560044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27566263..27568612
FT                   /estimated_length=2350
FT                   /gap_type="unknown"
FT   assembly_gap    27576169..27576543
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    27578094..27578683
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    27583484..27583504
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    27589871..27589890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27593819..27593911
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    27604376..27604395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27608994..27609025
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    27612464..27612483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27617009..27617028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27623277..27623994
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    27648549..27648568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27655386..27655405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27656488..27656507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27661406..27663973
FT                   /estimated_length=2568
FT                   /gap_type="unknown"
FT   assembly_gap    27696088..27696107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(27722556..27724907)
FT                   /gene="Pdha2"
FT                   /locus_tag="mCG_20336"
FT                   /note="gene_id=mCG20336.1"
FT   mRNA            complement(27722556..27724907)
FT                   /gene="Pdha2"
FT                   /locus_tag="mCG_20336"
FT                   /product="pyruvate dehydrogenase E1 alpha 2"
FT                   /note="gene_id=mCG20336.1 transcript_id=mCT20195.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(27723122..27724297)
FT                   /codon_start=1
FT                   /gene="Pdha2"
FT                   /locus_tag="mCG_20336"
FT                   /product="pyruvate dehydrogenase E1 alpha 2"
FT                   /note="gene_id=mCG20336.1 transcript_id=mCT20195.1
FT                   protein_id=mCP5086.2"
FT                   /protein_id="EDL12072.1"
FT                   /translation="MRKMLTAVLSHVFSGMVQKPALRGLLSSLKFSNDATCDIKKCDLY
FT                   RLEEGPPTSTVLTRAEALKYYRTMQVIRRMELKADQLYKQKFIRGFCHLCDGQEACCVG
FT                   LEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYGKNFYG
FT                   GNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFI
FT                   CENNLYGMGTSNERSAASTDYHKKGFIIPGLRVNGMDILCVREATKFAADHCRSGKGPI
FT                   VMELQTYRYHGHSMSDPGISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEID
FT                   ADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS"
FT   assembly_gap    27758937..27758956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27779825..27780506
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   assembly_gap    27782912..27783156
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    27784204..27784223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27789033..27789322
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    27805804..27806016
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    27852837..27852912
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    27879315..27879334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27891374..27896448
FT                   /estimated_length=5075
FT                   /gap_type="unknown"
FT   assembly_gap    27930425..27930498
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    27936948..27937061
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            complement(27969286..27976645)
FT                   /locus_tag="mCG_147418"
FT                   /note="gene_id=mCG147418.0"
FT   mRNA            complement(join(27969286..27970977,27975918..27976645))
FT                   /locus_tag="mCG_147418"
FT                   /product="mCG147418"
FT                   /note="gene_id=mCG147418.0 transcript_id=mCT187681.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(27970780..27970977,27975918..27975983))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147418"
FT                   /product="mCG147418"
FT                   /note="gene_id=mCG147418.0 transcript_id=mCT187681.0
FT                   protein_id=mCP109642.0"
FT                   /protein_id="EDL12071.1"
FT                   /translation="MLCEPVTYLWWNKNWKSMETPSMLMAVTALGIMSAFPAGRRSGSL
FT                   GCRNHRLILNSFYGNPQPKQLCCLVLTVCPVAPIKAVHTGGE"
FT   gene            27976876..28334578
FT                   /gene="Unc5c"
FT                   /locus_tag="mCG_122205"
FT                   /note="gene_id=mCG122205.1"
FT   mRNA            join(27976876..27977149,28184338..28184559,
FT                   28220958..28221101,28240154..28240257,28264030..28264210,
FT                   28268083..28268250,28270683..28270847,28288533..28288724,
FT                   28289391..28289735,28291471..28291558,28300960..28301128,
FT                   28303401..28303634,28316479..28316628,28317723..28317887,
FT                   28327154..28327332,28328060..28334578)
FT                   /gene="Unc5c"
FT                   /locus_tag="mCG_122205"
FT                   /product="unc-5 homolog C (C. elegans), transcript variant
FT                   mCT123418"
FT                   /note="gene_id=mCG122205.1 transcript_id=mCT123418.1
FT                   created on 20-JUL-2002"
FT   mRNA            join(<27976910..27977149,28184338..28184559,
FT                   28220958..28221101,28240154..28240257,28264030..28264210,
FT                   28268083..28268250,28270683..28270847,28286519..28286575,
FT                   28288533..28288724,28289391..28289735,28291471..28291558,
FT                   28300960..28301128,28303401..28303634,28316479..28316628,
FT                   28317723..28317887,28327154..28327332,28328060..28329045)
FT                   /gene="Unc5c"
FT                   /locus_tag="mCG_122205"
FT                   /product="unc-5 homolog C (C. elegans), transcript variant
FT                   mCT190560"
FT                   /note="gene_id=mCG122205.1 transcript_id=mCT190560.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<27976912..27977149,28184338..28184559,
FT                   28220958..28221101,28240154..28240257,28264030..28264210,
FT                   28268083..28268250,28270683..28270847,28286519..28286575,
FT                   28288533..28288724,28289391..28289735,28291471..28291558,
FT                   28300960..28301128,28303401..28303634,28316479..28316628,
FT                   28317723..28317887,28327154..28327332,28328060..28328225)
FT                   /codon_start=1
FT                   /gene="Unc5c"
FT                   /locus_tag="mCG_122205"
FT                   /product="unc-5 homolog C (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG122205.1 transcript_id=mCT190560.0
FT                   protein_id=mCP111538.0 isoform=CRA_b"
FT                   /protein_id="EDL12069.1"
FT                   /translation="LFLRTAWRWPDPASCLAGLSAVCASPGGVSLPRTPLPTMRKGLRA
FT                   TAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDEFFHELPETFPSDPPEPLPHFLI
FT                   EPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVREVSIE
FT                   ISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEV
FT                   LLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKN
FT                   IVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQ
FT                   SVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKN
FT                   CTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFV
FT                   YRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVS
FT                   DKIPMTNSPILDPLPNLKIKVYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNLKN
FT                   QSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMR
FT                   PPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQLKNQAVQGQWEDVV
FT                   VVGEENFTTPCYIQLDAEACHILTENLSTYALVGQSTTKAAAKRLKLAIFGPLCCSSLE
FT                   YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKS
FT                   KLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCT
FT                   VSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKL
FT                   NLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQY"
FT   CDS             join(27977026..27977149,28184338..28184559,
FT                   28220958..28221101,28240154..28240257,28264030..28264210,
FT                   28268083..28268250,28270683..28270847,28288533..28288724,
FT                   28289391..28289735,28291471..28291558,28300960..28301128,
FT                   28303401..28303634,28316479..28316628,28317723..28317887,
FT                   28327154..28327332,28328060..28328225)
FT                   /codon_start=1
FT                   /gene="Unc5c"
FT                   /locus_tag="mCG_122205"
FT                   /product="unc-5 homolog C (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG122205.1 transcript_id=mCT123418.1
FT                   protein_id=mCP89355.1 isoform=CRA_a"
FT                   /protein_id="EDL12068.1"
FT                   /translation="MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDEF
FT                   FHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKD
FT                   HVVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIA
FT                   YLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDH
FT                   NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQ
FT                   KRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRREC
FT                   TAPAPKNGGKDCDGLVLQSKNCTDGLCMQAAPDSDDVALYVGIVIAVTVCLAITVVVAL
FT                   FVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHD
FT                   VSDKIPMTNSPILDPLPNLKIKVYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNL
FT                   KNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKEN
FT                   MRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQLKNQAVQGQWED
FT                   VVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQSTTKAAAKRLKLAIFGPLCCSS
FT                   LEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLW
FT                   KSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLN
FT                   CTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAH
FT                   KLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ
FT                   Y"
FT   assembly_gap    28008700..28008738
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    28021678..28021795
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    28054382..28054401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28089518..28089540
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    28090927..28091021
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    28101913..28101932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28112250..28112288
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    28127679..28128812
FT                   /estimated_length=1134
FT                   /gap_type="unknown"
FT   assembly_gap    28140552..28140571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28163094..28163113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(28169253..>28189248)
FT                   /locus_tag="mCG_144631"
FT                   /note="gene_id=mCG144631.0"
FT   mRNA            complement(join(28169253..28170282,28189033..28189113,
FT                   28189201..>28189248))
FT                   /locus_tag="mCG_144631"
FT                   /product="mCG144631"
FT                   /note="gene_id=mCG144631.0 transcript_id=mCT184055.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(28170126..28170282,28189033..>28189073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144631"
FT                   /product="mCG144631"
FT                   /note="gene_id=mCG144631.0 transcript_id=mCT184055.0
FT                   protein_id=mCP106169.0"
FT                   /protein_id="EDL12070.1"
FT                   /translation="RIIFLLDHTGTKHRSSCLCSWSCDSTKELTLLMNKNIDCEPLTLH
FT                   HICVDGNNGQPALNVLDKVY"
FT   assembly_gap    28189835..28190069
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    28292865..28292884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(28340022..28383653)
FT                   /gene="Bmpr1b"
FT                   /locus_tag="mCG_122207"
FT                   /note="gene_id=mCG122207.1"
FT   mRNA            complement(join(28340022..28340395,28342552..28342682,
FT                   28344748..28344923,28356396..28356693,28357450..28357642,
FT                   28362993..28363131,28364491..28364587,28370725..28370827,
FT                   28371306..28371408,28383494..28383653))
FT                   /gene="Bmpr1b"
FT                   /locus_tag="mCG_122207"
FT                   /product="bone morphogenetic protein receptor, type 1B"
FT                   /note="gene_id=mCG122207.1 transcript_id=mCT123421.1
FT                   created on 20-JUL-2002"
FT   CDS             complement(join(28340270..28340395,28342552..28342682,
FT                   28344748..28344923,28356396..28356693,28357450..28357642,
FT                   28362993..28363131,28364491..28364587,28370725..28370827,
FT                   28371306..28371408,28383494..28383636))
FT                   /codon_start=1
FT                   /gene="Bmpr1b"
FT                   /locus_tag="mCG_122207"
FT                   /product="bone morphogenetic protein receptor, type 1B"
FT                   /note="gene_id=mCG122207.1 transcript_id=mCT123421.1
FT                   protein_id=mCP89379.1"
FT                   /db_xref="GOA:B2RRZ4"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:107191"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRZ4"
FT                   /protein_id="EDL12067.1"
FT                   /translation="MLLRSSGKLNVGTKKEDGESTAPTPRPKILRCKCHHHCPEDSVNN
FT                   ICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNK
FT                   DLHPTLPPLKDRDFVDGPIHHKALLISVTVCSLLLVLIILFCYFRYKRQEARPRYSIGL
FT                   EQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGK
FT                   WRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDY
FT                   HENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILV
FT                   KKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMAD
FT                   MYSFGLILWEIARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCMKKLRPSFPNRWS
FT                   SDECLRQMGKLMTECWAQNPASRLTALRVKKTLAKMSESQDIKL"
FT   assembly_gap    28354065..28354460
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    28378707..28378726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28380079..28380098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28381889..28381908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28383028..28383047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28389182..28389201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28391850..28391869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28397021..28400306
FT                   /estimated_length=3286
FT                   /gap_type="unknown"
FT   assembly_gap    28402970..28403004
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    28414706..28414725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28439898..28439917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28447440..28447972
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    28498602..28498629
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    28512681..28513238
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    28515213..28515377
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    28521035..28521230
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    28591904..28591973
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    28607410..28607429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28620018..28620037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28637589..28637649
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    28650615..28650688
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   gene            complement(28686658..28687578)
FT                   /pseudo
FT                   /locus_tag="mCG_21123"
FT                   /note="gene_id=mCG21123.1"
FT   mRNA            complement(28686658..28687578)
FT                   /pseudo
FT                   /locus_tag="mCG_21123"
FT                   /note="gene_id=mCG21123.1 transcript_id=mCT19932.1 created
FT                   on 09-SEP-2002"
FT   assembly_gap    28695213..28697201
FT                   /estimated_length=1989
FT                   /gap_type="unknown"
FT   assembly_gap    28701823..28701842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28731439..28731468
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(28746265..28906634)
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /note="gene_id=mCG21120.3"
FT   mRNA            complement(join(28746265..28749443,28751572..28751687,
FT                   28753971..28754091,28756006..28756186,28765825..28765987,
FT                   28784510..28784694,28812640..28812676,28812994..28813166,
FT                   28820812..28820903,28823093..28823135,28863806..28863957,
FT                   28902617..28902754,28906552..28906634))
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, transcript variant
FT                   mCT178128"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT178128.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(28746265..28749443,28751572..28751687,
FT                   28753971..28754091,28756006..28756186,28765825..28765987,
FT                   28784510..28784694,28812640..28812676,28812994..28813166,
FT                   28820812..28821230,28823093..28823135,28863806..28863957,
FT                   28902617..28902754,28906552..28906634))
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, transcript variant
FT                   mCT123446"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT123446.2 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(28749354..28749443,28751572..28751687,
FT                   28753971..28754091,28756006..28756186,28765825..28765987,
FT                   28784510..28784694,28812640..28812676,28812994..28813166,
FT                   28820812..28820903,28823093..28823135,28863806..28863957,
FT                   28902617..28902712))
FT                   /codon_start=1
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, isoform CRA_c"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT178128.0
FT                   protein_id=mCP101050.0 isoform=CRA_c"
FT                   /protein_id="EDL12065.1"
FT                   /translation="MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVR
FT                   IGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKPTVTSVC
FT                   SESAQELAEGQRRGSQGDIKQQNGPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWR
FT                   PRTGTTQSRSFRILAQITGTEHLTESENDNTKKANSTQEPSQQPASSGASPLSASEGPE
FT                   SPGSSRPAVAGLRSAAAFKPVGSTSVKSPSWQRPNQAAPSTGRISNNARSSGTGASVGP
FT                   PQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMA
FT                   YIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIR
FT                   NNVFHLEDGEPYCETDYYALFGTICRGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCES
FT                   LEGQTFFSKKDKPLCKKHAHSVNF"
FT   CDS             complement(join(28749354..28749443,28751572..28751687,
FT                   28753971..28754091,28756006..28756186,28765825..28765987,
FT                   28784510..28784694,28812640..28812676,28812994..28813166,
FT                   28820812..28821230,28823093..28823135,28863806..28863957,
FT                   28902617..28902712))
FT                   /codon_start=1
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, isoform CRA_b"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT123446.2
FT                   protein_id=mCP89697.1 isoform=CRA_b"
FT                   /protein_id="EDL12064.1"
FT                   /translation="MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVR
FT                   IGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGEPKEVV
FT                   KPVPITSPAVSKVTSTTNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHAATSSHASP
FT                   TPVAAATPLHLSASGLHVSANLSADQCSSPPNTGKPAVNVPRQPTVTSVCSESAQELAE
FT                   GQRRGSQGDIKQQNGPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSR
FT                   SFRILAQITGTEHLTESENDNTKKANSTQEPSQQPASSGASPLSASEGPESPGSSRPAV
FT                   AGLRSAAAFKPVGSTSVKSPSWQRPNQAAPSTGRISNNARSSGTGASVGPPQPSDQDTL
FT                   VQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKG
FT                   ALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDG
FT                   EPYCETDYYALFGTICRGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSK
FT                   KDKPLCKKHAHSVNF"
FT   assembly_gap    28792354..28793269
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   assembly_gap    28800636..28800655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28801736..28801755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28803266..28803285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28806536..28806555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(28810998..28812118,28812640..28812676,
FT                   28812994..28813166,28820812..28821230,28823093..28823135,
FT                   28863806..28863957,28902617..28902754,28906552..28906634))
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, transcript variant
FT                   mCT19929"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT19929.3 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(28810998..28812118,28812640..28812676,
FT                   28812994..28813166,28814963..28814995,28820812..28820903,
FT                   28823093..28823135,28863806..28863957,28902617..28902755))
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, transcript variant
FT                   mCT123445"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT123445.1 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(28812025..28812118,28812640..28812676,
FT                   28812994..28813166,28820812..28821230,28823093..28823135,
FT                   28863806..28863957,28902617..28902712))
FT                   /codon_start=1
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, isoform CRA_d"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT19929.3
FT                   protein_id=mCP5088.2 isoform=CRA_d"
FT                   /protein_id="EDL12066.1"
FT                   /translation="MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVR
FT                   IGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGEPKEVV
FT                   KPVPITSPAVSKVTSTTNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHAATSSHASP
FT                   TPVAAATPLHLSASGLHVSANLSADQCSSPPNTGKPAVNVPRQPTVTSVCSESAQELAE
FT                   GQRRGSQGDIKQQNGPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSR
FT                   SFRILAQITGTEHLTESENDNTKKAKEKIPLHVFSPKYTKLRDWHHEVSARALNVQ"
FT   CDS             complement(join(28814977..28814995,28820812..28820903,
FT                   28823093..28823135,28863806..28863957,28902617..28902712))
FT                   /codon_start=1
FT                   /gene="Pdlim5"
FT                   /locus_tag="mCG_21120"
FT                   /product="PDZ and LIM domain 5, isoform CRA_a"
FT                   /note="gene_id=mCG21120.3 transcript_id=mCT123445.1
FT                   protein_id=mCP89435.1 isoform=CRA_a"
FT                   /protein_id="EDL12063.1"
FT                   /translation="MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVR
FT                   IGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKPTVTSVC
FT                   SESAQELAEGQRRGSQGDIKQQNGNPGTV"
FT   assembly_gap    28837748..28837767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28881663..28881682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28897022..28897154
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    28901926..28901945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28904031..28904206
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    28923657..28923924
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    28978462..28978595
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    28995785..28996262
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            <29006866..29031985
FT                   /locus_tag="mCG_145180"
FT                   /note="gene_id=mCG145180.0"
FT   mRNA            join(<29006866..29006927,29010484..29010677,
FT                   29011193..29011320,29012947..29013056,29013654..29013853,
FT                   29014183..29014425,29015313..29015593,29016628..29016840,
FT                   29017613..29017715,29017838..29018019,29027793..29028732,
FT                   29030717..29031824,29031902..29031985)
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, transcript variant mCT184604"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT184604.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<29006866..29006927,29010484..29010677,
FT                   29011193..29011320,29012947..29013056,29013654..29013853,
FT                   29014183..29014425,29015313..29015593,29016628..29016840,
FT                   29017613..29017715,29017838..29018019,29027793..29028317)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, isoform CRA_a"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT184604.0
FT                   protein_id=mCP106178.0 isoform=CRA_a"
FT                   /protein_id="EDL12060.1"
FT                   /translation="RVPFEAVFLLAPAPALQFFLRDMAPEIHMPEPLCLIGSTEGHLVT
FT                   NQEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKEKGFSVGSTVQSHTKGIWMWC
FT                   VPHPQKPDHTLVLLDTEGLGDVEKDDKKNDTQIFALAILLSSTFVYNTMNKIDQGAIDL
FT                   LHNVTELTDLLRTRNSSDSNQTEGEGPADMSFFPDLVWTLRDFFLDLQANGHAITSDEY
FT                   LENSLKLKQGSDERTQTFNLPRLCIQKFFPVKKCFVFDAPALGSKLSQLPTLSNEELNS
FT                   DFVQDLSEFCSHIFTQSKTKTLPGGIQVNGPRLESLVLTYVDAINSGALPSIENTVVTL
FT                   ARRENSAAVQKAIGHYDQLMSEKVQLPTETLQELLDLHRTCEREAIEIFRKHSFKDEGE
FT                   FFQKELESLLSAKQDEICKKNADASAALCSTLLGSIFKPLEQEVAQEFYHKPGGHKLFL
FT                   QRMEQLKANYRQQPGKGTQAEEVLQTYLNAKETVSRTILQTDQVLTDKEIQSKAEQERA
FT                   EAARLEAQRLEAIRIQEEQRKAEMERQHQEQLRQIALEKARVAQEQQWILKQRAQGRCP
FT                   VIWCLDLLLAEDEGPKQDLSQKLCCFGQEGGRLSGAEDGAASEALWISPFPETAGLCIP
FT                   HCHPSNLPSVESRSQGGSRRGLRHKPLRPGGPLCTHQEGARLSGAEDGTASEALWLSPV
FT                   LETVGLFIPHPHPCSLPSTDSRSEGGSRRGLRQKPLGLVDPCALTRKVAGCL"
FT   mRNA            join(<29006874..29006927,29010484..29010677,
FT                   29013752..29013853,29014183..29014425,29015313..29015593,
FT                   29016628..29016840,29017613..29017715,29017838..29018019,
FT                   29027793..29028732,29030717..29031708)
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, transcript variant mCT190558"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT190558.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<29006875..29006927,29010484..29010677,
FT                   29013752..29013853,29014183..29014425,29015313..29015593,
FT                   29016628..29016840,29017613..29017715,29017838..29018019,
FT                   29027793..29028317)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, isoform CRA_c"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT190558.0
FT                   protein_id=mCP111546.0 isoform=CRA_c"
FT                   /protein_id="EDL12062.1"
FT                   /translation="FEAVFLLAPAPALQFFLRDMAPEIHMPEPLCLIGSTEGHLVTNQE
FT                   ALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKEKDLVWTLRDFFLDLQANGHAITS
FT                   DEYLENSLKLKQGSDERTQTFNLPRLCIQKFFPVKKCFVFDAPALGSKLSQLPTLSNEE
FT                   LNSDFVQDLSEFCSHIFTQSKTKTLPGGIQVNGPRLESLVLTYVDAINSGALPSIENTV
FT                   VTLARRENSAAVQKAIGHYDQLMSEKVQLPTETLQELLDLHRTCEREAIEIFRKHSFKD
FT                   EGEFFQKELESLLSAKQDEICKKNADASAALCSTLLGSIFKPLEQEVAQEFYHKPGGHK
FT                   LFLQRMEQLKANYRQQPGKGTQAEEVLQTYLNAKETVSRTILQTDQVLTDKEIQSKAEQ
FT                   ERAEAARLEAQRLEAIRIQEEQRKAEMERQHQEQLRQIALEKARVAQEQQWILKQRAQG
FT                   RCPVIWCLDLLLAEDEGPKQDLSQKLCCFGQEGGRLSGAEDGAASEALWISPFPETAGL
FT                   CIPHCHPSNLPSVESRSQGGSRRGLRHKPLRPGGPLCTHQEGARLSGAEDGTASEALWL
FT                   SPVLETVGLFIPHPHPCSLPSTDSRSEGGSRRGLRQKPLGLVDPCALTRKVAGCL"
FT   mRNA            join(<29006884..29006927,29010484..29010677,
FT                   29011193..29011320,29012947..29013056,29013654..29013853,
FT                   29014183..29014425,29015313..29015593,29016628..29016840,
FT                   29017613..29017715,29017838..29018019,29030717..29031576)
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, transcript variant mCT190557"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT190557.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<29006884..29006927,29010484..29010677,
FT                   29011193..29011320,29012947..29013056,29013654..29013853,
FT                   29014183..29014425,29015313..29015593,29016628..29016840,
FT                   29017613..29017715,29017838..29018019,29030717..29030839)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145180"
FT                   /product="mCG145180, isoform CRA_b"
FT                   /note="gene_id=mCG145180.0 transcript_id=mCT190557.0
FT                   protein_id=mCP111545.0 isoform=CRA_b"
FT                   /protein_id="EDL12061.1"
FT                   /translation="VFLLAPAPALQFFLRDMAPEIHMPEPLCLIGSTEGHLVTNQEALK
FT                   ILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKEKGFSVGSTVQSHTKGIWMWCVPHPQK
FT                   PDHTLVLLDTEGLGDVEKDDKKNDTQIFALAILLSSTFVYNTMNKIDQGAIDLLHNVTE
FT                   LTDLLRTRNSSDSNQTEGEGPADMSFFPDLVWTLRDFFLDLQANGHAITSDEYLENSLK
FT                   LKQGSDERTQTFNLPRLCIQKFFPVKKCFVFDAPALGSKLSQLPTLSNEELNSDFVQDL
FT                   SEFCSHIFTQSKTKTLPGGIQVNGPRLESLVLTYVDAINSGALPSIENTVVTLARRENS
FT                   AAVQKAIGHYDQLMSEKVQLPTETLQELLDLHRTCEREAIEIFRKHSFKDEGEFFQKEL
FT                   ESLLSAKQDEICKKNADASAALCSTLLGSIFKPLEQEVAQEFYHKPGGHKLFLQRMEQL
FT                   KANYRQQPGKGTQAEEVLQTYLNAKETVSRTILQTDQVLTDKEIQSKAEQERAEAARLE
FT                   AQRLEAIRIQEEQRKAEMERQHQEQLRQIALEKARVAQEQQWILKQRAQEEADRIKAEQ
FT                   EAQLRALQQQLQHMREMNHHRRHHHDCVIS"
FT   assembly_gap    29020706..29020725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29022348..29022688
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    29023679..29025327
FT                   /estimated_length=1649
FT                   /gap_type="unknown"
FT   gene            29039966..29056555
FT                   /locus_tag="mCG_141961"
FT                   /note="gene_id=mCG141961.0"
FT   mRNA            join(29039966..29040064,29041476..29041629,
FT                   29044125..29044338,29045923..29046050,29047638..29047747,
FT                   29048348..29048544,29050886..29051131,29052379..29052659,
FT                   29053452..29053664,29054955..29055057,29055367..29055560,
FT                   29055825..29056555)
FT                   /locus_tag="mCG_141961"
FT                   /product="mCG141961, transcript variant mCT178113"
FT                   /note="gene_id=mCG141961.0 transcript_id=mCT178113.0
FT                   created on 03-JAN-2003"
FT   mRNA            join(29039966..29040064,29044125..29044338,
FT                   29045923..29046050,29047638..29047747,29048348..29048544,
FT                   29050886..29051131,29052379..29052659,29053452..29053664,
FT                   29054955..29055057,29055367..29055560,29055825..29056555)
FT                   /locus_tag="mCG_141961"
FT                   /product="mCG141961, transcript variant mCT178112"
FT                   /note="gene_id=mCG141961.0 transcript_id=mCT178112.0
FT                   created on 03-JAN-2003"
FT   mRNA            join(29039966..29040064,29044143..29044338,
FT                   29045923..29046050,29047638..29047747,29048348..29048544,
FT                   29050886..29051131,29052379..29052659,29053452..29053664,
FT                   29054955..29055057,29055367..29055560,29055825..29056555)
FT                   /locus_tag="mCG_141961"
FT                   /product="mCG141961, transcript variant mCT178111"
FT                   /note="gene_id=mCG141961.0 transcript_id=mCT178111.0
FT                   created on 03-JAN-2003"
FT   CDS             join(29044149..29044338,29045923..29046050,
FT                   29047638..29047747,29048348..29048544,29050886..29051131,
FT                   29052379..29052659,29053452..29053664,29054955..29055057,
FT                   29055367..29055560,29055825..29056079)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141961"
FT                   /product="mCG141961, isoform CRA_a"
FT                   /note="gene_id=mCG141961.0 transcript_id=mCT178111.0
FT                   protein_id=mCP101034.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91Z40"
FT                   /db_xref="InterPro:IPR003191"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2444421"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Z40"
FT                   /protein_id="EDL12057.1"
FT                   /translation="MASGPNMEAPVCLVENENEELRVNSKAINILERITQPVVVVAIVG
FT                   LYRTGKSYLMNRLAGQNHGFNLGTTVRSETKGIWMWCVPHPSKPK