Dbfetch

ID   CH466530; SV 1; linear; genomic DNA; CON; MUS; 48261665 BP.
XX
AC   CH466530;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009823021 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-48261665
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-48261665
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 97df9a256b3452efeda5264901511b2c.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000211.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001865; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008393; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019528; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025766; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027564; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027615; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027665; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027671; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027673; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027684; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027695; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027699; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027737; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027739; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027744; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027748; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027752; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027763; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027765; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027801; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027823; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036353; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036381; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036503; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036894; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037174; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037225; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037400; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039221; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042997; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043850; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051136; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058400; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059834; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060913; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063273; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069041; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074604; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074637; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090527; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090919; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022497; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027086; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027087; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027091; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027095; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027097; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027098; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027099; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027100; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027101; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027102; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027108; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027109; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027110; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027111; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027118; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027120; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027136; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027138; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027141; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027145; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027146; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027147; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027149; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027150; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027156; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027157; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027159; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027161; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027163; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027167; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027170; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027173; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027177; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027180; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027182; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027187; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027188; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027190; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027192; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027193; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027195; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027202; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027205; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027214; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027220; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027223; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027228; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027230; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027232; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027234; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027240; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027243; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027246; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027248; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027254; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027255; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027256; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027259; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027265; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027266; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022459; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027047; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027048; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027055; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027057; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027058; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027059; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027060; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027061; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027068; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027069; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027070; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027071; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027078; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027080; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027083; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027096; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027098; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027101; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027103; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027104; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027105; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027106; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027107; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027110; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027116; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027117; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027121; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027123; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027127; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027130; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027133; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027137; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027138; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027140; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027144; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027147; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027148; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027150; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027152; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027153; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027154; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027155; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027162; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027165; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027180; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027183; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027188; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027192; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027194; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027199; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027200; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027203; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027206; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027208; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027214; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027215; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027219; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027225; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022435; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027016; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027017; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027024; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027026; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027029; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027030; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027037; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027038; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027047; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027049; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027065; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027067; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027070; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027072; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027073; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027074; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027076; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027079; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027086; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027088; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027090; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027092; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027096; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027099; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027102; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027107; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027109; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027111; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027113; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027116; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027117; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027119; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027121; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027122; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027123; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027124; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027131; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027134; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027144; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027153; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027158; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027160; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027162; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027164; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027169; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027170; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027173; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027178; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027184; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027185; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027186; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027189; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027195; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027196; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022463; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027060; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027063; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027067; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027069; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027070; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027071; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027072; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027080; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027081; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027082; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027090; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027092; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027095; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027108; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027113; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027115; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027116; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027117; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027118; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027121; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027122; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027128; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027129; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027131; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027135; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027139; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027142; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027145; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027149; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027150; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027152; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027159; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027160; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027162; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027164; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027165; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027166; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027174; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027177; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027187; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027193; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027196; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027203; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027207; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027212; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027213; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027216; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027219; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027221; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027227; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027228; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027229; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027238; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027239; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026799; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026800; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026804; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026811; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026814; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026821; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026822; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026823; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026824; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026834; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026837; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026851; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026853; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026856; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026858; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026859; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026860; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026864; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026865; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026871; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026872; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026874; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026876; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026878; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026882; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026885; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026888; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026892; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026893; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026895; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026897; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026899; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026902; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026903; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026905; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026907; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026908; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026909; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026917; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026920; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026930; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026936; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026939; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026944; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026946; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026948; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026950; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026955; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026956; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026959; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026962; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026964; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026970; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026971; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026972; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026975; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026981; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026982; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022912; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027503; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027504; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027508; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027512; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027515; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027516; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027517; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027518; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027525; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027528; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027535; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027538; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027541; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027554; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027556; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027561; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027562; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027563; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027564; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027565; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027567; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027568; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027574; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027575; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027577; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027579; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027581; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027585; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027588; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027591; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027595; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027596; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027600; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027602; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027605; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027606; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027608; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027610; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027611; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027612; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027613; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027620; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027623; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027633; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027639; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027642; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027647; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027649; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027651; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027653; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027658; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027659; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027662; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027665; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027673; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027674; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027675; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027678; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027684; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027685; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015409; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021757; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026255; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026256; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026265; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026267; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026269; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026270; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026276; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026277; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026278; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026279; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026282; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026286; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026288; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026304; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026309; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026311; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026312; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026313; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026314; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026315; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026317; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026318; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026325; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026329; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026331; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026335; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026338; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026341; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026345; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026346; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026348; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026352; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026360; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026361; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026362; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026363; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026370; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026373; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026382; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026388; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026391; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026398; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026402; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026407; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026408; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026411; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026414; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026416; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026422; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026423; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026424; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026427; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026433; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022199; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026777; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026782; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026789; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026791; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026792; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026800; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026802; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026810; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026812; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026828; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026833; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026835; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026836; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026837; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026838; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026839; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026841; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026849; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026851; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026853; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026855; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026859; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026862; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026865; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026870; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026872; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026874; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026876; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026879; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026880; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026884; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026885; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026886; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026887; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026894; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026897; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026906; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026912; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026915; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026920; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026922; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026924; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026926; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026931; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026932; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026935; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026938; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026940; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026946; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026947; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026948; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026951; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026957; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026958; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022330; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026911; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026912; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026916; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026920; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026922; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026923; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026924; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026925; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026926; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026934; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026935; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026944; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026946; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026949; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026962; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026964; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026967; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026969; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026970; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026971; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026972; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026973; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026975; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026976; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026982; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026985; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026989; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026993; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026996; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026999; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027003; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027004; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027006; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027010; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027013; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027014; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027016; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027018; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027019; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027020; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027021; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027028; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027031; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027049; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027054; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027056; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027058; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027060; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027065; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027066; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027069; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027072; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027074; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027080; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027081; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027082; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027085; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027091; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027092; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026880; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026881; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026884; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026890; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026891; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026892; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026893; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026894; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026901; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026902; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026904; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026917; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026932; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026937; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026938; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026939; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026941; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026943; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026950; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026951; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026953; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026961; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026964; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026967; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026971; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026972; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026974; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026976; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026978; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026981; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026982; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026984; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026986; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026987; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026988; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026989; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026996; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026999; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027014; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027017; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027022; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027024; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027026; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027028; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027033; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027034; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027037; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027040; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027042; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027048; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027049; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027053; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027059; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027060; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022398; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027023; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027024; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027028; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027034; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027035; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027036; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027037; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027045; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027046; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027048; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027057; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027060; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027074; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027076; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027079; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027081; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027082; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027084; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027087; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027088; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027094; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027095; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027097; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027101; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027105; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027111; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027115; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027116; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027122; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027125; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027126; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027128; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027130; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027131; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027132; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027133; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027140; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027143; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027158; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027161; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027166; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027168; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027170; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027172; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027177; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027178; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027181; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027184; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027186; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027191; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027193; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027196; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027202; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027203; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026900; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026901; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026909; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026911; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026912; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026913; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026914; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026915; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026916; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026922; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026924; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026925; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026950; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026952; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026955; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026957; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026958; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026959; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026961; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026963; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026964; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026970; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026971; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026973; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026975; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026977; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026983; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026986; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026990; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026991; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026993; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026999; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027000; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027002; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027004; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027005; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027006; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027007; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027014; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027017; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027026; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027032; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027035; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027040; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027042; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027044; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027046; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027051; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027052; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027055; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027058; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027065; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027066; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027070; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027076; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027077; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022925; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027562; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027567; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027571; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027574; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027575; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027577; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027578; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027585; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027586; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027587; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027595; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027597; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027600; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027613; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027615; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027618; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027620; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027621; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027622; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027623; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027624; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027626; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027627; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027633; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027634; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027636; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027638; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027640; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027644; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027647; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027650; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027654; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027655; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027657; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027661; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027664; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027665; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027667; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027669; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027670; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027671; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027672; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027679; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027682; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027691; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027697; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027700; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027705; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027707; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027716; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027717; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027720; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027723; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027725; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027731; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027732; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027733; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027742; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021497; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025988; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025989; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025992; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025996; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025998; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026000; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026001; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026009; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026019; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026021; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026024; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026037; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026039; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026042; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026045; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026046; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026048; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026050; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026051; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026057; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026058; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026062; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026064; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026068; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026071; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026074; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026078; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026079; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026081; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026084; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026087; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026088; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026090; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026092; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026093; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026094; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026095; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026102; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026105; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026114; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026120; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026128; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026130; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026132; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026139; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026140; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026143; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026146; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026148; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026154; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026155; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026156; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026159; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026165; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021805; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026328; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026329; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026333; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026336; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026338; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026339; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026340; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026341; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026342; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026343; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026349; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026350; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026351; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026352; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026360; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026362; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026365; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026378; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026380; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026383; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026385; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026386; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026387; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026389; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026391; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026392; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026398; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026399; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026403; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026405; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026409; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026412; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026415; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026420; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026422; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026424; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026429; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026430; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026432; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026434; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026435; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026437; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026444; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026447; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026456; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026462; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026465; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026470; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026472; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026474; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026476; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026481; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026482; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026485; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026488; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026490; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026496; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026497; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026498; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026501; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026507; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026509; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008537; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000012580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029336; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038569; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051408; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108046; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108210; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143005; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167780; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203472; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0043083; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060130; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060131; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060135; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060158; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060161; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060177; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060188; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060194; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060198; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060200; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060227; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060245; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060247; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060300; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060324; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060378; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060381; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060408; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060419; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060425; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060428; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060440; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060452; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060467; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060520; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060529; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060540; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060574; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060584; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060620; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060623; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060632; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060648; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060657; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060687; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060695; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060714; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060728; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060730; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060743; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060779; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060790; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060838; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060865; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060880; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060913; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060916; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060923; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060938; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060954; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060956; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060966; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060979; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060989; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0060998; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061019; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061022; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061030; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061063; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061064; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0043049; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060146; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060147; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060150; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060173; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060176; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060192; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060203; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060209; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060213; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060242; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060255; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060260; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060262; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060340; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060397; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060441; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060457; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060469; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060489; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060529; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060532; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060537; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060546; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060557; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060591; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060601; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060627; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060637; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060640; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060649; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060676; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060706; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060714; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060733; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060742; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060747; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060750; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060763; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060797; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060808; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060856; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060883; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060898; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060931; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060941; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060956; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060972; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060974; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060984; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0060997; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061007; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061016; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061037; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061048; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061081; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061083; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0043021; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060080; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060081; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060084; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060107; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060110; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060126; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060137; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060147; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060177; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060190; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060195; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060197; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060250; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060274; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060329; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060332; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060359; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060370; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060376; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060404; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060419; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060424; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060464; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060467; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060473; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060482; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060493; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060527; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060537; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060563; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060576; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060585; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060601; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060610; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060640; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060648; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060667; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060676; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060681; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060683; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060730; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060741; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060817; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060865; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060868; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060875; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060907; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060909; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060919; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060932; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060942; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060951; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060972; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060975; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0060983; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061016; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061018; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0043035; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060079; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060080; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060083; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060106; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060109; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060125; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060136; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060142; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060146; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060176; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060189; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060194; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060196; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060233; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060249; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060273; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060328; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060358; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060375; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060379; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060391; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060403; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060418; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060423; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060470; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060479; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060490; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060524; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060557; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060567; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060579; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060602; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060632; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060640; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060659; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060668; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060673; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060675; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060688; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060722; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060733; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060809; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060824; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060857; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060860; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060867; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060882; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060898; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060900; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060910; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060923; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060933; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060942; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060967; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0060975; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061008; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061009; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059763; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059764; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059768; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059792; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059795; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059811; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059828; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059832; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059874; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059879; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059881; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059918; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059935; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060015; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060018; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060045; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060056; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060062; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060089; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060109; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060148; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060151; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060156; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060165; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060210; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060220; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060256; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060259; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060268; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060283; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060294; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060323; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060331; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060350; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060359; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060366; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060379; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060426; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060475; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060502; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060550; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060553; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060560; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060575; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060591; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060593; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060603; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060616; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060626; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060635; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060656; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060659; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060667; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060700; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060701; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060552; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060553; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060557; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060580; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060583; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060599; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060610; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060616; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060620; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060649; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060662; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060667; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060669; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060705; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060723; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060747; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060805; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060843; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060849; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060865; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060877; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060892; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060897; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060945; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060965; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061042; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061068; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061080; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061110; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061118; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061138; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061147; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061152; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061154; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061167; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061201; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061212; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061261; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061288; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061303; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061336; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061339; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061346; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061377; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061379; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061389; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061402; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061412; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061421; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061442; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061445; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061486; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061487; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019284; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042877; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060063; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060064; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060067; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060090; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060093; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060121; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060127; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060131; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060133; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060159; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060178; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060180; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060186; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060219; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060237; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060261; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060314; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060317; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060344; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060361; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060365; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060377; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060389; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060447; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060465; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060510; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060518; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060546; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060556; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060559; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060568; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060591; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060630; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060649; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060658; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060663; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060664; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060712; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060724; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060800; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060815; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060848; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060852; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060859; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060874; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060890; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060892; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060902; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060915; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060925; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060934; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060955; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060958; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0060967; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061001; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042688; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059740; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059741; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059745; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059769; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059772; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059788; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059805; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059809; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059839; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059852; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059857; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059859; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059896; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059936; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059991; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059994; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060021; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060032; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060042; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060054; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060081; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060086; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060124; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060141; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060152; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060185; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060195; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060231; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060243; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060261; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060300; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060308; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060327; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060336; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060341; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060343; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060356; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060392; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060494; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060527; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060530; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060537; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060552; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060569; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060571; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060581; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060594; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060604; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060613; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060634; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060637; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060645; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060678; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060679; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042844; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059838; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059839; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059843; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059866; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059869; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059885; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059902; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059906; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059936; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059954; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059956; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059994; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060011; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060035; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060090; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060093; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060120; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060131; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060141; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060153; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060166; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060181; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060186; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060228; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060254; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060288; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060298; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060320; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060330; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060333; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060366; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060396; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060404; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060423; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060432; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060437; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060439; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060452; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060486; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060497; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060545; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060572; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060618; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060628; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060643; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060660; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060662; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060672; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060685; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060695; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060704; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060725; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060728; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060736; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060770; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059829; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059830; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059833; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059856; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059859; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059875; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059886; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059892; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059896; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059926; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059939; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059946; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059996; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060020; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060074; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060077; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060104; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060115; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060121; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060149; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060164; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060169; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060213; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060219; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060228; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060239; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060281; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060316; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060328; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060346; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060355; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060384; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060392; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060411; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060420; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060425; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060427; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060440; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060476; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060535; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060562; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060610; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060613; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060620; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060651; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060653; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060663; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060676; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060686; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060695; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060716; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060719; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060727; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060760; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060761; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042911; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059983; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059984; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059988; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060011; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060014; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060030; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060041; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060048; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060052; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060081; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060094; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060099; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060101; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060155; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060179; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060234; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060237; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060264; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060275; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060281; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060307; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060327; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060368; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060371; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060377; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060386; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060397; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060439; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060465; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060475; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060478; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060487; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060548; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060575; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060584; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060589; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060591; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060604; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060640; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060651; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060699; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060726; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060741; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060774; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060777; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060783; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060798; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060815; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060817; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060839; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060849; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060857; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060878; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060881; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060889; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060922; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060923; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042782; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059808; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059809; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059813; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059836; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059839; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059855; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059866; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059872; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059876; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059878; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059905; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059918; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059923; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059925; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059974; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060052; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060055; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060082; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060093; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060099; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060103; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060140; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060145; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060182; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060199; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060210; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060244; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060254; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060280; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060293; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060302; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060325; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060355; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060363; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060382; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060391; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060396; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060399; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060412; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060446; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060457; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060504; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060531; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060546; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060579; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060582; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060589; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060604; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060619; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060621; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060631; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060644; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060654; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060662; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060683; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060686; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060694; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060728; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060730; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043561; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060732; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060735; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060739; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060762; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060766; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060782; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060799; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060803; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060832; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060845; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060850; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060852; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060889; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060907; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060931; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060985; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060988; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061015; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061026; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061032; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061036; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061048; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061060; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061075; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061080; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061120; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061123; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061129; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061149; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061183; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061193; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061229; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061232; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061268; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061298; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061306; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061325; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061334; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061340; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061343; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061356; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061401; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061449; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061476; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061491; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061524; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061527; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061534; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061549; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061567; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061576; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061589; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061599; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061608; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061629; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061632; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061640; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061673; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042462; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059623; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059624; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059627; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059649; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059652; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059680; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059686; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059690; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059717; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059730; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059735; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059737; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059775; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059793; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059818; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059867; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059872; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059910; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059920; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059932; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059944; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059959; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060003; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060032; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060066; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060074; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060099; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060109; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060112; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060121; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060145; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060175; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060183; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060200; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060209; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060214; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060216; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060229; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060264; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060276; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060325; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060352; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060367; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060399; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060403; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060410; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060425; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060442; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060444; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060454; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060487; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060510; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060522; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060555; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0042161; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059034; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059035; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059039; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059061; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059064; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059080; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059091; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059097; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059101; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059103; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059130; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059143; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059148; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059150; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059188; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059206; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059230; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059288; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059293; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059320; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059331; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059337; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059341; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059365; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059380; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059385; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059426; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059429; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059443; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059499; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059527; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059537; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059540; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059566; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059575; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059604; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059612; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059631; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059640; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059645; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059647; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059660; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059707; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059755; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059797; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059830; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059840; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059855; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059872; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059874; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059896; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059906; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059915; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059939; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059947; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059980; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059982; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..48261665
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<1297..1468)
FT                   /locus_tag="mCG_1050343"
FT                   /note="gene_id=mCG1050343.0"
FT   mRNA            complement(<1297..1468)
FT                   /locus_tag="mCG_1050343"
FT                   /product="mCG1050343"
FT                   /note="gene_id=mCG1050343.0 transcript_id=mCT194348.0
FT                   created on 26-APR-2004"
FT   CDS             complement(<1297..1369)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050343"
FT                   /product="mCG1050343"
FT                   /note="gene_id=mCG1050343.0 transcript_id=mCT194348.0
FT                   protein_id=mCP115377.0"
FT                   /protein_id="EDL34856.1"
FT                   /translation="MLLLDAWTHIPHCVLLLILLLGLK"
FT   assembly_gap    3998..4108
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    5636..5655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8896..9177
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    11646..11954
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    13896..14840
FT                   /estimated_length=945
FT                   /gap_type="unknown"
FT   assembly_gap    18381..31154
FT                   /estimated_length=12774
FT                   /gap_type="unknown"
FT   assembly_gap    33658..33677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35507..35526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37797..37816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(38597..39168)
FT                   /pseudo
FT                   /locus_tag="mCG_1049454"
FT                   /note="gene_id=mCG1049454.0"
FT   mRNA            complement(38597..39168)
FT                   /pseudo
FT                   /locus_tag="mCG_1049454"
FT                   /note="gene_id=mCG1049454.0 transcript_id=mCT167158.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    39169..39188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    59508..59655
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    74446..74465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    75588..77412
FT                   /estimated_length=1825
FT                   /gap_type="unknown"
FT   gene            complement(85463..86453)
FT                   /pseudo
FT                   /locus_tag="mCG_1049455"
FT                   /note="gene_id=mCG1049455.1"
FT   mRNA            complement(85463..86453)
FT                   /pseudo
FT                   /locus_tag="mCG_1049455"
FT                   /note="gene_id=mCG1049455.1 transcript_id=mCT167159.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    87239..87429
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    94138..94875
FT                   /estimated_length=738
FT                   /gap_type="unknown"
FT   assembly_gap    97235..98094
FT                   /estimated_length=860
FT                   /gap_type="unknown"
FT   assembly_gap    108808..108832
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    111141..111160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    116373..116392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    117724..123213
FT                   /estimated_length=5490
FT                   /gap_type="unknown"
FT   assembly_gap    124965..124984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    132847..135252
FT                   /estimated_length=2406
FT                   /gap_type="unknown"
FT   gene            complement(137281..137647)
FT                   /pseudo
FT                   /locus_tag="mCG_60174"
FT                   /note="gene_id=mCG60174.2"
FT   mRNA            complement(137281..137647)
FT                   /pseudo
FT                   /locus_tag="mCG_60174"
FT                   /note="gene_id=mCG60174.2 transcript_id=mCT60357.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    149386..149405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    150425..150444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    180497..181250
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    183776..183795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    190762..190829
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    210009..210028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    215028..215047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    220691..220710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    236360..238527
FT                   /estimated_length=2168
FT                   /gap_type="unknown"
FT   assembly_gap    239923..240725
FT                   /estimated_length=803
FT                   /gap_type="unknown"
FT   assembly_gap    241888..243003
FT                   /estimated_length=1116
FT                   /gap_type="unknown"
FT   assembly_gap    252823..252842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    277882..277901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    287253..287272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    299470..299489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    318095..318114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            329620..362529
FT                   /gene="Ythdf3"
FT                   /locus_tag="mCG_11214"
FT                   /note="gene_id=mCG11214.2"
FT   mRNA            join(329620..329862,330264..330288,333309..333457,
FT                   335818..335903,350174..351772,360366..362529)
FT                   /gene="Ythdf3"
FT                   /locus_tag="mCG_11214"
FT                   /product="YTH domain family 3, transcript variant mCT11194"
FT                   /note="gene_id=mCG11214.2 transcript_id=mCT11194.2 created
FT                   on 16-AUG-2002"
FT   mRNA            join(329620..329862,330264..330288,335818..335903,
FT                   350174..351772,360366..362428)
FT                   /gene="Ythdf3"
FT                   /locus_tag="mCG_11214"
FT                   /product="YTH domain family 3, transcript variant
FT                   mCT171820"
FT                   /note="gene_id=mCG11214.2 transcript_id=mCT171820.0 created
FT                   on 16-AUG-2002"
FT   CDS             join(329839..329862,330264..330288,335818..335903,
FT                   350174..351772,360366..360389)
FT                   /codon_start=1
FT                   /gene="Ythdf3"
FT                   /locus_tag="mCG_11214"
FT                   /product="YTH domain family 3, isoform CRA_a"
FT                   /note="gene_id=mCG11214.2 transcript_id=mCT171820.0
FT                   protein_id=mCP94739.0 isoform=CRA_a"
FT                   /protein_id="EDL34857.1"
FT                   /translation="MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQ
FT                   NNSYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDG
FT                   VFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQNSAYSSSYGYPPSSLG
FT                   RAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIAT
FT                   NNVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDE
FT                   KGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQP
FT                   HQVQSQQPQLQNRWVAPRNRGTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVLEKLK
FT                   AINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGK
FT                   GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLR
FT                   HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAM
FT                   RRERNRNKQ"
FT   CDS             join(333397..333457,335818..335903,350174..351772,
FT                   360366..360389)
FT                   /codon_start=1
FT                   /gene="Ythdf3"
FT                   /locus_tag="mCG_11214"
FT                   /product="YTH domain family 3, isoform CRA_b"
FT                   /note="gene_id=mCG11214.2 transcript_id=mCT11194.2
FT                   protein_id=mCP15688.2 isoform=CRA_b"
FT                   /protein_id="EDL34858.1"
FT                   /translation="MFYLDLTLLHRATEETGEESFSVQNGSIHQKDAVNDDDFEPYLSS
FT                   QTNQNNSYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHY
FT                   IPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQNSAYSSSYGYPP
FT                   SSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMT
FT                   SIATNNVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIG
FT                   TWDEKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQP
FT                   QAQPHQVQSQQPQLQNRWVAPRNRGTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVL
FT                   EKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRS
FT                   LNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPN
FT                   NQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEE
FT                   EEAMRRERNRNKQ"
FT   assembly_gap    343389..343610
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    383157..383176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    413936..414435
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    416711..416925
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    430083..430305
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    464184..464260
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    501332..501639
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    504094..513770
FT                   /estimated_length=9677
FT                   /gap_type="unknown"
FT   assembly_gap    514851..514870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    568142..569160
FT                   /estimated_length=1019
FT                   /gap_type="unknown"
FT   assembly_gap    603561..603580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    620569..620588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    634003..634919
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   assembly_gap    638968..639174
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    745461..745480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    762485..763123
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    772749..772933
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    791181..794137
FT                   /estimated_length=2957
FT                   /gap_type="unknown"
FT   assembly_gap    820411..820755
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    823371..823725
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    843038..843057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    902367..902386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    925034..925056
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            <946229..954279
FT                   /locus_tag="mCG_144906"
FT                   /note="gene_id=mCG144906.0"
FT   mRNA            join(<946229..946282,952719..953472,953504..954279)
FT                   /locus_tag="mCG_144906"
FT                   /product="mCG144906"
FT                   /note="gene_id=mCG144906.0 transcript_id=mCT184330.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<953285..953472,953504..953768)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144906"
FT                   /product="mCG144906"
FT                   /note="gene_id=mCG144906.0 transcript_id=mCT184330.0
FT                   protein_id=mCP105160.0"
FT                   /protein_id="EDL34859.1"
FT                   /translation="RHNHTLISKIFFLHFSCSSSPSAYATPGFSSCLLNRVSLLFLIFF
FT                   SFLSLSLSLSLSLSLFLKDRVSLCSPGCPGIHSVDQAGLKLRNLPASASQVLGLKACAT
FT                   SAWLYFSFLGSYFPLLASLPDILEGIILFTFLSGKHKPSSISILCL"
FT   assembly_gap    953478..953497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    968831..968990
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    1003361..1003425
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    1005468..1005575
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    1027600..1028264
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    1030709..1030867
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    1064972..1064991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1088943..1089281
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    1111341..1111404
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    1117618..1117768
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1124640..1125036
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1126837..1130154
FT                   /estimated_length=3318
FT                   /gap_type="unknown"
FT   assembly_gap    1157775..1157794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1190397..1190443
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1213809..1213853
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1245736..1246053
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    1252641..1252797
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1260217..1260575
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    1268609..1268628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1281044..1281384)
FT                   /pseudo
FT                   /locus_tag="mCG_1049514"
FT                   /note="gene_id=mCG1049514.0"
FT   mRNA            complement(1281044..1281384)
FT                   /pseudo
FT                   /locus_tag="mCG_1049514"
FT                   /note="gene_id=mCG1049514.0 transcript_id=mCT167218.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    1285113..1285132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1286157..1286232
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    1310299..1313353
FT                   /estimated_length=3055
FT                   /gap_type="unknown"
FT   assembly_gap    1315131..1315697
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    1319023..1319042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1328093..1328165
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1340802..1340821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1344119..1344138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1345392..1345441
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    1353365..1353384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1354472..>1355408)
FT                   /locus_tag="mCG_48677"
FT                   /note="gene_id=mCG48677.1"
FT   mRNA            complement(1354472..>1355408)
FT                   /locus_tag="mCG_48677"
FT                   /product="mCG48677"
FT                   /note="gene_id=mCG48677.1 transcript_id=mCT48860.1 created
FT                   on 06-SEP-2002"
FT   CDS             complement(1355145..1355408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48677"
FT                   /product="mCG48677"
FT                   /note="gene_id=mCG48677.1 transcript_id=mCT48860.1
FT                   protein_id=mCP36531.0"
FT                   /db_xref="GOA:B7ZWE1"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="MGI:MGI:3643834"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWE1"
FT                   /protein_id="EDL34860.1"
FT                   /translation="MATQWHGIQQLLQVEKRAAKVSEARKRKNLRLKQAKEEAQAEIEQ
FT                   YILRREREFKTKEAAALGSHGGYSSEVKKGDHPLELLRAEQG"
FT   assembly_gap    1386070..1386497
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   gene            1393789..1395488
FT                   /pseudo
FT                   /locus_tag="mCG_51812"
FT                   /note="gene_id=mCG51812.1"
FT   mRNA            1393789..1395488
FT                   /pseudo
FT                   /locus_tag="mCG_51812"
FT                   /note="gene_id=mCG51812.1 transcript_id=mCT51995.1 created
FT                   on 06-SEP-2002"
FT   assembly_gap    1403945..1404041
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            1407401..1408500
FT                   /locus_tag="mCG_1049458"
FT                   /note="gene_id=mCG1049458.1"
FT   mRNA            1407401..1408500
FT                   /locus_tag="mCG_1049458"
FT                   /product="mCG1049458"
FT                   /note="gene_id=mCG1049458.1 transcript_id=mCT167162.1
FT                   created on 06-SEP-2002"
FT   CDS             1408045..1408233
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049458"
FT                   /product="mCG1049458"
FT                   /note="gene_id=mCG1049458.1 transcript_id=mCT167162.1
FT                   protein_id=mCP79223.1"
FT                   /protein_id="EDL34861.1"
FT                   /translation="MHEGLSASGSSLALVGHDSIYCICLKKCASFNCENRVPDPDECVV
FT                   YLKEEYWSCPQLLSIAL"
FT   assembly_gap    1418257..1418276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1420195..1420214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1425744..1425763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1444322..1444341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1451345..>1457107)
FT                   /locus_tag="mCG_144902"
FT                   /note="gene_id=mCG144902.0"
FT   mRNA            complement(join(1451345..1453360,1455936..1456021,
FT                   1457006..>1457107))
FT                   /locus_tag="mCG_144902"
FT                   /product="mCG144902"
FT                   /note="gene_id=mCG144902.0 transcript_id=mCT184326.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1452011..>1452307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144902"
FT                   /product="mCG144902"
FT                   /note="gene_id=mCG144902.0 transcript_id=mCT184326.0
FT                   protein_id=mCP105156.0"
FT                   /protein_id="EDL34862.1"
FT                   /translation="HFQCSLSVIPCNHQVRVLLLQSGARARSSYGWLHRILRKATSVPF
FT                   FFSWTVINNNLCSFRFFSLSIFTASYSVFFFFLILLKHRFNFECIFHCESVNL"
FT   assembly_gap    1463387..1463406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1465207..1465235
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1493930..1494243
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    1506116..1510957
FT                   /estimated_length=4842
FT                   /gap_type="unknown"
FT   gene            1517818..1518389
FT                   /pseudo
FT                   /locus_tag="mCG_1049459"
FT                   /note="gene_id=mCG1049459.1"
FT   mRNA            1517818..1518389
FT                   /pseudo
FT                   /locus_tag="mCG_1049459"
FT                   /note="gene_id=mCG1049459.1 transcript_id=mCT167163.1
FT                   created on 23-APR-2003"
FT   assembly_gap    1534898..1535311
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    1543738..1546567
FT                   /estimated_length=2830
FT                   /gap_type="unknown"
FT   assembly_gap    1611693..1611987
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    1619939..1620070
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    1627638..1627657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662041..1662060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1676057..1679930
FT                   /locus_tag="mCG_148203"
FT                   /note="gene_id=mCG148203.0"
FT   mRNA            join(1676057..1678125,1679353..1679930)
FT                   /locus_tag="mCG_148203"
FT                   /product="mCG148203"
FT                   /note="gene_id=mCG148203.0 transcript_id=mCT188466.0
FT                   created on 13-JAN-2004"
FT   CDS             1676489..1676644
FT                   /codon_start=1
FT                   /locus_tag="mCG_148203"
FT                   /product="mCG148203"
FT                   /note="gene_id=mCG148203.0 transcript_id=mCT188466.0
FT                   protein_id=mCP108131.0"
FT                   /protein_id="EDL34863.1"
FT                   /translation="MSEMSPRVPCSQLVTLFCKVVETVSQKRITEDNSLRIKPSSVFCF
FT                   LIEQDL"
FT   assembly_gap    1679330..1679349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1688995..1689556
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    1692566..1692585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1698012..1698134
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    1705034..1705296
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1714206..1714225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1759325..1759344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1760369..1760388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769575..1769594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1772890..1772909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1786544..1786563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798393..1802621
FT                   /estimated_length=4229
FT                   /gap_type="unknown"
FT   assembly_gap    1810972..1810991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1812596..1812615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1813113..1813132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1846683..1847923
FT                   /estimated_length=1241
FT                   /gap_type="unknown"
FT   assembly_gap    1898137..1898156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1899480..1899499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1901262..1901281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1902355..1911993
FT                   /locus_tag="mCG_146307"
FT                   /note="gene_id=mCG146307.0"
FT   mRNA            join(<1902355..1902592,1906997..1907417,1911789..1911993)
FT                   /locus_tag="mCG_146307"
FT                   /product="mCG146307"
FT                   /note="gene_id=mCG146307.0 transcript_id=mCT186410.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<1902548..1902592,1906997..1907417,1911789..1911808)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146307"
FT                   /product="mCG146307"
FT                   /note="gene_id=mCG146307.0 transcript_id=mCT186410.0
FT                   protein_id=mCP107285.0"
FT                   /protein_id="EDL34864.1"
FT                   /translation="QTEGPDHGLFKDSPAGERSGVSAQNLLLSPLAFFRRAQSVHPPGP
FT                   PSRKGCCEKSRCLPPPACRPEGSARRGQLPSFFFFPSCPPSAEPRLGSPPDSRRSQRER
FT                   ICCAALKSTPRAGSDPISALQSRRKPEQAAFSLRSKIIARPDGPQLSRDSAGLYGVK"
FT   assembly_gap    1924875..1925459
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    1962401..1964512
FT                   /estimated_length=2112
FT                   /gap_type="unknown"
FT   assembly_gap    1967313..1967332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1974498..1974517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1981554..1983100
FT                   /estimated_length=1547
FT                   /gap_type="unknown"
FT   assembly_gap    1984277..1984296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1988014..1988033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1989840..1989859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1990926..1990945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1992078..1992097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1993111..1993130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1995880..1995899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1997281..1997300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2001800..2001819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2003171..2003190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2023290..2023337
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            2036782..2038134
FT                   /pseudo
FT                   /locus_tag="mCG_1049517"
FT                   /note="gene_id=mCG1049517.1"
FT   mRNA            2036782..2038134
FT                   /pseudo
FT                   /locus_tag="mCG_1049517"
FT                   /note="gene_id=mCG1049517.1 transcript_id=mCT167221.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    2040596..2043142
FT                   /estimated_length=2547
FT                   /gap_type="unknown"
FT   assembly_gap    2051965..2051984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2063871..2064380
FT                   /locus_tag="mCG_55287"
FT                   /note="gene_id=mCG55287.1"
FT   mRNA            2063871..2064380
FT                   /locus_tag="mCG_55287"
FT                   /product="mCG55287"
FT                   /note="gene_id=mCG55287.1 transcript_id=mCT55470.1 created
FT                   on 05-SEP-2002"
FT   CDS             2063893..2064252
FT                   /codon_start=1
FT                   /locus_tag="mCG_55287"
FT                   /product="mCG55287"
FT                   /note="gene_id=mCG55287.1 transcript_id=mCT55470.1
FT                   protein_id=mCP25051.0"
FT                   /db_xref="GOA:Q9DAR6"
FT                   /db_xref="MGI:MGI:1922689"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAR6"
FT                   /protein_id="EDL34865.1"
FT                   /translation="MARVAKRAPEPTTAAAAARSKQRNRRASYGRRCKNSNKNQRASRR
FT                   RKSCAEIMRKGKRGRQQASKGKKAIKVRILKEASQNALALVIHEPVNENVSLTPPEVPS
FT                   CPENSPVPKEDLVSS"
FT   assembly_gap    2079318..2079717
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    2086729..2087516
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    2090323..2095341
FT                   /estimated_length=5019
FT                   /gap_type="unknown"
FT   assembly_gap    2108096..2111478
FT                   /estimated_length=3383
FT                   /gap_type="unknown"
FT   gene            2124564..2127299
FT                   /pseudo
FT                   /locus_tag="mCG_120607"
FT                   /note="gene_id=mCG120607.0"
FT   mRNA            2124564..2127299
FT                   /pseudo
FT                   /locus_tag="mCG_120607"
FT                   /note="gene_id=mCG120607.0 transcript_id=mCT121779.0
FT                   created on 16-AUG-2002"
FT   assembly_gap    2148146..2149793
FT                   /estimated_length=1648
FT                   /gap_type="unknown"
FT   assembly_gap    2152892..2155388
FT                   /estimated_length=2497
FT                   /gap_type="unknown"
FT   gene            2172186..2174991
FT                   /gene="Bhlhb5"
FT                   /locus_tag="mCG_6270"
FT                   /note="gene_id=mCG6270.1"
FT   mRNA            2172186..2174991
FT                   /gene="Bhlhb5"
FT                   /locus_tag="mCG_6270"
FT                   /product="basic helix-loop-helix domain containing, class
FT                   B5"
FT                   /note="gene_id=mCG6270.1 transcript_id=mCT5829.1 created on
FT                   19-AUG-2002"
FT   CDS             2172270..2173337
FT                   /codon_start=1
FT                   /gene="Bhlhb5"
FT                   /locus_tag="mCG_6270"
FT                   /product="basic helix-loop-helix domain containing, class
FT                   B5"
FT                   /note="gene_id=mCG6270.1 transcript_id=mCT5829.1
FT                   protein_id=mCP2114.2"
FT                   /db_xref="GOA:A0A0R4J056"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR032654"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="MGI:MGI:1930001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J056"
FT                   /protein_id="EDL34866.1"
FT                   /translation="MERGLHLGAAAASEDDLFLHKSLGTSAAKRLEAAFRSTPPGMDLS
FT                   LAPPTRERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGGGVSVPGLLVGSAGV
FT                   GGEPSLSSLPAGAALCLKYGESAGRGSVAESSGGEQSPDDDSDGRCELVLRAGGPDPRA
FT                   SPGAGGGSAKVAEGCSNAHLHGGSGLPPGGPTSGGGSGGGGGGSSKKSKEQKALRLNIN
FT                   ARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLV
FT                   AYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALF
FT                   NSVSSSLCKQCTEKP"
FT   gene            complement(2189690..2361171)
FT                   /gene="Cyp7b1"
FT                   /locus_tag="mCG_6269"
FT                   /note="gene_id=mCG6269.2"
FT   mRNA            complement(join(2189690..2190262,2196778..2196953,
FT                   2213923..2214129,2214601..2215191,2221096..2221232,
FT                   2360976..2361171))
FT                   /gene="Cyp7b1"
FT                   /locus_tag="mCG_6269"
FT                   /product="cytochrome P450, family 7, subfamily b,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG6269.2 transcript_id=mCT5823.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(2189966..2190262,2196778..2196953,
FT                   2213923..2214129,2214601..2215191,2221096..2221232,
FT                   2360976..2361091))
FT                   /codon_start=1
FT                   /gene="Cyp7b1"
FT                   /locus_tag="mCG_6269"
FT                   /product="cytochrome P450, family 7, subfamily b,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG6269.2 transcript_id=mCT5823.2
FT                   protein_id=mCP2101.2"
FT                   /db_xref="GOA:Q8CHV7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR024204"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="MGI:MGI:104978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CHV7"
FT                   /protein_id="EDL34867.1"
FT                   /translation="MQGATTLDAASPGPLALLGLLFAATLLLSALFLLTRRTRRPREPP
FT                   LIKGWLPYLGMALKFFKDPLTFLKTLQRQHGDTFTVFLVGKYITFVLNPFQYQYVTKNP
FT                   KQLSFQKFSSRLSAKAFSVKKLLTDDDLNEDVHRAYLLLQGKPLDALLETMIQEVKELF
FT                   ESQLLKITDWNTERIFAFCGSLVFEITFATLYGKILAGNKKQIISELRDDFFKFDDMFP
FT                   YLVSDIPIQLLRNEESMQKKIIKCLTSEKVAQMQGQSKIVQERQDLLKRYYRHDDPEIG
FT                   AHHLGFLWASLANTIPAMFWAMYYILRHPEAMEALRDEIDSFLQSTGQKKGPGISVHFT
FT                   REQLDSLVCLESTILEVLRLCSYSSIIREVQEDMNLSLESKSFSLRKGDFVALFPPLIH
FT                   NDPEIFDAPKEFRFDRFIEDGKKKSTFFKGGKRLKTYVMPFGLGTSKCPGRYFAVNEMK
FT                   LLLIMLLTYFDLEIIDRKPIGLNHSRMFLGIQHPDSAVSFRYKAKSWRS"
FT   assembly_gap    2201765..2201784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2234201..2234220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2252946..2253230
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    2260711..2261118
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    2320793..2320812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2374832..2374851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2377249..2377268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2442839..2442858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2458043..2458472
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   gene            complement(2459956..2580615)
FT                   /locus_tag="mCG_1049520"
FT                   /note="gene_id=mCG1049520.1"
FT   mRNA            complement(join(2459956..2460410,2499807..2499889,
FT                   2527969..2528067,2539740..2539819,2571672..2571770,
FT                   2580561..2580615))
FT                   /locus_tag="mCG_1049520"
FT                   /product="mCG1049520"
FT                   /note="gene_id=mCG1049520.1 transcript_id=mCT167224.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(2460208..2460351)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049520"
FT                   /product="mCG1049520"
FT                   /note="gene_id=mCG1049520.1 transcript_id=mCT167224.1
FT                   protein_id=mCP79493.1"
FT                   /protein_id="EDL34868.1"
FT                   /translation="MESLRTAHGVARVWQSLASWNHRISSICSTSPQRAHSNHLSSWSV
FT                   TT"
FT   assembly_gap    2462555..2462574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2467700..2469852
FT                   /estimated_length=2153
FT                   /gap_type="unknown"
FT   assembly_gap    2472007..2472646
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    2484376..2486504
FT                   /estimated_length=2129
FT                   /gap_type="unknown"
FT   assembly_gap    2494600..2494619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2497499..2497518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2508295..2509283
FT                   /estimated_length=989
FT                   /gap_type="unknown"
FT   assembly_gap    2540702..2540721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2572357..2572376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2573729..2573748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2580358..2580377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2581484..2581503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2582580..2582599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2589399..>2601609)
FT                   /locus_tag="mCG_145537"
FT                   /note="gene_id=mCG145537.0"
FT   mRNA            complement(join(2589399..2589464,2591940..2592101,
FT                   2593759..2593816,2601251..>2601609))
FT                   /locus_tag="mCG_145537"
FT                   /product="mCG145537"
FT                   /note="gene_id=mCG145537.0 transcript_id=mCT184961.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2601414..>2601608)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145537"
FT                   /product="mCG145537"
FT                   /note="gene_id=mCG145537.0 transcript_id=mCT184961.0
FT                   protein_id=mCP105168.0"
FT                   /protein_id="EDL34869.1"
FT                   /translation="NRLWILGSVQPSNRIKTQQIPHLTTWHFRNFISQEGCSKPYLGDR
FT                   EKGTVFRQAATATLLSQMY"
FT   assembly_gap    2601858..2601943
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    2607710..2608621
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   assembly_gap    2609643..2609662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2610988..2611007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2616659..2616852
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    2628231..2628250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2638947..2638966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2641408..2642919
FT                   /estimated_length=1512
FT                   /gap_type="unknown"
FT   assembly_gap    2646159..2646178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2648420..2648439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2649595..2649614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2655360..2660500
FT                   /estimated_length=5141
FT                   /gap_type="unknown"
FT   assembly_gap    2661905..2661924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2664498..2665977
FT                   /estimated_length=1480
FT                   /gap_type="unknown"
FT   gene            <2667302..2668002
FT                   /locus_tag="mCG_1049427"
FT                   /note="gene_id=mCG1049427.1"
FT   mRNA            <2667302..2668002
FT                   /locus_tag="mCG_1049427"
FT                   /product="mCG1049427"
FT                   /note="gene_id=mCG1049427.1 transcript_id=mCT167131.1
FT                   created on 06-SEP-2002"
FT   CDS             <2667302..2667727
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049427"
FT                   /product="mCG1049427"
FT                   /note="gene_id=mCG1049427.1 transcript_id=mCT167131.1
FT                   protein_id=mCP79678.1"
FT                   /protein_id="EDL34870.1"
FT                   /translation="VVVAVKWAISNRTIWKHLFPIQNEALSSACHKSTYSSLPADYNHK
FT                   VYLTLTSDDRTVVCYHTSVDISYKHTKPISQPDHLHNKEKTHKQVLKTILEGKFNGLDQ
FT                   GPIKEQLSKVFFTTNHRWFLHGQFHRHSKKLNPPKDR"
FT   assembly_gap    2668475..2668494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2670255..2670532
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    2672084..2672103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2674833..2674852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2675668..2675687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2684554..2685760
FT                   /pseudo
FT                   /locus_tag="mCG_140987"
FT                   /note="gene_id=mCG140987.0"
FT   mRNA            2684554..2685760
FT                   /pseudo
FT                   /locus_tag="mCG_140987"
FT                   /note="gene_id=mCG140987.0 transcript_id=mCT172598.0
FT                   created on 06-SEP-2002"
FT   assembly_gap    2689254..2689273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2691667..2691686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2739863..2739882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2748445..2748464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2750263..2750282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2770507..2770526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2785144..2785172
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    2804651..2805253
FT                   /estimated_length=603
FT                   /gap_type="unknown"
FT   assembly_gap    2806658..2806833
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    2811040..2811059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2839756..2840325
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    2859323..2866524
FT                   /estimated_length=7202
FT                   /gap_type="unknown"
FT   assembly_gap    2937978..2937997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2946011..2946625
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    2966908..2967307
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    2968266..2968796
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    2970455..2973328
FT                   /estimated_length=2874
FT                   /gap_type="unknown"
FT   assembly_gap    3018311..3018440
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3080797..3081691
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    3083264..3084201
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    3085031..3086097
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   assembly_gap    3101274..3101455
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            3108631..3109001
FT                   /pseudo
FT                   /locus_tag="mCG_1049522"
FT                   /note="gene_id=mCG1049522.0"
FT   mRNA            3108631..3109001
FT                   /pseudo
FT                   /locus_tag="mCG_1049522"
FT                   /note="gene_id=mCG1049522.0 transcript_id=mCT167226.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    3118062..3118084
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    3128774..3130417
FT                   /estimated_length=1644
FT                   /gap_type="unknown"
FT   assembly_gap    3147988..3148007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3153313..3154357
FT                   /estimated_length=1045
FT                   /gap_type="unknown"
FT   assembly_gap    3169200..3169348
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(<3176408..>3243314)
FT                   /locus_tag="mCG_1049523"
FT                   /note="gene_id=mCG1049523.0"
FT   mRNA            complement(join(<3176408..3176419,3176974..3177065,
FT                   3231442..3231837,3243305..>3243314))
FT                   /locus_tag="mCG_1049523"
FT                   /product="mCG1049523"
FT                   /note="gene_id=mCG1049523.0 transcript_id=mCT167227.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(3176408..3176419,3176974..3177065,
FT                   3231442..3231837,3243305..3243314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049523"
FT                   /product="mCG1049523"
FT                   /note="gene_id=mCG1049523.0 transcript_id=mCT167227.0
FT                   protein_id=mCP79521.0"
FT                   /protein_id="EDL34871.1"
FT                   /translation="MMKLKAGQGVLEEVQDSMSETERGKRLGAQRKKGIPKKKGPSTDP
FT                   GSEEVRERGKDTPEEKRKERGKEAPQKKSLYPVKELEALGLDGSDSNEELSPTDEEDLE
FT                   EEAARYEEERYHPDERWPSKSERKSKRNGSKESGTNIRDPNGFQESTYQICAPQKDRRR
FT                   SKEMLA"
FT   assembly_gap    3186262..3186281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3196432..3196576
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    3208642..3210323
FT                   /estimated_length=1682
FT                   /gap_type="unknown"
FT   assembly_gap    3217449..3217468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3227304..3227323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3238431..3238450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3239510..3239529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3241139..3242510
FT                   /estimated_length=1372
FT                   /gap_type="unknown"
FT   gene            complement(3244613..3275217)
FT                   /gene="Armc1"
FT                   /locus_tag="mCG_121082"
FT                   /note="gene_id=mCG121082.0"
FT   mRNA            complement(join(3244613..3244816,3246827..3246901,
FT                   3246991..3247107,3256611..3256800,3261622..3261713,
FT                   3269609..3269829,3275048..3275217))
FT                   /gene="Armc1"
FT                   /locus_tag="mCG_121082"
FT                   /product="armadillo repeat containing 1"
FT                   /note="gene_id=mCG121082.0 transcript_id=mCT122278.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(3244760..3244816,3246827..3246901,
FT                   3246991..3247107,3256611..3256800,3261622..3261713,
FT                   3269609..3269791))
FT                   /codon_start=1
FT                   /gene="Armc1"
FT                   /locus_tag="mCG_121082"
FT                   /product="armadillo repeat containing 1"
FT                   /note="gene_id=mCG121082.0 transcript_id=mCT122278.0
FT                   protein_id=mCP79581.1"
FT                   /protein_id="EDL34872.1"
FT                   /translation="MNSSSSTMNEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLI
FT                   LFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLAS
FT                   EIYDILQSSNLADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEE
FT                   ALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEFQQ
FT                   VFILFCIVTHLFKNL"
FT   assembly_gap    3244817..3244836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3246715..3246734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3249812..3249831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3259409..3259428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3293540..3293761
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   gene            3299595..3333105
FT                   /locus_tag="mCG_19781"
FT                   /note="gene_id=mCG19781.2"
FT   mRNA            join(3299595..3299814,3312335..3312476,3318761..3318859,
FT                   3323774..3323889,3327772..3328004,3329480..3329723,
FT                   3330462..3330621,3331338..3332019)
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, transcript variant mCT172196"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT172196.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(3300503..3300554,3312335..3312476,3318761..3318859,
FT                   3323774..3323889,3327777..3328004,3329480..3329723)
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, transcript variant mCT179956"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT179956.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(3300504..3300554,3312335..3312476,3318761..3318859,
FT                   3323774..3323889,3327772..3328004,3329480..3329723,
FT                   3330462..3330621,3331338..3333105)
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, transcript variant mCT22166"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT22166.2 created
FT                   on 11-FEB-2003"
FT   CDS             join(3312411..3312476,3318761..3318859,3323774..3323889,
FT                   3327772..3328004,3329480..3329723,3330462..3330621,
FT                   3331338..3331406)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, isoform CRA_a"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT172196.0
FT                   protein_id=mCP95115.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TTQ5"
FT                   /db_xref="InterPro:IPR007972"
FT                   /db_xref="MGI:MGI:1914722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTQ5"
FT                   /protein_id="EDL34873.1"
FT                   /translation="MLGWIKCLMRMWFQRVGVSMQSVLWSGKPYGSSRSIVRKIGTNLS
FT                   LIQCPRVQFQLTSHATEWSPAHSGEDAVASFADVGLVATEEGECSIRLRAEVSSKPPHE
FT                   DDPPCFEKPPSRHTSFPSLSQDKPSPERTLASEEALQKISALENELAALRAQIAKIVTL
FT                   QEQQSPSAGCLDSSTSVTVAPPPPPPPPPPPLPLVLHQSTSALDLIKERREQRLSAGKT
FT                   LATGHPKKPDMPNMLEILKDMNSVKLRSVKRSEKDVKPRPADTDHAAFIAEALKKKFAY
FT                   RHNSQGETERGIPKPESEATSEPALFGPHILKSTGKMKALIENVPDS"
FT   CDS             join(3312411..3312476,3318761..3318859,3323774..3323889,
FT                   3327772..3328004,3329480..3329723,3330462..3330621,
FT                   3331338..3331406)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, isoform CRA_a"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT22166.2
FT                   protein_id=mCP2093.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TTQ5"
FT                   /db_xref="InterPro:IPR007972"
FT                   /db_xref="MGI:MGI:1914722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTQ5"
FT                   /protein_id="EDL34875.1"
FT                   /translation="MLGWIKCLMRMWFQRVGVSMQSVLWSGKPYGSSRSIVRKIGTNLS
FT                   LIQCPRVQFQLTSHATEWSPAHSGEDAVASFADVGLVATEEGECSIRLRAEVSSKPPHE
FT                   DDPPCFEKPPSRHTSFPSLSQDKPSPERTLASEEALQKISALENELAALRAQIAKIVTL
FT                   QEQQSPSAGCLDSSTSVTVAPPPPPPPPPPPLPLVLHQSTSALDLIKERREQRLSAGKT
FT                   LATGHPKKPDMPNMLEILKDMNSVKLRSVKRSEKDVKPRPADTDHAAFIAEALKKKFAY
FT                   RHNSQGETERGIPKPESEATSEPALFGPHILKSTGKMKALIENVPDS"
FT   CDS             join(3312411..3312476,3318761..3318859,3323774..3323889,
FT                   3327777..3327801)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19781"
FT                   /product="mCG19781, isoform CRA_b"
FT                   /note="gene_id=mCG19781.2 transcript_id=mCT179956.0
FT                   protein_id=mCP102878.0 isoform=CRA_b"
FT                   /protein_id="EDL34874.1"
FT                   /translation="MLGWIKCLMRMWFQRVGVSMQSVLWSGKPYGSSRSIVRKIGTNLS
FT                   LIQCPRVQFQLTSHATEWSPAHSGEDAVASFADVGLVATEEGECSIRLRSQFQASS"
FT   gene            complement(3336969..>3426257)
FT                   /gene="Pde7a"
FT                   /locus_tag="mCG_19780"
FT                   /note="gene_id=mCG19780.2"
FT   mRNA            complement(join(3336969..3340133,3341980..3342057,
FT                   3342544..3342644,3343249..3343393,3345393..3345484,
FT                   3345969..3346100,3348045..3348145,3348576..3348671,
FT                   3353282..3353345,3355188..3355339,3368830..3368913,
FT                   3372284..3372344,3376872..3377009))
FT                   /gene="Pde7a"
FT                   /locus_tag="mCG_19780"
FT                   /product="phosphodiesterase 7A, transcript variant
FT                   mCT22165"
FT                   /note="gene_id=mCG19780.2 transcript_id=mCT22165.2 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(3339929..3340133,3341980..3342057,
FT                   3342544..3342644,3343249..3343393,3345393..3345484,
FT                   3345969..3346100,3348045..3348145,3348576..3348671,
FT                   3353282..3353345,3355188..3355339,3368830..3368913,
FT                   3372284..3372344,3426120..>3426257))
FT                   /gene="Pde7a"
FT                   /locus_tag="mCG_19780"
FT                   /product="phosphodiesterase 7A, transcript variant
FT                   mCT172583"
FT                   /note="gene_id=mCG19780.2 transcript_id=mCT172583.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(3342015..3342057,3342544..3342644,
FT                   3343249..3343393,3345393..3345484,3345969..3346100,
FT                   3348045..3348145,3348576..3348671,3353282..3353345,
FT                   3355188..3355339,3368830..3368913,3372284..3372344,
FT                   3426120..3426257))
FT                   /codon_start=1
FT                   /gene="Pde7a"
FT                   /locus_tag="mCG_19780"
FT                   /product="phosphodiesterase 7A, isoform CRA_a"
FT                   /note="gene_id=mCG19780.2 transcript_id=mCT172583.0
FT                   protein_id=mCP95502.0 isoform=CRA_a"
FT                   /protein_id="EDL34876.1"
FT                   /translation="MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLS
FT                   QRRGAISYDSSDQTALYIRMLGDVRVRSRAGFETERRGSHPYIDFRIFHSQSDIEASVS
FT                   ARNIRRLLSFQRYLRSSRVFRGATVCSSLDILDEDYNGQAKCMLEKVGNWNFDIFLFDR
FT                   LTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQ
FT                   AMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVL
FT                   ENHHWRSAVGLLRESGLFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRSHLDKG
FT                   DLHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGRYRKKVPFGCE
FT                   STL"
FT   CDS             complement(join(3342015..3342057,3342544..3342644,
FT                   3343249..3343393,3345393..3345484,3345969..3346100,
FT                   3348045..3348145,3348576..3348671,3353282..3353345,
FT                   3355188..3355339,3368830..3368913,3372284..3372344,
FT                   3376872..3376931))
FT                   /codon_start=1
FT                   /gene="Pde7a"
FT                   /locus_tag="mCG_19780"
FT                   /product="phosphodiesterase 7A, isoform CRA_b"
FT                   /note="gene_id=mCG19780.2 transcript_id=mCT22165.2
FT                   protein_id=mCP2073.1 isoform=CRA_b"
FT                   /protein_id="EDL34877.1"
FT                   /translation="MGITLIWCLALVLIKWITSKRRGAISYDSSDQTALYIRMLGDVRV
FT                   RSRAGFETERRGSHPYIDFRIFHSQSDIEASVSARNIRRLLSFQRYLRSSRVFRGATVC
FT                   SSLDILDEDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHL
FT                   DMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSLIA
FT                   AATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRESGLFSHLPLESR
FT                   QEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDDGRHRHLVLQMALKCADICNP
FT                   CRNWELSKQWSEKVTEEFFHQGRYRKKVPFGCESTL"
FT   assembly_gap    3347539..3347558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3358213..3358742
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    3361348..3361367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3400395..3400414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3417590..3417609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3418773..3418792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3426288..3431036
FT                   /estimated_length=4749
FT                   /gap_type="unknown"
FT   assembly_gap    3444109..3444128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3454488..3454507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3455662..3455681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3458877..3458933
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    3467268..3468738
FT                   /estimated_length=1471
FT                   /gap_type="unknown"
FT   assembly_gap    3471096..3471151
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    3475394..3478481
FT                   /estimated_length=3088
FT                   /gap_type="unknown"
FT   assembly_gap    3483473..3483584
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    3494843..3494862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3562160..3562322
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    3565912..3565931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3596467..3596591
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    3599081..3599100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3612506..3612525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3613570..3613589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3620123..3620142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3623139..3725327
FT                   /gene="Dnajc5b"
FT                   /locus_tag="mCG_19779"
FT                   /note="gene_id=mCG19779.1"
FT   mRNA            join(3623139..3623219,3661360..3661486,3689306..3689519,
FT                   3693588..3693759,3725011..3725327)
FT                   /gene="Dnajc5b"
FT                   /locus_tag="mCG_19779"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5 beta"
FT                   /note="gene_id=mCG19779.1 transcript_id=mCT22164.0 created
FT                   on 19-AUG-2002"
FT   assembly_gap    3629465..3629643
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   CDS             join(3661368..3661486,3689306..3689519,3693588..3693759,
FT                   3725011..3725105)
FT                   /codon_start=1
FT                   /gene="Dnajc5b"
FT                   /locus_tag="mCG_19779"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5 beta"
FT                   /note="gene_id=mCG19779.1 transcript_id=mCT22164.0
FT                   protein_id=mCP2109.1"
FT                   /protein_id="EDL34878.1"
FT                   /translation="MACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALR
FT                   HHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFM
FT                   LSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIR
FT                   TDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDS"
FT   assembly_gap    3686906..3687114
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    3711964..3711983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3724535..3724554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3748230..3748249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3758994..>3806396
FT                   /locus_tag="mCG_19772"
FT                   /note="gene_id=mCG19772.2"
FT   mRNA            join(3758994..3759263,3759763..3759935,3773681..3773846,
FT                   3776948..3777043,3786127..3786360,3786610..3786632,
FT                   3786733..3786857,3787959..3788200,3789454..3789741,
FT                   3806277..>3806396)
FT                   /locus_tag="mCG_19772"
FT                   /product="mCG19772"
FT                   /note="gene_id=mCG19772.2 transcript_id=mCT22157.2 created
FT                   on 19-AUG-2002"
FT   CDS             join(3759096..3759263,3759763..3759935,3773681..3773846,
FT                   3776948..3777043,3786127..3786360,3786610..3786632,
FT                   3786733..3786857,3787959..3788200,3789454..3789741,
FT                   3806277..>3806396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19772"
FT                   /product="mCG19772"
FT                   /note="gene_id=mCG19772.2 transcript_id=mCT22157.2
FT                   protein_id=mCP2098.2"
FT                   /db_xref="GOA:G3X8Y1"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017903"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="MGI:MGI:3036269"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Y1"
FT                   /protein_id="EDL34879.1"
FT                   /translation="MSTSLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHN
FT                   LCRKCASDIFQASNPYLPTRGGTTVASGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENI
FT                   IDIYKQESTRPEKKLDQPMCEEHEEERINIYCLNCEVPTCSLCKVFGAHKDCQVAPLTH
FT                   VFQRQKSELSDGIAVLVGSNDRVQGVISQLEDTCKTIEECCRKQKQDLCEKFDHLYGIL
FT                   EERKTEMTQAITRTQEEKLEHVRTLIRKYSDHLENVSKLVESGIQFMDEPEMAVFLQNA
FT                   KTLLQKIVEASKAFQMEKLEQGYEIMSNFTVNLNREEKIIREIDFSREEEEEEDAGEID
FT                   EEGEGEDAVEVEEAENVQIASSGEEESLEKAAEPSQLPAELQVAPEPLPASSPEPFSSM
FT                   PPAADVLVTQGEVVPIGSQQTTQSETSGPSAAETADPLFYPSWYKGQSRKTSSNPPCTH
FT                   GSEGLGQIGPLGIEDSSVQSAEVAEAATNEQAAVSGKESSSTAATSQIGFEAPSPQGQS
FT                   AALGSGGGADPEPARHVFSFSWLNSLNE"
FT   assembly_gap    3760457..3760575
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    3774372..3774391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3782753..3783481
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   gene            3800815..3801359
FT                   /locus_tag="mCG_148198"
FT                   /note="gene_id=mCG148198.0"
FT   mRNA            3800815..3801359
FT                   /locus_tag="mCG_148198"
FT                   /product="mCG148198"
FT                   /note="gene_id=mCG148198.0 transcript_id=mCT188461.0
FT                   created on 13-JAN-2004"
FT   CDS             3800981..3801097
FT                   /codon_start=1
FT                   /locus_tag="mCG_148198"
FT                   /product="mCG148198"
FT                   /note="gene_id=mCG148198.0 transcript_id=mCT188461.0
FT                   protein_id=mCP108126.0"
FT                   /db_xref="MGI:MGI:3642300"
FT                   /db_xref="UniProtKB/TrEMBL:Q99LW8"
FT                   /protein_id="EDL34880.1"
FT                   /translation="MAELVVSVNSEALAANLSKQTNQQSSISDKQAQVTDIC"
FT   assembly_gap    3805037..3805056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3808534..>3809275)
FT                   /locus_tag="mCG_50108"
FT                   /note="gene_id=mCG50108.2"
FT   mRNA            complement(3808534..>3809275)
FT                   /locus_tag="mCG_50108"
FT                   /product="mCG50108"
FT                   /note="gene_id=mCG50108.2 transcript_id=mCT50291.2 created
FT                   on 06-SEP-2002"
FT   CDS             complement(3808712..3809275)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50108"
FT                   /product="mCG50108"
FT                   /note="gene_id=mCG50108.2 transcript_id=mCT50291.2
FT                   protein_id=mCP25030.2"
FT                   /protein_id="EDL34881.1"
FT                   /translation="MRLRLLVSAGMLLVALSSCLPCRALLSRGSVPRAPRAPQPLNFLQ
FT                   PEQPQQPQPVLIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFR
FT                   VLLQQLQMPQRSLDSRAEPAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVL
FT                   EMARAEQLAQQAHSNRKLMEIIGK"
FT   gene            complement(3822908..3824113)
FT                   /pseudo
FT                   /locus_tag="mCG_52048"
FT                   /note="gene_id=mCG52048.2"
FT   mRNA            complement(3822908..3824113)
FT                   /pseudo
FT                   /locus_tag="mCG_52048"
FT                   /note="gene_id=mCG52048.2 transcript_id=mCT52231.2 created
FT                   on 06-SEP-2002"
FT   gene            3883684..3884223
FT                   /pseudo
FT                   /locus_tag="mCG_140988"
FT                   /note="gene_id=mCG140988.0"
FT   mRNA            3883684..3884223
FT                   /pseudo
FT                   /locus_tag="mCG_140988"
FT                   /note="gene_id=mCG140988.0 transcript_id=mCT172605.0
FT                   created on 06-SEP-2002"
FT   assembly_gap    3966407..3966426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3978690..3993799
FT                   /estimated_length=15110
FT                   /gap_type="unknown"
FT   gene            4004800..4007110
FT                   /gene="4632415L05Rik"
FT                   /locus_tag="mCG_19777"
FT                   /note="gene_id=mCG19777.1"
FT   mRNA            4004800..4007110
FT                   /gene="4632415L05Rik"
FT                   /locus_tag="mCG_19777"
FT                   /product="RIKEN cDNA 4632415L05"
FT                   /note="gene_id=mCG19777.1 transcript_id=mCT22162.1 created
FT                   on 19-AUG-2002"
FT   CDS             4004873..4005241
FT                   /codon_start=1
FT                   /gene="4632415L05Rik"
FT                   /locus_tag="mCG_19777"
FT                   /product="RIKEN cDNA 4632415L05"
FT                   /note="gene_id=mCG19777.1 transcript_id=mCT22162.1
FT                   protein_id=mCP2104.2"
FT                   /db_xref="MGI:MGI:1918058"
FT                   /db_xref="UniProtKB/TrEMBL:Q78IR3"
FT                   /protein_id="EDL34882.1"
FT                   /translation="MEGQSAEMLQARWRRRSCSASQCTKSWSKNSTLAPYRLRTALPDR
FT                   PSCRPWRGTARSCSSPCCCRPCAGGGGGSALAGALHSLAPREAAIRAAAAHPLAAVRAS
FT                   SEHPPKKTTFLWDEVSGQ"
FT   assembly_gap    4021172..4021357
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    4027458..4031426
FT                   /estimated_length=3969
FT                   /gap_type="unknown"
FT   assembly_gap    4033761..4033780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4036210..4038712
FT                   /estimated_length=2503
FT                   /gap_type="unknown"
FT   gene            4044680..4046628
FT                   /pseudo
FT                   /locus_tag="mCG_1049429"
FT                   /note="gene_id=mCG1049429.1"
FT   mRNA            4044680..4046628
FT                   /pseudo
FT                   /locus_tag="mCG_1049429"
FT                   /note="gene_id=mCG1049429.1 transcript_id=mCT167133.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    4050643..4050662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4067958..4119755
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /note="gene_id=mCG19773.2"
FT   mRNA            join(4067958..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4116430..4116534,4119503..4119755)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT172192"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172192.0 created
FT                   on 19-AUG-2002"
FT   mRNA            join(4067958..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085748..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4103398..4103824)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT22158"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT22158.1 created
FT                   on 19-AUG-2002"
FT   mRNA            join(<4068000..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4116430..4116534,4117513..4118073)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT193305"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT193305.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4068069..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4103398..4103479)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT172195"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172195.0 created
FT                   on 19-AUG-2002"
FT   mRNA            join(4068069..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100489)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT172194"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172194.0 created
FT                   on 19-AUG-2002"
FT   CDS             join(<4068105..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4116430..4116521)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_c"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT193305.0
FT                   protein_id=mCP114274.0 isoform=CRA_c"
FT                   /protein_id="EDL34885.1"
FT                   /translation="SPIYKIACFWFHFIASWAPRGRKMKFLLLSTFIFLYSSLALARDK
FT                   HYFIGITEAVWDYASGTEEKKLISVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFS
FT                   KTIDKPAWLGFLGPVIKAEVEDKVYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTT
FT                   DFQRADDKVLPGQQYVYVLHANEPSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILC
FT                   KKGSLYKEKEKNIDQEFVLMFSVVDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRM
FT                   YSINGYTFGSLPGLSMCAADRVKWYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFP
FT                   ATLIDAYMVAQNPGVWMLSCQNLNHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIA
FT                   AEEVIWNYAPSGTDIFTGENLTALESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNR
FT                   KQRGPDEEHLGILGPVIWAEVGDTIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPG
FT                   RSSQQASHVAPKETFTYEWTVPKEMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKI
FT                   CKKGSLLADGRQKDVDKEFYLFPTVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESN
FT                   KMHSMNGFMYGNQPGLNMCLGESIVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANL
FT                   FPHKSLTLLMNPDTKGTFDVECLTTDHYTGGMKQKYTVNQCQRQFEDFTVYLGERTYYV
FT                   AAVEVEWDYSPSRAWEKELHHLQEQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQ
FT                   VKRRAEDEHLGILGPPIHANVGDKVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEV
FT                   RTYTWQIPERSGAGREDSACIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKK
FT                   MEFFLLFLVFDENESWYLDDNIKTYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGL
FT                   TMHVKDEVNWYVMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQ
FT                   TPGTWLLHCHVTDHVHAGMATTYTVLPVEQVSSQSYRMTWNILYTLLISIIILFQMSTK
FT                   E"
FT   CDS             join(4068174..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4116430..4116521)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_a"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172192.0
FT                   protein_id=mCP95112.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8Q5"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR024715"
FT                   /db_xref="InterPro:IPR027150"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="MGI:MGI:88476"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q5"
FT                   /protein_id="EDL34883.1"
FT                   /translation="MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLI
FT                   SVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDK
FT                   VYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANE
FT                   PSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCKKGSLYKEKEKNIDQEFVLMFSV
FT                   VDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVK
FT                   WYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNL
FT                   NHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTA
FT                   LESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGD
FT                   TIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQASHVAPKETFTYEWTVPK
FT                   EMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFP
FT                   TVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGES
FT                   IVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECL
FT                   TTDHYTGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQ
FT                   EQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVGD
FT                   KVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPW
FT                   AYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENESWYLDDNIK
FT                   TYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLHT
FT                   VHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTY
FT                   TVLPVEQVSSQSYRMTWNILYTLLISIIILFQMSTKE"
FT   CDS             join(4068174..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085748..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4103398..4103414)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_d"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT22158.1
FT                   protein_id=mCP2072.1 isoform=CRA_d"
FT                   /protein_id="EDL34886.1"
FT                   /translation="MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLI
FT                   SVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDK
FT                   VYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANE
FT                   PSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCKKGSLYKEKEKNIDQEFVLMFSV
FT                   VDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVK
FT                   WYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNL
FT                   NHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTA
FT                   LESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGD
FT                   TIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQAASHVAPKETFTYEWTVP
FT                   KEMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLF
FT                   PTVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGE
FT                   SIVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVEC
FT                   LTTDHYTGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHL
FT                   QEQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVG
FT                   DKVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIP
FT                   WAYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENESWYLDDNI
FT                   KTYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLH
FT                   TVHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATT
FT                   YTVLPVEQETKSG"
FT   CDS             join(4068174..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4103398..4103414)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_f"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172195.0
FT                   protein_id=mCP95113.0 isoform=CRA_f"
FT                   /db_xref="GOA:G3X9T8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR024715"
FT                   /db_xref="InterPro:IPR027150"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="MGI:MGI:88476"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9T8"
FT                   /protein_id="EDL34888.1"
FT                   /translation="MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLI
FT                   SVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDK
FT                   VYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANE
FT                   PSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCKKGSLYKEKEKNIDQEFVLMFSV
FT                   VDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVK
FT                   WYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNL
FT                   NHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTA
FT                   LESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGD
FT                   TIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQASHVAPKETFTYEWTVPK
FT                   EMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFP
FT                   TVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGES
FT                   IVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECL
FT                   TTDHYTGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQ
FT                   EQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVGD
FT                   KVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPW
FT                   AYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENESWYLDDNIK
FT                   TYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLHT
FT                   VHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTY
FT                   TVLPVEQETKSG"
FT   CDS             join(4068174..4068319,4075170..4075417,4077129..4077338,
FT                   4078929..4079102,4080665..4080919,4081801..4081972,
FT                   4083504..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100121)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_b"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172194.0
FT                   protein_id=mCP95114.0 isoform=CRA_b"
FT                   /protein_id="EDL34884.1"
FT                   /translation="MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLI
FT                   SVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDK
FT                   VYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANE
FT                   PSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCKKGSLYKEKEKNIDQEFVLMFSV
FT                   VDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVK
FT                   WYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNL
FT                   NHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTA
FT                   LESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGD
FT                   TIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQASHVAPKETFTYEWTVPK
FT                   EMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFP
FT                   TVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGES
FT                   IVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECL
FT                   TTDHYTGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQ
FT                   EQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVGD
FT                   KVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPW
FT                   AYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENESWYLDDNIK
FT                   TYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLHT
FT                   VHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTY
FT                   TVLPVEQGKSR"
FT   mRNA            join(4081525..4081972,4083504..4083643,4084666..4084818,
FT                   4085751..4085947,4087985..4088135,4089749..4089961,
FT                   4091480..4091687,4092852..4092991,4094282..4094410,
FT                   4096449..4096555,4098248..4098464,4098822..4098961,
FT                   4099942..4100107,4103398..4103471)
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, transcript variant mCT172193"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172193.0 created
FT                   on 19-AUG-2002"
FT   CDS             join(4083562..4083643,4084666..4084818,4085751..4085947,
FT                   4087985..4088135,4089749..4089961,4091480..4091687,
FT                   4092852..4092991,4094282..4094410,4096449..4096555,
FT                   4098248..4098464,4098822..4098961,4099942..4100107,
FT                   4103398..4103414)
FT                   /codon_start=1
FT                   /gene="Cp"
FT                   /locus_tag="mCG_19773"
FT                   /product="ceruloplasmin, isoform CRA_e"
FT                   /note="gene_id=mCG19773.2 transcript_id=mCT172193.0
FT                   protein_id=mCP95111.0 isoform=CRA_e"
FT                   /protein_id="EDL34887.1"
FT                   /translation="MAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGDTIKVTFHN
FT                   KGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQASHVAPKETFTYEWTVPKEMGPTYAD
FT                   PVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFPTVFDENES
FT                   LLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGESIVWYLFSA
FT                   GNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECLTTDHYTGG
FT                   MKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQEQNVSNVF
FT                   LDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVGDKVKVVFKN
FT                   MATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPWAYYSTVDR
FT                   VKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENESWYLDDNIKTYSEHPEK
FT                   VNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLHTVHFHGHSF
FT                   QYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTYTVLPVEQE
FT                   TKSG"
FT   assembly_gap    4105634..4105653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4106907..4146353)
FT                   /gene="Hps3"
FT                   /locus_tag="mCG_123402"
FT                   /note="gene_id=mCG123402.1"
FT   mRNA            complement(join(4106907..4107986,4113286..4113376,
FT                   4114188..4114394,4119778..4119885,4121763..4121951,
FT                   4122352..4122537,4123660..4123893,4124986..4125166,
FT                   4126789..4126970,4129774..4129882,4130766..4130920,
FT                   4133721..4133802,4136694..4136883,4139923..4140008,
FT                   4140110..4140281,4141278..4141769,4146103..4146353))
FT                   /gene="Hps3"
FT                   /locus_tag="mCG_123402"
FT                   /product="Hermansky-Pudlak syndrome 3 homolog (human)"
FT                   /note="gene_id=mCG123402.1 transcript_id=mCT124634.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(4107859..4107986,4113286..4113376,
FT                   4114188..4114394,4119778..4119885,4121763..4121951,
FT                   4122352..4122537,4123660..4123893,4124986..4125166,
FT                   4126789..4126970,4129774..4129882,4130766..4130920,
FT                   4133721..4133802,4136694..4136883,4139923..4140008,
FT                   4140110..4140281,4141278..4141769,4146103..4146319))
FT                   /codon_start=1
FT                   /gene="Hps3"
FT                   /locus_tag="mCG_123402"
FT                   /product="Hermansky-Pudlak syndrome 3 homolog (human)"
FT                   /note="gene_id=mCG123402.1 transcript_id=mCT124634.1
FT                   protein_id=mCP79343.1"
FT                   /db_xref="GOA:Q91VB4"
FT                   /db_xref="InterPro:IPR017216"
FT                   /db_xref="InterPro:IPR028167"
FT                   /db_xref="InterPro:IPR029437"
FT                   /db_xref="InterPro:IPR029438"
FT                   /db_xref="MGI:MGI:2153839"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VB4"
FT                   /protein_id="EDL34889.1"
FT                   /translation="MVRLYNLHPFGSQQVVPCQWEPEQVCCGGSDALFVAAGCKVEAFA
FT                   VQGEELCRQRCAFSTLGRVLRMAYSEAGDYLVAIEEKNKTIFLRAYVNWRSKRSDNSRV
FT                   CIRMVGHNVEASFCESFRDQMSIIEMPMSEAPLCFSCCPVKGDLLVGCTNKLVLFTLKY
FT                   DIINEEFSILNFERSLIIHIDNITPVEISFCVGYVAVMSDLEVLLLKLESDPIHGESVD
FT                   HHPQETSNPLKEAEGVSNETSQLESEDFVICLKPMELIGEKCEQSGISVKLESTGLEDE
FT                   KVKYLRVRHLLYRRFAPDISSYVLSDNIKLHSLQLLPIHQSGFHPDENDLSPKKEMPNL
FT                   FCFFSLPHVGYLYMVVKSVELMSVYWYPEKSQQAVLTPQFLHVITSQSLQCFTVRCSAA
FT                   VAHEEDLYMDTTLKACPPVSMDVCALRIQLFIGLKAICHFKNHIILLTKAEPEAIPERR
FT                   ESPKKLISRKDASVRSGTPHVAEAAWNLYLVNTTAPVQLYKEMVDYSNSYKTVKTESCL
FT                   HLLSEAHLLVRAALMDGSQLEPAEKAELLEAFKESCGHLGDCYSRLTTEQSHLALPYYK
FT                   MSGLSLAEVLARVDWTEESESQKYERGLVFYINHSLYENLDEELSKELAAKVAQIFHMA
FT                   EPKQLPHVLSSPSMKNIDPLTALHYLRKLDSCGVSPVLVTLTKAAVALKMGDLDMYRNE
FT                   MKSHSEMKLVYGFILEPRLLIQQWKGQIVPTELAIDLKETQPGLLVASVLGLQKNDKIG
FT                   IVETDSFFKVLCGKDEDAVPQLLIDFWEAQLVACLPNVVLEELFFKLISQYVWRLSERR
FT                   CPDTVPLRTAEDLINACSHYGLVNPWVHVLTTSDSLADKNYTDDLLKLQSLICSPSLDV
FT                   ASIIPFLEPLSEDTVAGLSTHALCHTRLQEYEQCIDTLLERCPEAVIAYANQELKEDHW
FT                   ILWWKKLLPELCQRVKSGGERSHLHLSLLKETLSVIAVGLDLRDFLNVLPEDGAAAFFL
FT                   PYLLFCSRKKSLT"
FT   assembly_gap    4109811..4109830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4144081..4144571
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    4146657..4146676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4168868..4229256
FT                   /locus_tag="mCG_123397"
FT                   /note="gene_id=mCG123397.1"
FT   mRNA            join(4168868..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4209116..4209251,4210812..4210991,
FT                   4216681..4216805,4217390..4217568,4219038..4219163,
FT                   4219795..4219907,4220345..4220525,4224396..4224476,
FT                   4227494..4229256)
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, transcript variant mCT124629"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT124629.1
FT                   created on 19-AUG-2002"
FT   mRNA            join(4168868..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4209116..4209251,4210812..4210991,
FT                   4216681..4216805,4217390..4217568,4219038..4219561)
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, transcript variant mCT172131"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172131.0
FT                   created on 19-AUG-2002"
FT   mRNA            join(4168961..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4216681..4216805,4217390..4217501)
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, transcript variant mCT172132"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172132.0
FT                   created on 19-AUG-2002"
FT   CDS             join(4169042..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4209116..4209251,4210812..4210991,
FT                   4216681..4216805,4217390..4217568,4219038..4219163,
FT                   4219795..4219907,4220345..4220525,4224396..4224476,
FT                   4227494..4227646)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, isoform CRA_c"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT124629.1
FT                   protein_id=mCP79251.0 isoform=CRA_c"
FT                   /protein_id="EDL34892.1"
FT                   /translation="MSYTFTRGPVWKYSQSVQYGSHENIPRLSYSTFLPHFEFQDIIPP
FT                   DDFLTSDEEQDLVLFGTMRGQVVGLRYYTGVVNNNEMVALQREPNNPYDKNAIKVNNVN
FT                   GNQVGHIKREIAAAVAYIMDNKLAQVEGVVPFGASNTFTMPLYMTFWGKEENRNVVLEQ
FT                   LKKHGFKLGPTPKTLGSSLENAWGSGRAGPSYSRPAHVAVQMTTDQLKTEFDKLFEDLK
FT                   EDDRTVEMEPAEAIETPLLPHQKQALAWMIARENSKELPPFWEQRNDLYYNTITNFSVK
FT                   ERPENVHGGILADDMGLGKTLTAIAVILTNFDDGRPLLSKRGKKNHPGKEYKDETIKRR
FT                   GSNMDKKEDGHSESSTCGEEPSISGTPEKSSCTLSQLSSVCPKRRKISVQYIESSDSEE
FT                   IETSELPQKMKGKLKNVQLNTKSRVKGSSKVKEDSKFALTFFASATQRKMLKKGMSMME
FT                   CSEACDTGERTRATLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDRIRDSAWLSK
FT                   QDIILTTYNILTHDYGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRW
FT                   VLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWYRIIQRPVTTGDEGGLRRLQSLIKNIT
FT                   LRRTKTSKIKGKPVLELPERKVFIQHITLSEEERKIYQSVKNEGKAAIGRYFTEGTVLA
FT                   HYADVLGLLLRLRQICCHTHLLTNGMSSSGPSRSDTPEELRKMLIEKMKIILSSGSDEE
FT                   CAICLDSLTFPVITHCAHVFCKPCICQVIHSEQPHAKCPLCRNEIHGDNLLECPPEELA
FT                   CDSDKESSMEWKSSSKINALMHALIELRTKDPNIKSLVVSQFTTFLSLIETPLKASGFV
FT                   FTRLDGSMAQKKRVESIQRFQNTEAGSPTIMLLSLKAGGVGLNLCAASRVFLMDPAWNP
FT                   AAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNTKRDLAAGAFGTKKTDANDM
FT                   KQAKINEIRTLIDL"
FT   CDS             join(4169042..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4209116..4209251,4210812..4210991,
FT                   4216681..4216805,4217390..4217568,4219038..4219205)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, isoform CRA_b"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172131.0
FT                   protein_id=mCP95051.0 isoform=CRA_b"
FT                   /protein_id="EDL34891.1"
FT                   /translation="MSYTFTRGPVWKYSQSVQYGSHENIPRLSYSTFLPHFEFQDIIPP
FT                   DDFLTSDEEQDLVLFGTMRGQVVGLRYYTGVVNNNEMVALQREPNNPYDKNAIKVNNVN
FT                   GNQVGHIKREIAAAVAYIMDNKLAQVEGVVPFGASNTFTMPLYMTFWGKEENRNVVLEQ
FT                   LKKHGFKLGPTPKTLGSSLENAWGSGRAGPSYSRPAHVAVQMTTDQLKTEFDKLFEDLK
FT                   EDDRTVEMEPAEAIETPLLPHQKQALAWMIARENSKELPPFWEQRNDLYYNTITNFSVK
FT                   ERPENVHGGILADDMGLGKTLTAIAVILTNFDDGRPLLSKRGKKNHPGKEYKDETIKRR
FT                   GSNMDKKEDGHSESSTCGEEPSISGTPEKSSCTLSQLSSVCPKRRKISVQYIESSDSEE
FT                   IETSELPQKMKGKLKNVQLNTKSRVKGSSKVKEDSKFALTFFASATQRKMLKKGMSMME
FT                   CSEACDTGERTRATLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDRIRDSAWLSK
FT                   QDIILTTYNILTHDYGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRW
FT                   VLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWYRIIQRPVTTGDEGGLRRLQSLIKNIT
FT                   LRRTKTSKIKGKPVLELPERKVFIQHITLSEEERKIYQSVKNEGKAAIGRYFTEGTVLA
FT                   HYADVLGLLLRLRQICCHTHLLTNGMSSSGPSRSDTPEELRKMLIEKMKIILSSGSDEE
FT                   CAICLDSLTFPVITHCAHVFCKPCICQVIHSEQPHAKCPLCRNEIHGDNLLECPPEELA
FT                   CDSDKESSMEWKSSSKVKSTCVNILMFHT"
FT   CDS             join(4169042..4169061,4169954..4170161,4174853..4175019,
FT                   4175601..4175734,4176357..4176454,4178381..4178455,
FT                   4180001..4180192,4183404..4183499,4185864..4185930,
FT                   4187528..4187621,4193789..4193868,4193948..4193992,
FT                   4194787..4194867,4197133..4197230,4202513..4202656,
FT                   4203714..4203852,4216681..4216805,4217390..4217413)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, isoform CRA_d"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172132.0
FT                   protein_id=mCP95050.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3UVU1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1196437"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVU1"
FT                   /protein_id="EDL34893.1"
FT                   /translation="MSYTFTRGPVWKYSQSVQYGSHENIPRLSYSTFLPHFEFQDIIPP
FT                   DDFLTSDEEQDLVLFGTMRGQVVGLRYYTGVVNNNEMVALQREPNNPYDKNAIKVNNVN
FT                   GNQVGHIKREIAAAVAYIMDNKLAQVEGVVPFGASNTFTMPLYMTFWGKEENRNVVLEQ
FT                   LKKHGFKLGPTPKTLGSSLENAWGSGRAGPSYSRPAHVAVQMTTDQLKTEFDKLFEDLK
FT                   EDDRTVEMEPAEAIETPLLPHQKQALAWMIARENSKELPPFWEQRNDLYYNTITNFSVK
FT                   ERPENVHGGILADDMGLGKTLTAIAVILTNFDDGRPLLSKRGKKNHPGKEYKDETIKRR
FT                   GSNMDKKEDGHSESSTCGEEPSISGTPEKSSCTLSQLSSVCPKRRKISVQYIESSDSEE
FT                   IETSELPQKMKGKLKNVQLNTKSRVKGSSKVKEDSKFALTFFASATQRKMLKKGMSMME
FT                   CSEACDTGERTRATLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDRIRDSAWLSK
FT                   QDIILTTYNILTHDYGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRW
FT                   VLTGILLKGLSLHTMQMSWVFCLDCGRFVAIPIFLQTECLQVAPPEVTRLKS"
FT   mRNA            join(4219519..4219907,4220345..4220525,4224396..4224476,
FT                   4227494..4229256)
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, transcript variant mCT172130"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172130.0
FT                   created on 19-AUG-2002"
FT   CDS             join(4219768..4219907,4220345..4220525,4224396..4224476,
FT                   4227494..4227646)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123397"
FT                   /product="mCG123397, isoform CRA_a"
FT                   /note="gene_id=mCG123397.1 transcript_id=mCT172130.0
FT                   protein_id=mCP95049.0 isoform=CRA_a"
FT                   /protein_id="EDL34890.1"
FT                   /translation="MDTIFSLFQINALMHALIELRTKDPNIKSLVVSQFTTFLSLIETP
FT                   LKASGFVFTRLDGSMAQKKRVESIQRFQNTEAGSPTIMLLSLKAGGVGLNLCAASRVFL
FT                   MDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNTKRDLAAGAFGTK
FT                   KTDANDMKQAKINEIRTLIDL"
FT   assembly_gap    4231729..4231748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4232992..4266211)
FT                   /gene="Gyg"
FT                   /locus_tag="mCG_21888"
FT                   /note="gene_id=mCG21888.2"
FT   mRNA            complement(join(4232992..4233771,4236165..4236384,
FT                   4248924..4249050,4261456..4261618,4261870..4262044,
FT                   4263647..4263782,4265915..4266211))
FT                   /gene="Gyg"
FT                   /locus_tag="mCG_21888"
FT                   /product="glycogenin, transcript variant mCT21643"
FT                   /note="gene_id=mCG21888.2 transcript_id=mCT21643.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(4233598..4233771,4236165..4236384,
FT                   4248924..4249050,4261456..4261618,4261870..4262044,
FT                   4263647..4263782,4265915..4265921))
FT                   /codon_start=1
FT                   /gene="Gyg"
FT                   /locus_tag="mCG_21888"
FT                   /product="glycogenin, isoform CRA_a"
FT                   /note="gene_id=mCG21888.2 transcript_id=mCT21643.1
FT                   protein_id=mCP2095.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9R062"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1351614"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R062"
FT                   /protein_id="EDL34894.1"
FT                   /translation="MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSD
FT                   SMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDAD
FT                   TLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGD
FT                   QGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPWNY
FT                   TYNPQTKSVNCDSQDPTVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDASSYLMMEHVSG
FT                   ALSDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ"
FT   mRNA            complement(join(4236165..4236342,4248998..4249050,
FT                   4261456..4261618,4261870..4261923,4263650..4263782,
FT                   4265915..4266211))
FT                   /gene="Gyg"
FT                   /locus_tag="mCG_21888"
FT                   /product="glycogenin, transcript variant mCT172208"
FT                   /note="gene_id=mCG21888.2 transcript_id=mCT172208.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(4249030..4249050,4261456..4261618,
FT                   4261870..4261923,4263650..4263782,4265915..4265921))
FT                   /codon_start=1
FT                   /gene="Gyg"
FT                   /locus_tag="mCG_21888"
FT                   /product="glycogenin, isoform CRA_b"
FT                   /note="gene_id=mCG21888.2 transcript_id=mCT172208.0
FT                   protein_id=mCP95127.0 isoform=CRA_b"
FT                   /protein_id="EDL34895.1"
FT                   /translation="MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSD
FT                   SIAGHLLSIPNVCSWMQILWSSQILMICLKEKNYQQHQTQGGLTVSILESLSINPPLKR
FT                   ITSCCIWLLSKVVLMVGTRAY"
FT   gene            complement(4326532..4353094)
FT                   /gene="Cpa3"
FT                   /locus_tag="mCG_21886"
FT                   /note="gene_id=mCG21886.2"
FT   mRNA            complement(join(4326532..4326907,4330670..4330754,
FT                   4333002..4333204,4334147..4334237,4336002..4336112,
FT                   4338080..4338181,4339723..4339824,4339929..4340031,
FT                   4350467..4350591,4352828..4352903,4353017..4353094))
FT                   /gene="Cpa3"
FT                   /locus_tag="mCG_21886"
FT                   /product="carboxypeptidase A3, mast cell"
FT                   /note="gene_id=mCG21886.2 transcript_id=mCT21641.1 created
FT                   on 19-SEP-2002"
FT   CDS             complement(join(4326720..4326907,4330670..4330754,
FT                   4333002..4333204,4334147..4334237,4336002..4336112,
FT                   4338080..4338181,4339723..4339824,4339929..4340031,
FT                   4350467..4350591,4352828..4352903,4353017..4353084))
FT                   /codon_start=1
FT                   /gene="Cpa3"
FT                   /locus_tag="mCG_21886"
FT                   /product="carboxypeptidase A3, mast cell"
FT                   /note="gene_id=mCG21886.2 transcript_id=mCT21641.1
FT                   protein_id=mCP2083.1"
FT                   /db_xref="GOA:Q542E3"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR003146"
FT                   /db_xref="InterPro:IPR036990"
FT                   /db_xref="MGI:MGI:88479"
FT                   /db_xref="UniProtKB/TrEMBL:Q542E3"
FT                   /protein_id="EDL34896.1"
FT                   /translation="MRFFLLMAVIYTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQ
FT                   SIELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF
FT                   DVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKD
FT                   GERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDG
FT                   YIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEK
FT                   ETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALST
FT                   RYETRYIYGPIASTIYKTSGSSLDWVYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCK
FT                   ETMLSVKFIAKYILKNTS"
FT   gene            complement(4334723..4335579)
FT                   /pseudo
FT                   /locus_tag="mCG_123401"
FT                   /note="gene_id=mCG123401.1"
FT   mRNA            complement(4334723..4335579)
FT                   /pseudo
FT                   /locus_tag="mCG_123401"
FT                   /note="gene_id=mCG123401.1 transcript_id=mCT124633.1
FT                   created on 19-AUG-2002"
FT   gene            complement(4359982..4386512)
FT                   /gene="Cpb1"
FT                   /locus_tag="mCG_21890"
FT                   /note="gene_id=mCG21890.1"
FT   mRNA            complement(join(4359982..4360736,4362853..4362937,
FT                   4373204..4373406,4374304..4374394,4374476..4374586,
FT                   4376147..4376248,4377024..4377125,4377222..4377321,
FT                   4381041..4381165,4386216..4386291,4386382..4386512))
FT                   /gene="Cpb1"
FT                   /locus_tag="mCG_21890"
FT                   /product="carboxypeptidase B1 (tissue), transcript variant
FT                   mCT21645"
FT                   /note="gene_id=mCG21890.1 transcript_id=mCT21645.2 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(4360549..4360736,4362853..4362937,
FT                   4373204..4373406,4374304..4374394,4374476..4374586,
FT                   4376147..4376248,4377024..4377125,4377222..4377321,
FT                   4381041..4381165,4386216..4386291,4386382..4386446))
FT                   /codon_start=1
FT                   /gene="Cpb1"
FT                   /locus_tag="mCG_21890"
FT                   /product="carboxypeptidase B1 (tissue), isoform CRA_b"
FT                   /note="gene_id=mCG21890.1 transcript_id=mCT21645.2
FT                   protein_id=mCP2116.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RS76"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR003146"
FT                   /db_xref="InterPro:IPR034253"
FT                   /db_xref="InterPro:IPR036990"
FT                   /db_xref="MGI:MGI:1923953"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS76"
FT                   /protein_id="EDL34898.1"
FT                   /translation="MLLLLALVSVALAHASEENFDGNRVFRVSVHDEDDVSLIQELANT
FT                   KQIDFWKPDSATQVKPLTTVDFHVKAEDVVDVENFLEENEVLYEVLISNVKHILESQFD
FT                   SHTRASGHSYTKYNNWETIEAWIQQVANDNPDLVSKRVIGTTFEGRNMYVLKIGKDRPN
FT                   KPAFFIDCGFHAREWISPAFCQWFVREAVRTYKQEIHMKRLLDELDFYVLPVVNIDGYV
FT                   YTWAKDRMWRKTRSTTAGSSCFGVDPNRNFDAGWCEVGASRSPCSDTYCGPTPESEKET
FT                   KALADFIRQNLSSIKAYLTVHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKELSTLH
FT                   GTKYTYGPGATTIYPAAGGSDDWAYDQGIKYSFTFELRDKGFFGFLLPESQIRQTCEET
FT                   MLAVKYIANYVLEHPY"
FT   assembly_gap    4366071..4366812
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4374987..4375269,4376147..4376248,
FT                   4377024..4377125,4377222..4377321,4381041..4381165,
FT                   4386216..4386291,4386382..4386465))
FT                   /gene="Cpb1"
FT                   /locus_tag="mCG_21890"
FT                   /product="carboxypeptidase B1 (tissue), transcript variant
FT                   mCT172209"
FT                   /note="gene_id=mCG21890.1 transcript_id=mCT172209.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(4375264..4375269,4376147..4376248,
FT                   4377024..4377125,4377222..4377321,4381041..4381165,
FT                   4386216..4386291,4386382..4386446))
FT                   /codon_start=1
FT                   /gene="Cpb1"
FT                   /locus_tag="mCG_21890"
FT                   /product="carboxypeptidase B1 (tissue), isoform CRA_a"
FT                   /note="gene_id=mCG21890.1 transcript_id=mCT172209.0
FT                   protein_id=mCP95128.0 isoform=CRA_a"
FT                   /protein_id="EDL34897.1"
FT                   /translation="MLLLLALVSVALAHASEENFDGNRVFRVSVHDEDDVSLIQELANT
FT                   KQIDFWKPDSATQVKPLTTVDFHVKAEDVVDVENFLEENEVLYEVLISNVKHILESQFD
FT                   SHTRASGHSYTKYNNWETIEAWIQQVANDNPDLVSKRVIGTTFEGRNMYVLKIGKDRPN
FT                   KPAFFIDCGFHAREWISPAFCQWFVREL"
FT   gene            complement(4425272..4477780)
FT                   /gene="Agtr1b"
FT                   /locus_tag="mCG_1049430"
FT                   /note="gene_id=mCG1049430.1"
FT   mRNA            complement(join(4425272..4427274,4477637..4477780))
FT                   /gene="Agtr1b"
FT                   /locus_tag="mCG_1049430"
FT                   /product="angiotensin II receptor, type 1b"
FT                   /note="gene_id=mCG1049430.1 transcript_id=mCT167134.1
FT                   created on 28-JUN-2004"
FT   CDS             complement(4426160..4427239)
FT                   /codon_start=1
FT                   /gene="Agtr1b"
FT                   /locus_tag="mCG_1049430"
FT                   /product="angiotensin II receptor, type 1b"
FT                   /note="gene_id=mCG1049430.1 transcript_id=mCT167134.1
FT                   protein_id=mCP79708.1"
FT                   /protein_id="EDL34899.1"
FT                   /translation="MILNSSIEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFG
FT                   NSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYQWPFGNHLCKIA
FT                   SASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPA
FT                   VIHRNVYFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFVFPFVIILTSYTLIWKAL
FT                   KKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFSFLDVLIQLGVIHDCEIADVVD
FT                   TAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKARSHAGLSTKMSTLSYR
FT                   PSDNMSSSARKSAYCFEVE"
FT   assembly_gap    4428803..4428822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4438888..4439087
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    4446139..4446158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4463299..4463318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4468981..4471962
FT                   /estimated_length=2982
FT                   /gap_type="unknown"
FT   assembly_gap    4479624..4479689
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    4493674..4493693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4496684..4496832
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    4513997..4514016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4521900..4522122
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    4584312..4584442
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    4612369..4612904
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    4616928..4617548
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    4619730..4619749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4645910..4645929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4651092..4651269
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    4710409..4710428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4721955..4722044
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    4726241..4730730
FT                   /estimated_length=4490
FT                   /gap_type="unknown"
FT   assembly_gap    4742015..4742180
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4744316..4746662
FT                   /estimated_length=2347
FT                   /gap_type="unknown"
FT   assembly_gap    4747915..4754751
FT                   /estimated_length=6837
FT                   /gap_type="unknown"
FT   assembly_gap    4765066..4765085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4786726..4790157
FT                   /estimated_length=3432
FT                   /gap_type="unknown"
FT   assembly_gap    4796042..4801604
FT                   /estimated_length=5563
FT                   /gap_type="unknown"
FT   assembly_gap    4817559..4817645
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4818462..4819081
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    4836633..4836652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4842451..4842470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4858691..4859067
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    4899338..4899357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4917217..4918880
FT                   /pseudo
FT                   /locus_tag="mCG_140989"
FT                   /note="gene_id=mCG140989.0"
FT   mRNA            4917217..4918880
FT                   /pseudo
FT                   /locus_tag="mCG_140989"
FT                   /note="gene_id=mCG140989.0 transcript_id=mCT172606.0
FT                   created on 06-SEP-2002"
FT   assembly_gap    4951137..4951370
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    4958362..4960407
FT                   /estimated_length=2046
FT                   /gap_type="unknown"
FT   assembly_gap    4997385..4997561
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    5035807..5036245
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    5037384..5037403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5039162..5039944
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    5049628..5050385
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    5051145..5051249
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    5064103..5064122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5065287..5065306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5067098..5073772
FT                   /estimated_length=6675
FT                   /gap_type="unknown"
FT   assembly_gap    5079171..5079190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5080548..5080567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5087108..5087127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5088835..5088854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5090444..5090463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5091925..5091944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5111641..5112563
FT                   /estimated_length=923
FT                   /gap_type="unknown"
FT   assembly_gap    5113689..5117297
FT                   /estimated_length=3609
FT                   /gap_type="unknown"
FT   assembly_gap    5123809..5123828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5131518..5131681
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    5142766..5143224
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    5149245..5149264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5152274..5152293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5154457..5154589
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    5164804..5164823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5172615..5173776
FT                   /estimated_length=1162
FT                   /gap_type="unknown"
FT   assembly_gap    5180817..5180836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5181869..5181888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5204994..5205013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5206361..5206380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5220113..5220132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5221415..5221434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5222540..5230140
FT                   /estimated_length=7601
FT                   /gap_type="unknown"
FT   assembly_gap    5231876..5231895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5239869..5239888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5241274..5241293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5248770..5248789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5252291..5252419
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5294633..5294652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5319387..5319406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5368706..5369167
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    5392672..5392691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5448477..5448496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5457006..5457025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5497015..5497334
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    5503401..5503420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5509615..5513402
FT                   /estimated_length=3788
FT                   /gap_type="unknown"
FT   assembly_gap    5520379..5520398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5528568..5528587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5536700..5536719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5543772..5543791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5576102..5576121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5579140..5580927
FT                   /estimated_length=1788
FT                   /gap_type="unknown"
FT   assembly_gap    5583093..5584582
FT                   /estimated_length=1490
FT                   /gap_type="unknown"
FT   assembly_gap    5609191..5609210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5609567..5611067
FT                   /pseudo
FT                   /locus_tag="mCG_49509"
FT                   /note="gene_id=mCG49509.2"
FT   mRNA            5609567..5611067
FT                   /pseudo
FT                   /locus_tag="mCG_49509"
FT                   /note="gene_id=mCG49509.2 transcript_id=mCT49692.2 created
FT                   on 06-SEP-2002"
FT   assembly_gap    5611398..5611417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5614348..5614367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5617884..5617903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5647125..5648602
FT                   /estimated_length=1478
FT                   /gap_type="unknown"
FT   assembly_gap    5651992..5652011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5698622..5698641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5711298..5711317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5727793..5727812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5738542..5740082
FT                   /pseudo
FT                   /locus_tag="mCG_1049528"
FT                   /note="gene_id=mCG1049528.0"
FT   mRNA            join(5738542..5738914,5739012..5739086,5739663..5740082)
FT                   /pseudo
FT                   /locus_tag="mCG_1049528"
FT                   /note="gene_id=mCG1049528.0 transcript_id=mCT167232.0
FT                   created on 06-SEP-2002"
FT   assembly_gap    5757905..5757957
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    5766925..5766944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5823182..5824717
FT                   /estimated_length=1536
FT                   /gap_type="unknown"
FT   assembly_gap    5855091..5855573
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    5876980..5876999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5886708..>5934398)
FT                   /locus_tag="mCG_144903"
FT                   /note="gene_id=mCG144903.0"
FT   mRNA            complement(join(5886708..5887138,5909247..5909460,
FT                   5934278..>5934398))
FT                   /locus_tag="mCG_144903"
FT                   /product="mCG144903"
FT                   /note="gene_id=mCG144903.0 transcript_id=mCT184327.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(5886799..>5887035)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144903"
FT                   /product="mCG144903"
FT                   /note="gene_id=mCG144903.0 transcript_id=mCT184327.0
FT                   protein_id=mCP105157.0"
FT                   /protein_id="EDL34900.1"
FT                   /translation="GRRQATVAAVRSLNLKQEKKISFTQRCAAQVKCSFRTVPVDLILE
FT                   SQVVLFLTALPNWVCFLYLHIPIHSSYSLDDNK"
FT   assembly_gap    5896592..5897484
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    5917280..5917673
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    5967180..5967252
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    5981704..5981813
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6025398..6026114
FT                   /estimated_length=717
FT                   /gap_type="unknown"
FT   assembly_gap    6085875..6085894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6112580..6112670
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6120113..6120139
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6126256..6126460
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    6145283..6145302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6152373..6152392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6154591..6155053
FT                   /pseudo
FT                   /locus_tag="mCG_55829"
FT                   /note="gene_id=mCG55829.2"
FT   mRNA            6154591..6155053
FT                   /pseudo
FT                   /locus_tag="mCG_55829"
FT                   /note="gene_id=mCG55829.2 transcript_id=mCT56012.2 created
FT                   on 06-SEP-2002"
FT   assembly_gap    6164675..6164928
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    6170911..6171817
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    6184239..6184722
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    6187404..6187671
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    6203777..6204024
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    6207504..6207523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6209202..6209605)
FT                   /locus_tag="mCG_148187"
FT                   /note="gene_id=mCG148187.0"
FT   mRNA            complement(6209202..6209605)
FT                   /locus_tag="mCG_148187"
FT                   /product="mCG148187"
FT                   /note="gene_id=mCG148187.0 transcript_id=mCT188450.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6209389..6209490)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148187"
FT                   /product="mCG148187"
FT                   /note="gene_id=mCG148187.0 transcript_id=mCT188450.0
FT                   protein_id=mCP108115.0"
FT                   /protein_id="EDL34901.1"
FT                   /translation="MDSAFKVPHTWMRVNTPAPERTWKGASPAVSEF"
FT   assembly_gap    6209812..6210782
FT                   /estimated_length=971
FT                   /gap_type="unknown"
FT   gene            complement(6213962..6214801)
FT                   /pseudo
FT                   /locus_tag="mCG_20174"
FT                   /note="gene_id=mCG20174.2"
FT   mRNA            complement(6213962..6214801)
FT                   /pseudo
FT                   /locus_tag="mCG_20174"
FT                   /note="gene_id=mCG20174.2 transcript_id=mCT19279.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    6221300..6221347
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            6223001..6349912
FT                   /gene="Tbl1xr1"
FT                   /locus_tag="mCG_122611"
FT                   /note="gene_id=mCG122611.1"
FT   mRNA            join(6223001..6223116,6282421..6282487,6312503..6312605,
FT                   6321694..6321839,6323094..6323316,6324241..6324373,
FT                   6324718..6324859,6325346..6325409,6325496..6325593,
FT                   6326434..6326494,6333645..6333766,6333915..6333989,
FT                   6336422..6336549,6337152..6337317,6342837..6342938,
FT                   6343726..6349699)
FT                   /gene="Tbl1xr1"
FT                   /locus_tag="mCG_122611"
FT                   /product="transducin (beta)-like 1X-linked receptor 1,
FT                   transcript variant mCT172123"
FT                   /note="gene_id=mCG122611.1 transcript_id=mCT172123.0
FT                   created on 19-AUG-2002"
FT   assembly_gap    6231807..6231826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(6248005..6248091,6282421..6282487,6312503..6312605,
FT                   6321694..6321839,6323094..6323316,6324241..6324373,
FT                   6324718..6324859,6325346..6325409,6325496..6325593,
FT                   6326434..6326494,6333645..6333766,6333915..6333989,
FT                   6336422..6336549,6337152..6337317,6342837..6342938,
FT                   6343726..6349912)
FT                   /gene="Tbl1xr1"
FT                   /locus_tag="mCG_122611"
FT                   /product="transducin (beta)-like 1X-linked receptor 1,
FT                   transcript variant mCT123833"
FT                   /note="gene_id=mCG122611.1 transcript_id=mCT123833.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    6266141..6266229
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    6286119..6286180
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    6294772..6294835
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             join(6312548..6312605,6321694..6321839,6323094..6323316,
FT                   6324241..6324373,6324718..6324859,6325346..6325409,
FT                   6325496..6325593,6326434..6326494,6333645..6333766,
FT                   6333915..6333989,6336422..6336549,6337152..6337317,
FT                   6342837..6342938,6343726..6343752)
FT                   /codon_start=1
FT                   /gene="Tbl1xr1"
FT                   /locus_tag="mCG_122611"
FT                   /product="transducin (beta)-like 1X-linked receptor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122611.1 transcript_id=mCT172123.0
FT                   protein_id=mCP95042.0 isoform=CRA_a"
FT                   /protein_id="EDL34902.1"
FT                   /translation="MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVP
FT                   PAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLA
FT                   QQHAAAAAAAAAATNQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAV
FT                   VLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDV
FT                   PSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFI
FT                   LSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDR
FT                   PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKW
FT                   SPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLA
FT                   SGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK"
FT   CDS             join(6312548..6312605,6321694..6321839,6323094..6323316,
FT                   6324241..6324373,6324718..6324859,6325346..6325409,
FT                   6325496..6325593,6326434..6326494,6333645..6333766,
FT                   6333915..6333989,6336422..6336549,6337152..6337317,
FT                   6342837..6342938,6343726..6343752)
FT                   /codon_start=1
FT                   /gene="Tbl1xr1"
FT                   /locus_tag="mCG_122611"
FT                   /product="transducin (beta)-like 1X-linked receptor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122611.1 transcript_id=mCT123833.1
FT                   protein_id=mCP79772.1 isoform=CRA_a"
FT                   /protein_id="EDL34903.1"
FT                   /translation="MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVP
FT                   PAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLA
FT                   QQHAAAAAAAAAATNQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAV
FT                   VLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDV
FT                   PSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFI
FT                   LSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDR
FT                   PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKW
FT                   SPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLA
FT                   SGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK"
FT   assembly_gap    6313381..6313400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6376903..6377163
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    6378864..6379242
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    6407054..6411411
FT                   /estimated_length=4358
FT                   /gap_type="unknown"
FT   assembly_gap    6444453..6444601
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    6461679..6462084
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    6468446..6468465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6473494..6473513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6492320..6494808
FT                   /estimated_length=2489
FT                   /gap_type="unknown"
FT   assembly_gap    6495726..6496700
FT                   /estimated_length=975
FT                   /gap_type="unknown"
FT   assembly_gap    6541720..6541817
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6544171..6544190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6583301..6585078
FT                   /estimated_length=1778
FT                   /gap_type="unknown"
FT   assembly_gap    6636419..6636438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6640771..6644590
FT                   /estimated_length=3820
FT                   /gap_type="unknown"
FT   gene            6650462..6651912
FT                   /pseudo
FT                   /locus_tag="mCG_50032"
FT                   /note="gene_id=mCG50032.1"
FT   mRNA            6650462..6651912
FT                   /pseudo
FT                   /locus_tag="mCG_50032"
FT                   /note="gene_id=mCG50032.1 transcript_id=mCT50215.1 created
FT                   on 06-SEP-2002"
FT   assembly_gap    6651915..6651942
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    6655058..6655077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6659239..6659258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6660791..6660947
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    6667317..6667336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6690425..6692190
FT                   /estimated_length=1766
FT                   /gap_type="unknown"
FT   assembly_gap    6693505..6693615
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    6694687..6695250
FT                   /estimated_length=564
FT                   /gap_type="unknown"
FT   assembly_gap    6735216..6741015
FT                   /estimated_length=5800
FT                   /gap_type="unknown"
FT   assembly_gap    6747483..6751306
FT                   /estimated_length=3824
FT                   /gap_type="unknown"
FT   assembly_gap    6767064..6768086
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    6770897..6771487
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    6776368..6777262
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    6778301..6781716
FT                   /estimated_length=3416
FT                   /gap_type="unknown"
FT   assembly_gap    6792806..6793907
FT                   /estimated_length=1102
FT                   /gap_type="unknown"
FT   assembly_gap    6797335..6797354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6808558..6808577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6810111..6810130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6812087..6812457
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    6814631..6817060
FT                   /estimated_length=2430
FT                   /gap_type="unknown"
FT   assembly_gap    6828801..6828891
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6840084..6844465
FT                   /estimated_length=4382
FT                   /gap_type="unknown"
FT   assembly_gap    6847832..6852726
FT                   /estimated_length=4895
FT                   /gap_type="unknown"
FT   assembly_gap    6866718..6866737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6882094..6882113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6883856..6883875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6895058..6895283
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    6921536..6921558
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6943347..6943387
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    6965630..6965765
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    7002227..7002246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7005358..7005642
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    7007228..7008575
FT                   /estimated_length=1348
FT                   /gap_type="unknown"
FT   assembly_gap    7012407..7012426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7029877..7036804
FT                   /estimated_length=6928
FT                   /gap_type="unknown"
FT   assembly_gap    7038354..7038652
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    7057886..7058458
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    7064939..7064958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7073407..7074652
FT                   /estimated_length=1246
FT                   /gap_type="unknown"
FT   assembly_gap    7076372..7077418
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   assembly_gap    7088277..7089293
FT                   /estimated_length=1017
FT                   /gap_type="unknown"
FT   assembly_gap    7093946..7093965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7105127..7105190
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    7133874..7135195
FT                   /estimated_length=1322
FT                   /gap_type="unknown"
FT   assembly_gap    7163016..7163211
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    7174419..7174498
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            7195740..7197819
FT                   /pseudo
FT                   /locus_tag="mCG_15966"
FT                   /note="gene_id=mCG15966.1"
FT   mRNA            join(7195740..7195826,7195890..7196048,7196389..7196504,
FT                   7196597..7196743,7197321..7197558,7197719..7197819)
FT                   /pseudo
FT                   /locus_tag="mCG_15966"
FT                   /note="gene_id=mCG15966.1 transcript_id=mCT14460.1 created
FT                   on 03-SEP-2002"
FT   assembly_gap    7200564..7205280
FT                   /estimated_length=4717
FT                   /gap_type="unknown"
FT   assembly_gap    7241003..7241022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7272403..7272551
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7293177..7294423
FT                   /estimated_length=1247
FT                   /gap_type="unknown"
FT   assembly_gap    7334255..7334274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7342261..7342786
FT                   /estimated_length=526
FT                   /gap_type="unknown"
FT   assembly_gap    7348876..7348895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7351738..7352106
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    7367356..7367375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7370783..7370873
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    7408625..7408751
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    7428321..7430934
FT                   /estimated_length=2614
FT                   /gap_type="unknown"
FT   assembly_gap    7433371..7433390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7434408..7434427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7441511..7443518
FT                   /estimated_length=2008
FT                   /gap_type="unknown"
FT   assembly_gap    7478155..7478174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7483216..7485167
FT                   /pseudo
FT                   /locus_tag="mCG_1049530"
FT                   /note="gene_id=mCG1049530.1"
FT   mRNA            join(7483216..7483637,7484089..7485167)
FT                   /pseudo
FT                   /locus_tag="mCG_1049530"
FT                   /note="gene_id=mCG1049530.1 transcript_id=mCT167234.1
FT                   created on 06-SEP-2002"
FT   gene            complement(7494591..7494987)
FT                   /pseudo
FT                   /locus_tag="mCG_140990"
FT                   /note="gene_id=mCG140990.0"
FT   mRNA            complement(7494591..7494987)
FT                   /pseudo
FT                   /locus_tag="mCG_140990"
FT                   /note="gene_id=mCG140990.0 transcript_id=mCT172607.0
FT                   created on 06-SEP-2002"
FT   gene            7580721..7640580
FT                   /locus_tag="mCG_1049637"
FT                   /note="gene_id=mCG1049637.0"
FT   mRNA            join(7580721..7581091,7581183..7581249,7640237..7640580)
FT                   /locus_tag="mCG_1049637"
FT                   /product="mCG1049637"
FT                   /note="gene_id=mCG1049637.0 transcript_id=mCT167341.0
FT                   created on 05-SEP-2002"
FT   CDS             join(7581027..7581091,7581183..7581249,7640237..7640320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049637"
FT                   /product="mCG1049637"
FT                   /note="gene_id=mCG1049637.0 transcript_id=mCT167341.0
FT                   protein_id=mCP79468.1"
FT                   /protein_id="EDL34904.1"
FT                   /translation="MKTLVIFLTKLELSPWSCTKWRRPNNGASDGIRRIVASCSSHLQL
FT                   RLTSMDPTMLGIYRGFSLYIQLHYIS"
FT   assembly_gap    7582883..7583416
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    7584180..7584199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7594705..7594854
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    7604637..7604656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7609332..7609410
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7610125..7610279
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    7624319..7624620
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    7628473..7629026
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    7658865..7659127
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    7659604..7660235
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    7689074..7689093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7698681..7700230
FT                   /estimated_length=1550
FT                   /gap_type="unknown"
FT   assembly_gap    7701243..7704290
FT                   /estimated_length=3048
FT                   /gap_type="unknown"
FT   assembly_gap    7708310..7708331
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7755932..7755951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7776456..7776485
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7778899..7778918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7802789..7808593
FT                   /estimated_length=5805
FT                   /gap_type="unknown"
FT   assembly_gap    7820418..7820499
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            complement(7920083..7997077)
FT                   /locus_tag="mCG_14200"
FT                   /note="gene_id=mCG14200.1"
FT   mRNA            complement(join(7920083..7920863,7962050..7962248,
FT                   7985212..7985306,7997049..7997077))
FT                   /locus_tag="mCG_14200"
FT                   /product="mCG14200"
FT                   /note="gene_id=mCG14200.1 transcript_id=mCT9482.1 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(7920665..7920863,7962050..7962168))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14200"
FT                   /product="mCG14200"
FT                   /note="gene_id=mCG14200.1 transcript_id=mCT9482.1
FT                   protein_id=mCP2100.2"
FT                   /protein_id="EDL34905.1"
FT                   /translation="MRPANDPKERAPSRVRMLNDILQDLEKNFLVQWVPPGFYRNILYH
FT                   LDEKTNQFSILKEAWEHCNPQTSNETFQEALSNVLNSINSAHISFKVGLDVFESVLLGK
FT                   N"
FT   assembly_gap    7933582..7933662
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    7957950..7958845
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    8087094..8087113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8105412..8105442
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    8134483..8138477
FT                   /estimated_length=3995
FT                   /gap_type="unknown"
FT   assembly_gap    8203143..8204473
FT                   /estimated_length=1331
FT                   /gap_type="unknown"
FT   assembly_gap    8207874..8208411
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    8221112..8221189
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    8232503..8232522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8270620..8270639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8294447..8294466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8303837..8303935
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            8346514..8346992
FT                   /pseudo
FT                   /locus_tag="mCG_60783"
FT                   /note="gene_id=mCG60783.2"
FT   mRNA            8346514..8346992
FT                   /pseudo
FT                   /locus_tag="mCG_60783"
FT                   /note="gene_id=mCG60783.2 transcript_id=mCT60966.2 created
FT                   on 06-SEP-2002"
FT   assembly_gap    8351982..8356862
FT                   /estimated_length=4881
FT                   /gap_type="unknown"
FT   assembly_gap    8358691..8359017
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    8421897..8421916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8434144..8434184
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    8443811..8444565
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    8467440..8467734
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    8477083..8477692
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    8512241..8516539
FT                   /estimated_length=4299
FT                   /gap_type="unknown"
FT   gene            complement(8543085..8893226)
FT                   /locus_tag="mCG_57352"
FT                   /note="gene_id=mCG57352.2"
FT   mRNA            complement(join(8543085..8543464,8661621..8662122,
FT                   8893135..8893226))
FT                   /locus_tag="mCG_57352"
FT                   /product="mCG57352"
FT                   /note="gene_id=mCG57352.2 transcript_id=mCT57535.2 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(8543182..8543464,8661621..8662114))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57352"
FT                   /product="mCG57352"
FT                   /note="gene_id=mCG57352.2 transcript_id=mCT57535.2
FT                   protein_id=mCP25069.2"
FT                   /protein_id="EDL34906.1"
FT                   /translation="MAYQKVKADLRTSGHSQYLDNDELQATALDLEWDMEKELEEPGFD
FT                   QFQPDSAEHQNLGHSETLDLHLDSIQPATSPKGRFQRLQEESDCVTHYTRSAPKNNHCS
FT                   FCYMLKILCIATTLFIFGIIIGYYAHMNCPSDASPSGTNNPQLYQDILKTIKAEDIKKS
FT                   FRNWLQLYDSKDDMEIAKKIKSHWIALGLEDTQFINYSVLLDFPGSSPGTITLSSTGQC
FT                   FYPDGQPCREEARGGHSQDLFFSYAAYSAKGTLQVI"
FT   assembly_gap    8559164..8559183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8580967..8580986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8612482..8612551
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8620836..8620855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8657508..8657680
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    8660274..8660343
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8691395..8691414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8695770..8695789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8739767..8739786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8764132..8764734
FT                   /estimated_length=603
FT                   /gap_type="unknown"
FT   assembly_gap    8765687..8767952
FT                   /estimated_length=2266
FT                   /gap_type="unknown"
FT   assembly_gap    8768910..8769464
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    8796787..8796806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8828893..8832836
FT                   /estimated_length=3944
FT                   /gap_type="unknown"
FT   assembly_gap    8869967..8869986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8916477..8916496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8939288..8939307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9049097..9049149
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    9061214..9061233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9072120..9076898
FT                   /estimated_length=4779
FT                   /gap_type="unknown"
FT   assembly_gap    9096014..9099043
FT                   /estimated_length=3030
FT                   /gap_type="unknown"
FT   assembly_gap    9114114..9114235
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    9120531..9120550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9145147..9145767
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    9180515..9180675
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    9197921..9197940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9209285..9213389
FT                   /estimated_length=4105
FT                   /gap_type="unknown"
FT   assembly_gap    9304570..9304618
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            complement(9318312..9320190)
FT                   /pseudo
FT                   /locus_tag="mCG_119852"
FT                   /note="gene_id=mCG119852.1"
FT   mRNA            complement(join(9318312..9318842,9319514..9320190))
FT                   /pseudo
FT                   /locus_tag="mCG_119852"
FT                   /note="gene_id=mCG119852.1 transcript_id=mCT121030.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    9318859..9319513
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    9329196..9329215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9331586..9332473
FT                   /estimated_length=888
FT                   /gap_type="unknown"
FT   assembly_gap    9354400..9354419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9356204..9356223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9357360..9357379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9367124..9367143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9395578..9400670
FT                   /estimated_length=5093
FT                   /gap_type="unknown"
FT   assembly_gap    9407127..9407433
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    9414700..9415117
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    9448220..9448239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9455671..9455690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9501732..9501751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9524317..9524336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9535894..>9544130)
FT                   /locus_tag="mCG_119853"
FT                   /note="gene_id=mCG119853.1"
FT   mRNA            complement(join(9535894..9538512,9539905..9540694,
FT                   9543917..>9544130))
FT                   /locus_tag="mCG_119853"
FT                   /product="mCG119853"
FT                   /note="gene_id=mCG119853.1 transcript_id=mCT121031.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(9537690..9538512,9539905..9540694,
FT                   9543917..>9544127))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119853"
FT                   /product="mCG119853"
FT                   /note="gene_id=mCG119853.1 transcript_id=mCT121031.1
FT                   protein_id=mCP79436.1"
FT                   /protein_id="EDL34907.1"
FT                   /translation="FLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSG
FT                   AGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKV
FT                   GCNVSDTVELVECLQKKPYKELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFL
FT                   NYDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYPEGKDVLRETIKF
FT                   MYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQV
FT                   PAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
FT                   PQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHN
FT                   LNDISQYTSTTTKVPSTDITLRPTRKNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYST
FT                   ELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSL
FT                   QMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDIPLMTPNTITMIPNTIPGIQ
FT                   PLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV"
FT   assembly_gap    9567353..9567372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9577413..9580843
FT                   /estimated_length=3431
FT                   /gap_type="unknown"
FT   assembly_gap    9628351..9628370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9634115..9634134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9635376..9635842
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    9642149..9650481
FT                   /estimated_length=8333
FT                   /gap_type="unknown"
FT   assembly_gap    9656876..9656922
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    9678658..9678677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9685800..9686484
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   assembly_gap    9717474..9717493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9721169..9721188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9743670..9743689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9765294..9765313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9786867..9786886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9793062..10439620)
FT                   /locus_tag="mCG_57360"
FT                   /note="gene_id=mCG57360.2"
FT   mRNA            complement(join(9793062..9793916,9798095..9798163,
FT                   10010633..10010785,10018170..10018229,10240975..10241785,
FT                   10292944..10293020,10438715..10439620))
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, transcript variant mCT57543"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT57543.2 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(9793062..9793916,9798095..9798163,
FT                   10010633..10010785,10018170..10018229,10240975..10241785,
FT                   10292944..10293020,10374315..10374391,10438715..10439620))
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, transcript variant mCT181477"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT181477.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(9793894..9793916,9798095..9798163,
FT                   10010633..10010785,10018170..10018229,10240975..10241467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, isoform CRA_b"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT57543.2
FT                   protein_id=mCP25045.2 isoform=CRA_b"
FT                   /protein_id="EDL34909.1"
FT                   /translation="MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLS
FT                   QKLDDVDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPW
FT                   SDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTE
FT                   DGPLTKKHTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGN
FT                   VIVITVNYRLGVLEKETISVAFQALRTKGGGFIPKQATYKRCE"
FT   CDS             complement(join(9793894..9793916,9798095..9798163,
FT                   10010633..10010785,10018170..10018229,10240975..10241467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, isoform CRA_b"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT181477.0
FT                   protein_id=mCP104398.0 isoform=CRA_b"
FT                   /protein_id="EDL34910.1"
FT                   /translation="MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLS
FT                   QKLDDVDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPW
FT                   SDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTE
FT                   DGPLTKKHTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGN
FT                   VIVITVNYRLGVLEKETISVAFQALRTKGGGFIPKQATYKRCE"
FT   assembly_gap    9823382..9823401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9890104..9890123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9963548..9963568
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    9985490..9985509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9991159..9991389
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    10019514..10019533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10020678..10020697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10021916..10021935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10030833..10030852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10032247..10032266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10051628..10051647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10054075..10054094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10055538..10055557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10066786..10067216
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    10069188..10069271
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    10086540..10086566
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    10089832..10089851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10112118..10112278
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    10136382..10136490
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    10164327..10164351
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    10192940..10192959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10194855..10194874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10196628..10196647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10198803..10199903
FT                   /estimated_length=1101
FT                   /gap_type="unknown"
FT   assembly_gap    10213833..10219167
FT                   /estimated_length=5335
FT                   /gap_type="unknown"
FT   mRNA            complement(join(10239403..10241785,10292944..10293020,
FT                   10438715..10439582))
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, transcript variant mCT181476"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT181476.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(10240862..10241467)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57360"
FT                   /product="mCG57360, isoform CRA_a"
FT                   /note="gene_id=mCG57360.2 transcript_id=mCT181476.0
FT                   protein_id=mCP104399.0 isoform=CRA_a"
FT                   /protein_id="EDL34908.1"
FT                   /translation="MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLS
FT                   QKLDDVDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPW
FT                   SDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTE
FT                   DGEFIAGTQGDVYLFSILSSNNINSHVLVVCMAFPVGM"
FT   assembly_gap    10251459..10251478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10255317..10255456
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    10256731..10256756
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    10269103..10269493
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    10277477..10277496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10282270..10282289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10286926..10286945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10330850..10330990
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    10332245..10332654
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    10361955..10363773
FT                   /estimated_length=1819
FT                   /gap_type="unknown"
FT   assembly_gap    10364889..10364908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10365553..10365572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10368553..10368793
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    10372430..10372449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10441284..10441397
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    10465151..10465170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10466468..10466487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10467558..10469164
FT                   /estimated_length=1607
FT                   /gap_type="unknown"
FT   assembly_gap    10471736..10471755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10476235..10476254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10478563..10478582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10484446..10486821
FT                   /pseudo
FT                   /locus_tag="mCG_54003"
FT                   /note="gene_id=mCG54003.1"
FT   mRNA            10484446..10486821
FT                   /pseudo
FT                   /locus_tag="mCG_54003"
FT                   /note="gene_id=mCG54003.1 transcript_id=mCT54186.2 created
FT                   on 21-FEB-2003"
FT   assembly_gap    10515150..10515169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10522256..10522324
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    10541576..10543360
FT                   /estimated_length=1785
FT                   /gap_type="unknown"
FT   assembly_gap    10546683..10546702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10555282..10555301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10581761..10584709
FT                   /estimated_length=2949
FT                   /gap_type="unknown"
FT   assembly_gap    10672578..10672597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10682049..10682266
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    10695964..10695983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10698852..10698871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10707774..10707793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10713033..10713052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10718249..10718268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10731109..10731128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10732539..11076472
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /note="gene_id=mCG140928.0"
FT   mRNA            join(10732539..10732657,10764681..10765313,
FT                   10830399..10830544,10870299..10870388,10934501..10934585,
FT                   10972738..10972885,11007856..11008002,11009370..11009482,
FT                   11018934..11019098,11022011..11022094,11076179..11076472)
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, transcript variant
FT                   mCT172256"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172256.0
FT                   created on 06-FEB-2003"
FT   mRNA            join(10732583..10732657,10764681..10766310)
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, transcript variant
FT                   mCT172257"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172257.0
FT                   created on 06-FEB-2003"
FT   mRNA            join(10732587..10732644,10764669..10765313,
FT                   10830399..10830544,10870299..10870388,10934501..10934585,
FT                   10972738..10972885,11007856..11008002,11009370..11009482,
FT                   11018934..11019098,11022011..11022094,11076179..11076472)
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, transcript variant
FT                   mCT172258"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172258.0
FT                   created on 06-FEB-2003"
FT   mRNA            join(10732587..10732657,10764681..10765313,
FT                   10830399..10830544,10870299..10870388,10934501..10934585,
FT                   10972738..10972885,11007856..11008002,11009370..11009482,
FT                   11018934..11019098,11022011..11022184)
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, transcript variant
FT                   mCT179548"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT179548.0
FT                   created on 06-FEB-2003"
FT   assembly_gap    10744176..10744195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10755923..10755942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10757292..10757311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10758345..10759649
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    10761286..10761305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10762599..10762618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10764164..10764183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10764699..10765313,10830399..10830544,
FT                   10870299..10870388,10934501..10934585,10972738..10972885,
FT                   11007856..11008002,11009370..11009482,11018934..11019098,
FT                   11022011..11022094,11076179..11076301)
FT                   /codon_start=1
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, isoform CRA_b"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172258.0
FT                   protein_id=mCP95176.0 isoform=CRA_b"
FT                   /protein_id="EDL34912.1"
FT                   /translation="MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTP
FT                   GIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAKIMELD
FT                   NQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPAS
FT                   PRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQFRTALELCSKGAALGKPFEAHAE
FT                   DIASIASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQAAVFRCLERYSE
FT                   AARSAMIADYMFWLCGGSEHSVSKLIKLYWQAMIEEAITRAEAFSVMYTPFATRIKPEN
FT                   IEKVKEVFMRTHPTYVDCIYTDTQGLHVLPQTADWSCFPPQQYLLTLGFKNKEDGKFLE
FT                   KVSSRKLPTYTEHKTPFSPLTREDTVRHMETVGKRILPILDFIRSTQLNGNFHACSGVM
FT                   EKLHYASLLSRLQRVKEQAQVINQAMAELATVPYLQDISQQEAELLQSLMADAMDTLEG
FT                   KKSDKERVWNTIQKVGRIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQN"
FT   CDS             join(10764699..10765313,10830399..10830544,
FT                   10870299..10870388,10934501..10934585,10972738..10972885,
FT                   11007856..11008002,11009370..11009482,11018934..11019098,
FT                   11022011..11022094,11076179..11076301)
FT                   /codon_start=1
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, isoform CRA_b"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172256.0
FT                   protein_id=mCP95175.0 isoform=CRA_b"
FT                   /protein_id="EDL34913.1"
FT                   /translation="MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTP
FT                   GIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAKIMELD
FT                   NQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPAS
FT                   PRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQFRTALELCSKGAALGKPFEAHAE
FT                   DIASIASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQAAVFRCLERYSE
FT                   AARSAMIADYMFWLCGGSEHSVSKLIKLYWQAMIEEAITRAEAFSVMYTPFATRIKPEN
FT                   IEKVKEVFMRTHPTYVDCIYTDTQGLHVLPQTADWSCFPPQQYLLTLGFKNKEDGKFLE
FT                   KVSSRKLPTYTEHKTPFSPLTREDTVRHMETVGKRILPILDFIRSTQLNGNFHACSGVM
FT                   EKLHYASLLSRLQRVKEQAQVINQAMAELATVPYLQDISQQEAELLQSLMADAMDTLEG
FT                   KKSDKERVWNTIQKVGRIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQN"
FT   CDS             join(10764699..10765313,10830399..10830544,
FT                   10870299..10870388,10934501..10934585,10972738..10972885,
FT                   11007856..11008002,11009370..11009482,11018934..11019098,
FT                   11022011..11022106)
FT                   /codon_start=1
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, isoform CRA_c"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT179548.0
FT                   protein_id=mCP102470.0 isoform=CRA_c"
FT                   /protein_id="EDL34914.1"
FT                   /translation="MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTP
FT                   GIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAKIMELD
FT                   NQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPAS
FT                   PRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQFRTALELCSKGAALGKPFEAHAE
FT                   DIASIASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQAAVFRCLERYSE
FT                   AARSAMIADYMFWLCGGSEHSVSKLIKLYWQAMIEEAITRAEAFSVMYTPFATRIKPEN
FT                   IEKVKEVFMRTHPTYVDCIYTDTQGLHVLPQTADWSCFPPQQYLLTLGFKNKEDGKFLE
FT                   KVSSRKLPTYTEHKTPFSPLTREDTVRHMETVGKRILPILDFIRSTQLNGNFHACSGVM
FT                   EKLHYASLLSRLQRVKEQAQVINQAMAELATVPYLQDISQQEAELLQSLMADAMDTLEG
FT                   KKSDKERVWNTIQKVKF"
FT   CDS             10764699..10765430
FT                   /codon_start=1
FT                   /gene="Spata16"
FT                   /locus_tag="mCG_140928"
FT                   /product="spermatogenesis associated 16, isoform CRA_a"
FT                   /note="gene_id=mCG140928.0 transcript_id=mCT172257.0
FT                   protein_id=mCP95177.0 isoform=CRA_a"
FT                   /protein_id="EDL34911.1"
FT                   /translation="MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTP
FT                   GIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAKIMELD
FT                   NQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPAS
FT                   PRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQFRTALEVWDYSQYRCAGSHEIKS
FT                   CNYTEWFSPQCNEQWSWGKII"
FT   assembly_gap    10768953..10768972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10778313..10778515
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    10791209..10791460
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    10795652..10795671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10820262..10822256
FT                   /estimated_length=1995
FT                   /gap_type="unknown"
FT   assembly_gap    10825046..10825065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10844200..10844268
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    10854254..10856121
FT                   /estimated_length=1868
FT                   /gap_type="unknown"
FT   assembly_gap    10874291..10874310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10881471..10881490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10883205..10883224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10885183..10885269
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    10893749..10893890
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    10897089..10897108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10952387..10957004
FT                   /estimated_length=4618
FT                   /gap_type="unknown"
FT   assembly_gap    10968636..10968702
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    10980583..10980602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10986572..10987213
FT                   /estimated_length=642
FT                   /gap_type="unknown"
FT   assembly_gap    10991946..10991997
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    10995823..10996511
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    10998587..10998606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11038618..11038699
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    11041091..11042423
FT                   /estimated_length=1333
FT                   /gap_type="unknown"
FT   assembly_gap    11066509..11069444
FT                   /estimated_length=2936
FT                   /gap_type="unknown"
FT   assembly_gap    11099216..11099235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11111192..11111696
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    11119668..11119687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11128470..11128491
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            complement(11131538..11132705)
FT                   /pseudo
FT                   /locus_tag="mCG_9561"
FT                   /note="gene_id=mCG9561.1"
FT   mRNA            complement(11131538..11132705)
FT                   /pseudo
FT                   /locus_tag="mCG_9561"
FT                   /note="gene_id=mCG9561.1 transcript_id=mCT9364.1 created on
FT                   19-AUG-2002"
FT   assembly_gap    11136411..11136534
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    11139420..11140242
FT                   /estimated_length=823
FT                   /gap_type="unknown"
FT   assembly_gap    11152310..11152329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11161718..11161737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11173039..11173159
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    11178989..11179008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11179746..11180288
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   gene            complement(11182319..11238561)
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /note="gene_id=mCG9558.2"
FT   mRNA            complement(join(11182319..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231747,11233524..11233616,11233722..11233801,
FT                   11234758..11234909,11238442..11238545))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT172254"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172254.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(11182319..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231929))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT172255"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172255.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(11182319..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11207426))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT172252"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172252.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(11182322..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231610,11233722..11233801,11234758..11234909,
FT                   11238348..11238561))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT9362"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT9362.2 created on
FT                   06-FEB-2003"
FT   mRNA            complement(join(11182322..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11200805..11200871,
FT                   11202516..11202545))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT172251"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172251.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(11182330..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231747,11233722..11233801,11234758..11234909,
FT                   11238428..11238551))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT179636"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT179636.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231747,11233722..11233801,11234758..11234887))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_e"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT179636.0
FT                   protein_id=mCP102558.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q07139"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR026817"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="MGI:MGI:95281"
FT                   /db_xref="PDB:2COU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07139"
FT                   /protein_id="EDL34919.1"
FT                   /translation="MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEE
FT                   MPQVEARVIMVQDAGKQEELLKALKEMKVPCVKMDSMEEFESLDSPEFENIFVVTDFQN
FT                   SVFNDLYKADCRIVGPPVILNCAQRGEPLPFSCRPLYCTSMLNLVLCFTGFRKKEELVK
FT                   LVTLVHHMGGVIRKECNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQ
FT                   CFCAAVDDFRNEFKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLI
FT                   VEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSL
FT                   STPNSNRKRRRLKETLAQLSRETDLSPFPPRKRPSAEHSLSIGSLLDISNTPESSIHYG
FT                   ETPKSCAKSSRSSTPVPPKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRG
FT                   GPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYAKDLVKTYP
FT                   PFVNFFEMSKEMIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLL
FT                   NDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLL
FT                   SSHRSLVQRVETVSLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHDRTRPPA
FT                   SLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEELPKESWL
FT                   KMLCRHVANTICKADAENLMYVADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSF
FT                   SKTPKRALRMALSSSHSSEGRSPPSSGKLAVSRLSSTSSLAGIPSPSLVSLPSFFERRS
FT                   HTLSRSTTHLI"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231747,11233524..11233616,11233722..11233801,
FT                   11234758..11234887))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_f"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172254.0
FT                   protein_id=mCP95171.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q07139"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR026817"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="MGI:MGI:95281"
FT                   /db_xref="PDB:2COU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07139"
FT                   /protein_id="EDL34920.1"
FT                   /translation="MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEE
FT                   MPQVEARVIMVQDAGKQEELLKALKTIKIMEVPVIKIKESCPGKSEEKLIKSIINMEMK
FT                   VPCVKMDSMEEFESLDSPEFENIFVVTDFQNSVFNDLYKADCRIVGPPVILNCAQRGEP
FT                   LPFSCRPLYCTSMLNLVLCFTGFRKKEELVKLVTLVHHMGGVIRKECNSKVTHLVANCT
FT                   QGEKFRVAVSLGTPIMKPEWIYKAWERRNEQCFCAAVDDFRNEFKVPPFQDCILSFLGF
FT                   SDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFWGS
FT                   IQMDARAGETMYLYEKANTPELKKSVSLLSLSTPNSNRKRRRLKETLAQLSRETDLSPF
FT                   PPRKRPSAEHSLSIGSLLDISNTPESSIHYGETPKSCAKSSRSSTPVPPKQSARWQVAK
FT                   ELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKD
FT                   DLEDLIANWDESRSIGDIFLKYAKDLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAFLK
FT                   INQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVM
FT                   THINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQVTL
FT                   FLFNDCLEIARKRHKVIGTFRSPHDRTRPPASLKHIHLMPLSQIKKVLDIRETEDCHNA
FT                   FALLVRPPTEQANVLLSFQMTSEELPKESWLKMLCRHVANTICKADAENLMYVADPESF
FT                   EVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMALSSSHSSEGRSPPSSGK
FT                   LAVSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230765,
FT                   11231565..11231744))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_d"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172255.0
FT                   protein_id=mCP95172.0 isoform=CRA_d"
FT                   /protein_id="EDL34918.1"
FT                   /translation="MKVPCVKMDSMEEFESLDSPEFENIFVVTDFQNSVFNDLYKADCR
FT                   IVGPPVILNCAQRGEPLPFSCRPLYCTSMLNLVLCFTGFRKKEELVKLVTLVHHMGGVI
FT                   RKECNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQCFCAAVDDFRNE
FT                   FKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFE
FT                   PSKKLFVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSLSTPNSNRKRRRL
FT                   KETLAQLSRETDLSPFPPRKRPSAEHSLSIGSLLDISNTPESSIHYGETPKSCAKSSRS
FT                   STPVPPKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTI
FT                   FGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYAKDLVKTYPPFVNFFEMSKEM
FT                   IIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENP
FT                   DKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVET
FT                   VSLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHDRTRPPASLKHIHLMPLSQ
FT                   IKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEELPKESWLKMLCRHVANTIC
FT                   KADAENLMYVADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMAL
FT                   SSSHSSEGRSPPSSGKLAVSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202654,
FT                   11206695..11206814,11207131..11207209,11208637..11208718,
FT                   11211613..11211709,11212468..11212578,11214778..11214846,
FT                   11216510..11216629,11221740..11221876,11223217..11223439,
FT                   11223563..11223625,11223729..11223844,11224247..11224377,
FT                   11226341..11226414,11229672..11229779,11230676..11230726))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_g"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT9362.2
FT                   protein_id=mCP2117.1 isoform=CRA_g"
FT                   /protein_id="EDL34921.1"
FT                   /translation="MLNLVLCFTGFRKKEELVKLVTLVHHMGGVIRKECNSKVTHLVAN
FT                   CTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQCFCAAVDDFRNEFKVPPFQDCILSFL
FT                   GFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFW
FT                   GSIQMDARAGETMYLYEKANTPELKKSVSLLSLSTPNSNRKRRRLKETLAQLSRETDLS
FT                   PFPPRKRPSAEHSLSIGSLLDISNTPESSIHYGETPKSCAKSSRSSTPVPPKQSARWQV
FT                   AKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKI
FT                   KDDLEDLIANWDESRSIGDIFLKYAKDLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAF
FT                   LKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKE
FT                   VMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQV
FT                   TLFLFNDCLEIARKRHKVIGTFRSPHDRTRPPASLKHIHLMPLSQIKKVLDIRETEDCH
FT                   NAFALLVRPPTEQANVLLSFQMTSEELPKESWLKMLCRHVANTICKADAENLMYVADPE
FT                   SFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMALSSSHSSEGRSPPSS
FT                   GKLAVSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200289,11202516..11202564))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_b"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172252.0
FT                   protein_id=mCP95174.0 isoform=CRA_b"
FT                   /protein_id="EDL34916.1"
FT                   /translation="MPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEE
FT                   LPKESWLKMLCRHVANTICKADAENLMYVADPESFEVNTKDMDSTLSRASRAIKKTSKK
FT                   VTRAFSFSKTPKRALRMALSSSHSSEGRSPPSSGKLAVSRLSSTSSLAGIPSPSLVSLP
FT                   SFFERRSHTLSRSTTHLI"
FT   CDS             complement(join(11183495..11183584,11185924..11186067,
FT                   11187491..11187598,11200135..11200218))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172251.0
FT                   protein_id=mCP95173.0 isoform=CRA_a"
FT                   /protein_id="EDL34915.1"
FT                   /translation="MTSEELPKESWLKMLCRHVANTICKADAENLMYVADPESFEVNTK
FT                   DMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMALSSSHSSEGRSPPSSGKLAVSR
FT                   LSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI"
FT   assembly_gap    11198635..11199524
FT                   /estimated_length=890
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11216188..11216629,11221740..11221876,
FT                   11223217..11223439,11223563..11223625,11223729..11223844,
FT                   11224247..11224377,11226341..11226414,11229672..11229779,
FT                   11230676..11230765,11231565..11231747,11233722..11233801,
FT                   11234758..11234909,11238428..11238548))
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, transcript variant mCT172253"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172253.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(11216495..11216629,11221740..11221876,
FT                   11223217..11223439,11223563..11223625,11223729..11223844,
FT                   11224247..11224377,11226341..11226414,11229672..11229779,
FT                   11230676..11230765,11231565..11231747,11233722..11233801,
FT                   11234758..11234887))
FT                   /codon_start=1
FT                   /gene="Ect2"
FT                   /locus_tag="mCG_9558"
FT                   /product="ect2 oncogene, isoform CRA_c"
FT                   /note="gene_id=mCG9558.2 transcript_id=mCT172253.0
FT                   protein_id=mCP95170.0 isoform=CRA_c"
FT                   /protein_id="EDL34917.1"
FT                   /translation="MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEE
FT                   MPQVEARVIMVQDAGKQEELLKALKEMKVPCVKMDSMEEFESLDSPEFENIFVVTDFQN
FT                   SVFNDLYKADCRIVGPPVILNCAQRGEPLPFSCRPLYCTSMLNLVLCFTGFRKKEELVK
FT                   LVTLVHHMGGVIRKECNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQ
FT                   CFCAAVDDFRNEFKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLI
FT                   VEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSL
FT                   STPNSNRKRRRLKETLAQLSRETDLSPFPPRKRPSAEHSLSIGSLLDISNTPESSIHYG
FT                   ETPKSCAKSSRSSTPVPPKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRG
FT                   GPILAPEEIKTIFGSIPDIFDVHMKIKVSLY"
FT   gene            <11238749..11241744
FT                   /locus_tag="mCG_145539"
FT                   /note="gene_id=mCG145539.0"
FT   mRNA            join(<11238749..11239035,11239465..11239656,
FT                   11241361..11241744)
FT                   /locus_tag="mCG_145539"
FT                   /product="mCG145539"
FT                   /note="gene_id=mCG145539.0 transcript_id=mCT184963.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<11239019..11239035,11239465..11239656,
FT                   11241361..11241418)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145539"
FT                   /product="mCG145539"
FT                   /note="gene_id=mCG145539.0 transcript_id=mCT184963.0
FT                   protein_id=mCP105170.0"
FT                   /protein_id="EDL34922.1"
FT                   /translation="SKTASGRRPDPQRLELQRMMNHQVGAGNQTHGLCVRNKRFKPLSQ
FT                   LTLSPKSTLKPKELLDSLSSSTSLRGSRNKRRSRLDREAPGTD"
FT   assembly_gap    11244291..11244390
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    11257629..11259528
FT                   /estimated_length=1900
FT                   /gap_type="unknown"
FT   assembly_gap    11264525..11264573
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            11267092..11369192
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /note="gene_id=mCG9562.2"
FT   mRNA            join(11267092..11267306,11306944..11307172,
FT                   11310585..11310654,11323977..11324148,11325646..11327452)
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, transcript
FT                   variant mCT9365"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT9365.2 created on
FT                   19-AUG-2002"
FT   mRNA            join(11267096..11267306,11306944..11307048,
FT                   11323988..11324148,11325646..11325847)
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, transcript
FT                   variant mCT172259"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT172259.0 created
FT                   on 19-AUG-2002"
FT   mRNA            join(11267097..11267306,11306944..11307172,
FT                   11310585..11310654,11363778..11363869,11368966..11369192)
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, transcript
FT                   variant mCT172260"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT172260.0 created
FT                   on 19-AUG-2002"
FT   CDS             join(11267169..11267306,11306944..11307172,
FT                   11310585..11310654,11363778..11363869,11368966..11369036)
FT                   /codon_start=1
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT172260.0
FT                   protein_id=mCP95178.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BYQ0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:2443191"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BYQ0"
FT                   /protein_id="EDL34925.1"
FT                   /translation="MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQ
FT                   VSNLIHSLGLNHHLIALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPKPEEP
FT                   LRRSVIYIHGGGWALASAKISYYDQLCTTMAEELNAVIVSIEISQALKSLCLGGCFWTP
FT                   DIPTAPSQVVQITGMSTYECRSTVRPEEGARSLELL"
FT   CDS             join(11267169..11267306,11306944..11307172,
FT                   11310585..11310654,11323977..11324148,11325646..11326263)
FT                   /codon_start=1
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT9365.2
FT                   protein_id=mCP2102.2 isoform=CRA_b"
FT                   /protein_id="EDL34924.1"
FT                   /translation="MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQ
FT                   VSNLIHSLGLNHHLIALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPKPEEP
FT                   LRRSVIYIHGGGWALASAKISYYDQLCTTMAEELNAVIVSIEYRLVPQVYFPEQIHDVI
FT                   RATKYFLQPEVLDKYKVDPGRVGISGDSAGGNLAAALGQQFTYVASLKNKLKLQALVYP
FT                   VLQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTSLDVERAAA
FT                   LRARLDWTSLLPSSIKKNYKPIMQTTGNARIVQEIPQLLDAAASPLIAEQEVLEALPKT
FT                   YILTCEHDVLRDDGIMYAKRLESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNS
FT                   YIKWLDQNL"
FT   CDS             join(11267169..11267306,11306944..11307048,
FT                   11323988..11324065)
FT                   /codon_start=1
FT                   /gene="Aadacl1"
FT                   /locus_tag="mCG_9562"
FT                   /product="arylacetamide deacetylase-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG9562.2 transcript_id=mCT172259.0
FT                   protein_id=mCP95179.0 isoform=CRA_a"
FT                   /protein_id="EDL34923.1"
FT                   /translation="MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQ
FT                   VSNLIHSLGLNHHLIALNFIITSFGKQSARSSPKVKSHRSIFRSKSMMSSVPLNISCSQ
FT                   KS"
FT   assembly_gap    11278855..11278874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11302772..11302950
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    11308435..11308797
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    11322609..11322654
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    11345239..11345303
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11348333..11348395
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    11372664..11372694
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    11374134..11374381
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    11376220..11376973
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    11384887..11386010
FT                   /estimated_length=1124
FT                   /gap_type="unknown"
FT   gene            11401488..11418667
FT                   /gene="Tnfsf10"
FT                   /locus_tag="mCG_119503"
FT                   /note="gene_id=mCG119503.0"
FT   mRNA            join(11401488..11401677,11408511..11408648,
FT                   11411631..11411673,11416644..11416748,11417792..11418667)
FT                   /gene="Tnfsf10"
FT                   /locus_tag="mCG_119503"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 10"
FT                   /note="gene_id=mCG119503.0 transcript_id=mCT120677.0
FT                   created on 19-AUG-2002"
FT   CDS             join(11401534..11401677,11408511..11408648,
FT                   11411631..11411673,11416644..11416748,11417792..11418237)
FT                   /codon_start=1
FT                   /gene="Tnfsf10"
FT                   /locus_tag="mCG_119503"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 10"
FT                   /note="gene_id=mCG119503.0 transcript_id=mCT120677.0
FT                   protein_id=mCP79597.1"
FT                   /db_xref="GOA:Q3U5H0"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR017355"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="MGI:MGI:107414"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U5H0"
FT                   /protein_id="EDL34926.1"
FT                   /translation="MPSSGALKDLSFSQHFRMMVICIVLLQVLLQAVSVAVTYMYFTNE
FT                   MKQLQDNYSKIGLACFSKTDEDFWDSTDGEILNRPCLQVKRQLYQLIEEVTLRTFQDTI
FT                   STVPEKQLSTPPLPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRK
FT                   GHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYK
FT                   YTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQE
FT                   ASFFGAFLIN"
FT   assembly_gap    11402680..11403089
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    11428640..11428930
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    11446676..11446746
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            11453522..11460179
FT                   /gene="Ghsr"
FT                   /locus_tag="mCG_49508"
FT                   /note="gene_id=mCG49508.3"
FT   mRNA            join(11453522..11453611,11453808..11454755,
FT                   11456787..11460179)
FT                   /gene="Ghsr"
FT                   /locus_tag="mCG_49508"
FT                   /product="growth hormone secretagogue receptor"
FT                   /note="gene_id=mCG49508.3 transcript_id=mCT49691.3 created
FT                   on 18-APR-2003"
FT   CDS             join(11453966..11454755,11456787..11457091)
FT                   /codon_start=1
FT                   /gene="Ghsr"
FT                   /locus_tag="mCG_49508"
FT                   /product="growth hormone secretagogue receptor"
FT                   /note="gene_id=mCG49508.3 transcript_id=mCT49691.3
FT                   protein_id=mCP24998.1"
FT                   /db_xref="GOA:Q0VBE5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003905"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBE5"
FT                   /protein_id="EDL34927.1"
FT                   /translation="MWNATPSEEPEPNVTLDLDWDASPGNDSLSDELLPLFPAPLLAGV
FT                   TATCVALFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQ
FT                   YRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVI
FT                   LVIWAVAFCSAGPIFVLVGVEHENGTDPRDTNECRATEFAVRSGLLTVMVWVSSVFFFL
FT                   PVFCLTVLYSLIGRKLWRRRGDAAVGSSLRDQNHKQTVKMLAVVVFAFILCWLPFHVGR
FT                   YLFSKSFEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFES
FT                   FSQRKLSTLKDESSRAWTKSSINT"
FT   gene            complement(11498333..11545448)
FT                   /locus_tag="mCG_119508"
FT                   /note="gene_id=mCG119508.1"
FT   mRNA            complement(join(11498333..11501778,11508227..11508354,
FT                   11510965..11511131,11521551..11521763,11532914..11533194,
FT                   11538049..11538198,11538587..11538700,11540318..11540490,
FT                   11545376..11545448))
FT                   /locus_tag="mCG_119508"
FT                   /product="mCG119508, transcript variant mCT120682"
FT                   /note="gene_id=mCG119508.1 transcript_id=mCT120682.1
FT                   created on 19-AUG-2002"
FT   mRNA            complement(join(11498333..11501778,11508227..11508354,
FT                   11510965..11511131,11521551..11521763,11532914..11533194,
FT                   11538049..11538198,11538587..11538700,11540318..11540490,
FT                   11541546..11541649))
FT                   /locus_tag="mCG_119508"
FT                   /product="mCG119508, transcript variant mCT172120"
FT                   /note="gene_id=mCG119508.1 transcript_id=mCT172120.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(11501467..11501778,11508227..11508354,
FT                   11510965..11511131,11521551..11521763,11532914..11533194,
FT                   11538049..11538198,11538587..11538700,11540318..11540440))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119508"
FT                   /product="mCG119508, isoform CRA_a"
FT                   /note="gene_id=mCG119508.1 transcript_id=mCT120682.1
FT                   protein_id=mCP79180.1 isoform=CRA_a"
FT                   /protein_id="EDL34928.1"
FT                   /translation="MTEPENVASEVYHGPELECTVGNLLPGTVYRFRVRALNDGGYGPY
FT                   SDVSEITTAAGPPGQCRAPRVSFTPDGCVLVGWESPASPGADISEYRLEWGEDEQSLEL
FT                   VYHGPDTCFEMRDLLPAAQYCCRLQAFNPAGAGPYSELVHCQTPASAPDPVSTLCVLEE
FT                   EPPSAHPDSPSVCLVLNWEEPCNNGSEILAYNIDLGDSCITVGNTTTHVMKNLLPETTY
FT                   RIRIQAINEIGVGPFSQFIKAKTRPLPPSPPRLECAASGPQSLKLKWGDSNSKTHAAGD
FT                   MVYTLQLEDRNKRFISIYRGPSHTYKVQRLTEFTCYSFRIQAMSEAGEGPYSETYTFST
FT                   TKSVPPTLKAPRVTQLEGNSCEIFWETVPPMRGDPVSYVLQVLVGRDSEYKQVYKGEEA
FT                   TFQISGLQSNTDYRFRVCACRRCVDTSQELSGAFSPSAAFMLQQREVMLTGDLGGMEEA
FT                   KMKGMMPTDEQFAALIVLGFATLSILFAFILQYFLMK"
FT   CDS             complement(join(11501467..11501778,11508227..11508354,
FT                   11510965..11511131,11521551..11521763,11532914..11533194,
FT                   11538049..11538198,11538587..11538700,11540318..11540440))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119508"
FT                   /product="mCG119508, isoform CRA_a"
FT                   /note="gene_id=mCG119508.1 transcript_id=mCT172120.0
FT                   protein_id=mCP95039.0 isoform=CRA_a"
FT                   /protein_id="EDL34929.1"
FT                   /translation="MTEPENVASEVYHGPELECTVGNLLPGTVYRFRVRALNDGGYGPY
FT                   SDVSEITTAAGPPGQCRAPRVSFTPDGCVLVGWESPASPGADISEYRLEWGEDEQSLEL
FT                   VYHGPDTCFEMRDLLPAAQYCCRLQAFNPAGAGPYSELVHCQTPASAPDPVSTLCVLEE
FT                   EPPSAHPDSPSVCLVLNWEEPCNNGSEILAYNIDLGDSCITVGNTTTHVMKNLLPETTY
FT                   RIRIQAINEIGVGPFSQFIKAKTRPLPPSPPRLECAASGPQSLKLKWGDSNSKTHAAGD
FT                   MVYTLQLEDRNKRFISIYRGPSHTYKVQRLTEFTCYSFRIQAMSEAGEGPYSETYTFST
FT                   TKSVPPTLKAPRVTQLEGNSCEIFWETVPPMRGDPVSYVLQVLVGRDSEYKQVYKGEEA
FT                   TFQISGLQSNTDYRFRVCACRRCVDTSQELSGAFSPSAAFMLQQREVMLTGDLGGMEEA
FT                   KMKGMMPTDEQFAALIVLGFATLSILFAFILQYFLMK"
FT   assembly_gap    11502471..11502661
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    11508655..11508776
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11517099..11517822
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    11529746..11529785
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    11547848..11549426
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   assembly_gap    11553410..11553429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11555227..11555246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11556919..11559465
FT                   /estimated_length=2547
FT                   /gap_type="unknown"
FT   assembly_gap    11561835..11563479
FT                   /estimated_length=1645
FT                   /gap_type="unknown"
FT   assembly_gap    11564932..11564951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11566469..11566488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11588998..11791694)
FT                   /locus_tag="mCG_119507"
FT                   /note="gene_id=mCG119507.1"
FT   mRNA            complement(join(<11588998..11589089,11617243..11617533,
FT                   11621161..11621404,11635409..11635485,11700181..11700256,
FT                   11723396..11723534,11791506..11791694))
FT                   /locus_tag="mCG_119507"
FT                   /product="mCG119507, transcript variant mCT172119"
FT                   /note="gene_id=mCG119507.1 transcript_id=mCT172119.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(11588998..11589089,11617243..11617533,
FT                   11621161..11621404,11635409..11635485,11700181..11700256,
FT                   11723396..11723506))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119507"
FT                   /product="mCG119507, isoform CRA_b"
FT                   /note="gene_id=mCG119507.1 transcript_id=mCT172119.0
FT                   protein_id=mCP95038.0 isoform=CRA_b"
FT                   /protein_id="EDL34931.1"
FT                   /translation="MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGEAAQQVILVQVNP
FT                   GETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQ
FT                   SPECYPPSYPSAMSPTHHLPPYLTHHPHFIQNSHTAYYPPVTVPGDMPPQFFPQPHLPP
FT                   TIYSEPEIIPLYGMSSYVTREDQYSKPPHKKLKDRQIDRQNRLNSPPSTIYKNSCATVY
FT                   NGYGKGHSGGSSGGGGGGSGGGPGIKKTERRARSSPKSSDSDLQGLSLVLLDCLEDSFV
FT                   LVLQVPSAFLLRFSD"
FT   mRNA            complement(join(<11588998..11589089,11617243..11617533,
FT                   11621161..11621404,11635409..11635485,11635551..11635625,
FT                   11639772..11639917,11641294..11641413,11641767..11641890,
FT                   11670496..>11670562))
FT                   /locus_tag="mCG_119507"
FT                   /product="mCG119507, transcript variant mCT120681"
FT                   /note="gene_id=mCG119507.1 transcript_id=mCT120681.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(11588998..11589089,11617243..11617533,
FT                   11621161..11621404,11635409..11635485,11635551..11635625,
FT                   11639772..11639917,11641294..11641413,11641767..11641890,
FT                   11670496..11670562))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119507"
FT                   /product="mCG119507, isoform CRA_a"
FT                   /note="gene_id=mCG119507.1 transcript_id=mCT120681.1
FT                   protein_id=mCP79636.1 isoform=CRA_a"
FT                   /protein_id="EDL34930.1"
FT                   /translation="MALAICGSVTTCVVLDLTTALKRQLSGQLEILVLKPVSSTEDLLP
FT                   ESEDWSFDIHLPQPTEKVSAVLKLLSHQFLVALLKMLDLCPIIPSLEQPLKLAGAPLFR
FT                   LLGVSRTLPSRQRSCVYSIRAEVSEHSVQQQHLVSRELEMPSHKKEAVARKLRQPWFQA
FT                   VVAIIEEKLSIVKTRPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPE
FT                   CYPPSYPSAMSPTHHLPPYLTHHPHFIQNSHTAYYPPVTVPGDMPPQFFPQPHLPPTIY
FT                   SEPEIIPLYGMSSYVTREDQYSKPPHKKLKDRQIDRQNRLNSPPSTIYKNSCATVYNGY
FT                   GKGHSGGSSGGGGGGSGGGPGIKKTERRARSSPKSSDSDLQGLSLVLLDCLEDSFVLVL
FT                   QVPSAFLLRFSD"
FT   assembly_gap    11596351..11596370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11620435..11620454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11660862..11660939
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    11666352..11666708
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    11674421..11674911
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    11676121..11676290
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    11689204..11689304
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    11706607..11708096
FT                   /estimated_length=1490
FT                   /gap_type="unknown"
FT   assembly_gap    11790947..11791016
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    11795104..11795364
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    11808477..11808782
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    11809786..11809843
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    11811282..11811314
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    11818910..11819145
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    11831052..11831071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11844142..11844161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11851762..11851786
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    11860744..11861509
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    11865267..11865465
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    11875970..11875989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11881814..11881833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11909532..11909619
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(11946089..11976705)
FT                   /locus_tag="mCG_60345"
FT                   /note="gene_id=mCG60345.2"
FT   mRNA            complement(join(11946089..11946236,11965102..11965425,
FT                   11966809..11966868,11976522..11976705))
FT                   /locus_tag="mCG_60345"
FT                   /product="mCG60345"
FT                   /note="gene_id=mCG60345.2 transcript_id=mCT60528.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(11946216..11946236,11965102..11965425,
FT                   11966809..11966868,11976522..11976680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60345"
FT                   /product="mCG60345"
FT                   /note="gene_id=mCG60345.2 transcript_id=mCT60528.2
FT                   protein_id=mCP25014.2"
FT                   /protein_id="EDL34932.1"
FT                   /translation="MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIA
FT                   CPIWNGALAVTAGSLVLLAHREWTQRYLWEAVFTFVILSILGCPLHFTVALQSALLGPY
FT                   CFYSFSGVAGTNYLGYVVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVS
FT                   LAVFIKLSARLMQTGYINGPKNPQ"
FT   assembly_gap    11951899..11951988
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    11966667..11966686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11981266..11981600
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    11984482..11984588
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    11996464..11996483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12000951..12001242
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    12015593..12015612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12018694..12210594
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /note="gene_id=mCG20179.1"
FT   mRNA            join(12018694..12018821,12032802..12032951,
FT                   12109069..12109259,12110119..12110246,12113495..12113640,
FT                   12114061..12114166,12116133..12116198,12124664..12124722,
FT                   12126066..12126158,12129833..12129985,12132903..12133052,
FT                   12134101..12134184,12141328..12141409,12148809..12148919,
FT                   12154108..12154308,12155885..12156098,12163470..12163598,
FT                   12164853..12164971,12166314..12166427,12173404..12173514,
FT                   12177296..12177384,12187376..12187489,12189852..12189901,
FT                   12197925..12198059,12201804..12201957,12207544..12207661,
FT                   12208745..12210594)
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, transcript variant mCT19149"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT19149.2 created
FT                   on 20-AUG-2002"
FT   mRNA            join(12018766..12018821,12032802..12032951,
FT                   12109069..12109259,12110119..12110246,12113495..12113640,
FT                   12114061..12114166,12116133..12116198,12124664..12124722,
FT                   12126066..12126158,12129833..12129985,12132903..12133052,
FT                   12134101..12134184,12141328..12141409,12148809..12148919,
FT                   12154108..12154308,12155885..12156098,12156867..12156980,
FT                   12163470..12163598,12164853..12164971,12166314..12166427,
FT                   12173404..12173514,12177296..12177384,12187376..12187489,
FT                   12189852..12189901,12197925..12198059,12201804..12201957,
FT                   12207544..12207661,12208745..12210594)
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, transcript variant mCT172197"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT172197.0 created
FT                   on 20-AUG-2002"
FT   assembly_gap    12024762..12025267
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    12057843..12057928
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    12061609..12061628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(12064824..12064883,12109069..12109259,
FT                   12110119..12110246,12113495..12113640,12114061..12114166,
FT                   12116133..12116198,12124664..12124722,12126066..12126158,
FT                   12129833..12129985,12132903..12133052,12134101..12134184,
FT                   12141328..12141409,12148809..12148919,12154108..12154308,
FT                   12155885..12156098,12163470..12163598,12164853..12164971,
FT                   12166314..12166427,12173404..12173514,12177296..12177384,
FT                   12187376..12187489,12189852..12189901,12197925..12198059,
FT                   12201804..12201957,12207544..12207661,12208745..12210594)
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, transcript variant mCT172198"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT172198.0 created
FT                   on 20-AUG-2002"
FT   assembly_gap    12086819..12087689
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    12088804..12088823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12089821..12089840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12092947..12092966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(12109100..12109259,12110119..12110246,
FT                   12113495..12113640,12114061..12114166,12116133..12116198,
FT                   12124664..12124722,12126066..12126158,12129833..12129985,
FT                   12132903..12133052,12134101..12134184,12141328..12141409,
FT                   12148809..12148919,12154108..12154308,12155885..12156098,
FT                   12156867..12156980,12163470..12163598,12164853..12164971,
FT                   12166314..12166427,12173404..12173514,12177296..12177384,
FT                   12187376..12187489,12189852..12189901,12197925..12198059,
FT                   12201804..12201957,12207544..12207661,12208745..12208969)
FT                   /codon_start=1
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, isoform CRA_a"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT172197.0
FT                   protein_id=mCP95117.0 isoform=CRA_a"
FT                   /db_xref="GOA:D6RH77"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="MGI:MGI:109585"
FT                   /db_xref="UniProtKB/TrEMBL:D6RH77"
FT                   /protein_id="EDL34933.1"
FT                   /translation="MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDAS
FT                   PGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYT
FT                   IELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSL
FT                   PRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGL
FT                   EGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKE
FT                   FRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRF
FT                   GSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRW
FT                   RLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSV
FT                   YLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASV
FT                   ESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADS
FT                   ISSIDSTSSYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTDTGSIRSVQTGVG
FT                   ELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVA
FT                   RHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSA
FT                   GIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDAIAQRILKAHREG
FT                   QRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWIN
FT                   YISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVI
FT                   VQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVS
FT                   TAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFP
FT                   LYFLSEENLLPSVGTKEAIVPMEVWT"
FT   CDS             join(12109100..12109259,12110119..12110246,
FT                   12113495..12113640,12114061..12114166,12116133..12116198,
FT                   12124664..12124722,12126066..12126158,12129833..12129985,
FT                   12132903..12133052,12134101..12134184,12141328..12141409,
FT                   12148809..12148919,12154108..12154308,12155885..12156098,
FT                   12163470..12163598,12164853..12164971,12166314..12166427,
FT                   12173404..12173514,12177296..12177384,12187376..12187489,
FT                   12189852..12189901,12197925..12198059,12201804..12201957,
FT                   12207544..12207661,12208745..12208969)
FT                   /codon_start=1
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, isoform CRA_b"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT172198.0
FT                   protein_id=mCP95116.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6NVF2"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="MGI:MGI:109585"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NVF2"
FT                   /protein_id="EDL34934.1"
FT                   /translation="MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDAS
FT                   PGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYT
FT                   IELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSL
FT                   PRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGL
FT                   EGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKE
FT                   FRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRF
FT                   GSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRW
FT                   RLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSV
FT                   YLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASV
FT                   ESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADS
FT                   ISSIDSTSNTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYST
FT                   PRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRY
FT                   QVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDK
FT                   VVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTM
FT                   CRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVII
FT                   GSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLS
FT                   DPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAK
FT                   EDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT"
FT   CDS             join(12109100..12109259,12110119..12110246,
FT                   12113495..12113640,12114061..12114166,12116133..12116198,
FT                   12124664..12124722,12126066..12126158,12129833..12129985,
FT                   12132903..12133052,12134101..12134184,12141328..12141409,
FT                   12148809..12148919,12154108..12154308,12155885..12156098,
FT                   12163470..12163598,12164853..12164971,12166314..12166427,
FT                   12173404..12173514,12177296..12177384,12187376..12187489,
FT                   12189852..12189901,12197925..12198059,12201804..12201957,
FT                   12207544..12207661,12208745..12208969)
FT                   /codon_start=1
FT                   /gene="Pld1"
FT                   /locus_tag="mCG_20179"
FT                   /product="phospholipase D1, isoform CRA_b"
FT                   /note="gene_id=mCG20179.1 transcript_id=mCT19149.2
FT                   protein_id=mCP2079.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q6NVF2"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="MGI:MGI:109585"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NVF2"
FT                   /protein_id="EDL34935.1"
FT                   /translation="MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDAS
FT                   PGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYT
FT                   IELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSL
FT                   PRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGL
FT                   EGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKE
FT                   FRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRF
FT                   GSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRW
FT                   RLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSV
FT                   YLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASV
FT                   ESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADS
FT                   ISSIDSTSNTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYST
FT                   PRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRY
FT                   QVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDK
FT                   VVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTM
FT                   CRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVII
FT                   GSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLS
FT                   DPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAK
FT                   EDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT"
FT   assembly_gap    12135216..12135235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12151525..12151544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12155637..12155656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12177173..12177221
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    12194037..12194835
FT                   /estimated_length=799
FT                   /gap_type="unknown"
FT   assembly_gap    12231042..12231061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12252346..12252365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12273935..12273954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12276744..12276763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12288699..12290429
FT                   /estimated_length=1731
FT                   /gap_type="unknown"
FT   assembly_gap    12291526..12291545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12295351..12295370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12313269..12313288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12340706..12340725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12342388..12746311
FT                   /locus_tag="mCG_16973"
FT                   /note="gene_id=mCG16973.3"
FT   mRNA            join(<12342388..12342873,12437942..12438007,
FT                   12574781..12574837,12586543..12586668,12605503..12605613,
FT                   12611856..12611946,12614410..12614540,12621987..12622090,
FT                   12627385..12627439,12629496..12629574,12636563..12636738,
FT                   12643356..12643422,12649870..12650074,12666515..12666625,
FT                   12668571..12668759,12676662..12676826,12679589..12679828,
FT                   12684308..12684414,12693435..12693598,12695511..12695608,
FT                   12702330..12702514,12710257..12710386,12722266..12722430,
FT                   12724812..12724923,12725696..12725866,12727452..12727595,
FT                   12729836..12729970,12737412..12737512,12739644..12739793,
FT                   12741407..12741566,12741816..12741955,12743626..12746311)
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, transcript variant mCT193299"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT193299.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12342450..12342873,12437942..12438007,
FT                   12574781..12574846,12743688..12743920)
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, transcript variant mCT172187"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172187.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(12342470..12342873,12437942..12438007,
FT                   12574781..12574837,12586543..12586668,12605503..12605613,
FT                   12611856..12611946,12614410..12614540,12627385..12627439,
FT                   12629496..12629574,12636563..12636738,12643356..12643422,
FT                   12649870..12650074,12666515..12666625,12667400..12667486,
FT                   12668571..12668759,12676662..12676826,12679589..12679828,
FT                   12684308..12684414,12693435..12693598,12695511..12695608,
FT                   12702330..12702514,12710257..12710386,12722266..12722430,
FT                   12724809..12724923,12725696..12725866,12727452..12727595,
FT                   12729836..12729970,12737412..12737512,12739644..12739793,
FT                   12741407..12741566,12741816..12741955,12743626..12746310)
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, transcript variant mCT172189"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172189.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(12342817..12342873,12437942..12438007,
FT                   12574781..12574846,12743688..12743756)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, isoform CRA_a"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172187.0
FT                   protein_id=mCP95106.0 isoform=CRA_a"
FT                   /protein_id="EDL34936.1"
FT                   /translation="MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHV
FT                   KTGQLAAIKVMDVTGVRKKFHDELVTEEHLALIFMALFLM"
FT   CDS             join(12342817..12342873,12437942..12438007,
FT                   12574781..12574837,12586543..12586668,12605503..12605613,
FT                   12611856..12611946,12614410..12614540,12627385..12627439,
FT                   12629496..12629574,12636563..12636738,12643356..12643422,
FT                   12649870..12650074,12666515..12666625,12667400..12667486,
FT                   12668571..12668759,12676662..12676826,12679589..12679828,
FT                   12684308..12684414,12693435..12693598,12695511..12695608,
FT                   12702330..12702514,12710257..12710386,12722266..12722430,
FT                   12724809..12724923,12725696..12725866,12727452..12727595,
FT                   12729836..12729970,12737412..12737512,12739644..12739793,
FT                   12741407..12741566,12741816..12741955,12743626..12743709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, isoform CRA_b"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172189.0
FT                   protein_id=mCP95108.0 isoform=CRA_b"
FT                   /protein_id="EDL34937.1"
FT                   /translation="MASDSPARSLDEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHV
FT                   KTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLV
FT                   MEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTE
FT                   NAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGIT
FT                   AIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATE
FT                   QLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSS
FT                   ILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQK
FT                   EQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQL
FT                   EILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPLEKKP
FT                   LYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGV
FT                   QPARTPPMLRPVDPQIPQLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEM
FT                   PRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSA
FT                   LGPRLGSQPIRASNPDLRRTEPVLESSLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAG
FT                   SSERSRVRANSKSEGSPVLPHEPSKVKPEESRDITRPSRPADLTALAKELRELRIEETN
FT                   RPLKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGNNEQYNMGM
FT                   VGTHGLETSHADTFGGSISREGTLMIRETAEEKKRSGHSDSNGFAGHINLPDLVQQSHS
FT                   PAGTPTEGLGRVSTHSQEMDSGAEQYGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDES
FT                   SAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAAL
FT                   WGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYY
FT                   LSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAP
FT                   KPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPS
FT                   HIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHS
FT                   NQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFM
FT                   TLNRNSMMNW"
FT   assembly_gap    12358497..12358791
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    12392023..12392202
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    12419698..12420449
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    12475045..12475064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(12489179..12489310,12574781..12574837,
FT                   12586543..12586668,12605503..12605613,12611856..12611946,
FT                   12614410..12614540,12627385..12627439,12629496..12629574,
FT                   12636563..12636738,12643356..12643422,12649870..12650074,
FT                   12666515..12666625,12667400..12667486,12668571..12668759,
FT                   12676662..12676826,12679589..12679828,12684308..12684414,
FT                   12693435..12693598,12695511..12695608,12702330..12702514,
FT                   12710257..12710386,12722266..12722430,12724809..12724923,
FT                   12725696..12725866,12727452..12727595,12729836..12729970,
FT                   12737412..12737512,12739644..12739793,12741407..12741566,
FT                   12741816..12741955,12743626..12746310)
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, transcript variant mCT15128"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT15128.2 created
FT                   on 20-AUG-2002"
FT   mRNA            join(12489179..12489310,12574781..12574837,
FT                   12586543..12586668,12605503..12605613,12611856..12611946,
FT                   12614410..12614540,12627385..12627439,12629496..12629574,
FT                   12636563..12636738,12643356..12643422,12649870..12650074,
FT                   12666515..12666625,12667400..12667486,12668571..12668759,
FT                   12676662..12676826,12679589..12679828,12684308..12684414,
FT                   12693435..12693598,12695511..12695608,12702330..12702514,
FT                   12710257..12710386,12722266..12722430,12724809..12724923,
FT                   12725696..12725866,12727452..12727595,12729836..12729970,
FT                   12737412..12737512,12739644..12739793,12741407..12741566,
FT                   12741816..12742133)
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, transcript variant mCT172188"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172188.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(12489191..12489310,12574781..12574837,
FT                   12586543..12586668,12605503..12605613,12611856..12611946,
FT                   12614410..12614540,12627385..12627439,12629496..12629574,
FT                   12636563..12636738,12643356..12643422,12649870..12650074,
FT                   12666515..12666625,12667400..12667486,12668571..12668759,
FT                   12676662..12676826,12679589..12679828,12684308..12684414,
FT                   12693435..12693598,12695511..12695608,12702330..12702514,
FT                   12710257..12710386,12722266..12722430,12724809..12724923,
FT                   12725696..12725866,12727452..12727595,12729836..12729970,
FT                   12737412..12737512,12739644..12739793,12741407..12741566,
FT                   12741816..12741955,12743626..12743709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, isoform CRA_e"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT15128.2
FT                   protein_id=mCP6990.2 isoform=CRA_e"
FT                   /protein_id="EDL34940.1"
FT                   /translation="MSELIGSLWQRELLMSELIGSLWQLFYNEGWKDLVRNERQGRHVK
FT                   TGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVM
FT                   EFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTEN
FT                   AEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITA
FT                   IEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQ
FT                   LMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSI
FT                   LNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKE
FT                   QRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLE
FT                   ILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPLEKKPL
FT                   YHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQ
FT                   PARTPPMLRPVDPQIPQLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP
FT                   RQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSAL
FT                   GPRLGSQPIRASNPDLRRTEPVLESSLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGS
FT                   SERSRVRANSKSEGSPVLPHEPSKVKPEESRDITRPSRPADLTALAKELRELRIEETNR
FT                   PLKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGNNEQYNMGMV
FT                   GTHGLETSHADTFGGSISREGTLMIRETAEEKKRSGHSDSNGFAGHINLPDLVQQSHSP
FT                   AGTPTEGLGRVSTHSQEMDSGAEQYGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDESS
FT                   AAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALW
FT                   GVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
FT                   SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPK
FT                   PYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSH
FT                   IQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSN
FT                   QIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMT
FT                   LNRNSMMNW"
FT   CDS             join(12489191..12489310,12574781..12574837,
FT                   12586543..12586668,12605503..12605613,12611856..12611946,
FT                   12614410..12614540,12627385..12627439,12629496..12629574,
FT                   12636563..12636738,12643356..12643422,12649870..12650074,
FT                   12666515..12666625,12667400..12667486,12668571..12668759,
FT                   12676662..12676826,12679589..12679828,12684308..12684414,
FT                   12693435..12693598,12695511..12695608,12702330..12702514,
FT                   12710257..12710386,12722266..12722430,12724809..12724923,
FT                   12725696..12725866,12727452..12727595,12729836..12729970,
FT                   12737412..12737512,12739644..12739793,12741407..12741566,
FT                   12741816..12742072)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, isoform CRA_d"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT172188.0
FT                   protein_id=mCP95107.0 isoform=CRA_d"
FT                   /protein_id="EDL34939.1"
FT                   /translation="MSELIGSLWQRELLMSELIGSLWQLFYNEGWKDLVRNERQGRHVK
FT                   TGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVM
FT                   EFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTEN
FT                   AEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITA
FT                   IEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQ
FT                   LMKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSI
FT                   LNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKE
FT                   QRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLE
FT                   ILQQQLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPLEKKPL
FT                   YHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQ
FT                   PARTPPMLRPVDPQIPQLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP
FT                   RQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSAL
FT                   GPRLGSQPIRASNPDLRRTEPVLESSLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGS
FT                   SERSRVRANSKSEGSPVLPHEPSKVKPEESRDITRPSRPADLTALAKELRELRIEETNR
FT                   PLKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGNNEQYNMGMV
FT                   GTHGLETSHADTFGGSISREGTLMIRETAEEKKRSGHSDSNGFAGHINLPDLVQQSHSP
FT                   AGTPTEGLGRVSTHSQEMDSGAEQYGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDESS
FT                   AAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALW
FT                   GVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
FT                   SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPK
FT                   PYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSH
FT                   IQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSN
FT                   QIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVNPFQLCFSVCILRDHQV
FT                   PVKPSFSFILTQVTSVFNDQ"
FT   assembly_gap    12491694..12491713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12547128..12547147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12561437..12561679
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    12564120..12564139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12565610..12566025
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    12573490..12573580
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    12597703..12597722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12607667..12607953
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   CDS             join(<12622067..12622090,12627385..12627439,
FT                   12629496..12629574,12636563..12636738,12643356..12643422,
FT                   12649870..12650074,12666515..12666625,12668571..12668759,
FT                   12676662..12676826,12679589..12679828,12684308..12684414,
FT                   12693435..12693598,12695511..12695608,12702330..12702514,
FT                   12710257..12710386,12722266..12722430,12724812..12724923,
FT                   12725696..12725866,12727452..12727595,12729836..12729970,
FT                   12737412..12737512,12739644..12739793,12741407..12741566,
FT                   12741816..12741955,12743626..12743709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16973"
FT                   /product="mCG16973, isoform CRA_c"
FT                   /note="gene_id=mCG16973.3 transcript_id=mCT193299.0
FT                   protein_id=mCP114271.0 isoform=CRA_c"
FT                   /protein_id="EDL34938.1"
FT                   /translation="AAPWPGGNSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPA
FT                   PRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRT
FT                   KKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEAL
FT                   RRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHY
FT                   EEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPLEK
FT                   KPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSIS
FT                   GVQPARTPPMLRPVDPQIPQLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRV
FT                   EMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNG
FT                   SALGPRLGSQPIRASNPDLRRTEPVLESSLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQ
FT                   AGSSERSRVRANSKSEGSPVLPHEPSKVKPEESRDITRPSRPADLTALAKELRELRIEE
FT                   TNRPLKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGNNEQYNM
FT                   GMVGTHGLETSHADTFGGSISREGTLMIRETAEEKKRSGHSDSNGFAGHINLPDLVQQS
FT                   HSPAGTPTEGLGRVSTHSQEMDSGAEYGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDE
FT                   SSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAA
FT                   LWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVY
FT                   YLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWA
FT                   PKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIP
FT                   SHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIH
FT                   SNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFF
FT                   MTLNRNSMMNW"
FT   assembly_gap    12622482..12622845
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    12625070..12625193
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    12678935..12678996
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    12691848..12691867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12696807..12696826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12713122..12713141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12716026..12716045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12718002..12718021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12720744..12720763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12721837..12721856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12732516..12732535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12746997..12747016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12772137..12772156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12773610..12803742
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /note="gene_id=mCG16972.2"
FT   mRNA            join(12773610..12773675,12781357..12781449,
FT                   12784045..12784304,12789324..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797607,
FT                   12801640..12801741,12802391..12802594,12802685..12803737)
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, transcript variant mCT15127"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT15127.2 created
FT                   on 20-AUG-2002"
FT   mRNA            join(12773628..12773675,12781357..12781449,
FT                   12784045..12784152,12789406..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797607,
FT                   12801640..12801741,12802391..12802594,12802685..12803737)
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, transcript variant mCT172185"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT172185.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(12773629..12773675,12781357..12781449,
FT                   12784045..12784304,12789324..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797521,
FT                   12803393..12803742)
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, transcript variant mCT172186"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT172186.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(12773661..12773675,12781357..12781449,
FT                   12784045..12784304,12789324..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797521,
FT                   12803393..12803415)
FT                   /codon_start=1
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT172186.0
FT                   protein_id=mCP95105.0 isoform=CRA_b"
FT                   /protein_id="EDL34942.1"
FT                   /translation="MSEDKITGTLAFTVFTAVLSSFQFGYDIGVINAPQEVIISHYRHV
FT                   LGVPLDDRKAAINYDVNGTDTPLTVTPAYTTPAPWDEEETEGSAHIVTMLWSLSVSSFA
FT                   VGGMVASFFGGWLGDKLGRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLY
FT                   CGLISGLVPMYIGEIAPTTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHILLG
FT                   LSAVPALLQCLLLLFCPESPRYLYIKLEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEE
FT                   ASTEQKVSVIQLFTDANYRQPILVALMLHMAQQFSGINGIFYYSTTIFCIFI"
FT   CDS             join(12773661..12773675,12781357..12781449,
FT                   12784045..12784304,12789324..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797607,
FT                   12801640..12801741,12802391..12802594,12802685..12802885)
FT                   /codon_start=1
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, isoform CRA_c"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT15127.2
FT                   protein_id=mCP6989.2 isoform=CRA_c"
FT                   /protein_id="EDL34943.1"
FT                   /translation="MSEDKITGTLAFTVFTAVLSSFQFGYDIGVINAPQEVIISHYRHV
FT                   LGVPLDDRKAAINYDVNGTDTPLTVTPAYTTPAPWDEEETEGSAHIVTMLWSLSVSSFA
FT                   VGGMVASFFGGWLGDKLGRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLY
FT                   CGLISGLVPMYIGEIAPTTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHILLG
FT                   LSAVPALLQCLLLLFCPESPRYLYIKLEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEE
FT                   ASTEQKVSVIQLFTDANYRQPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISQPVYA
FT                   TIGVGAINMIFTAVSVLLVEKAGRRTLFLTGMIGMFFCTIFMSVGLVLLDKFAWMSYVS
FT                   MTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYIAD
FT                   FLGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEIAAEFRKKSGSAPPRKAAVQMEFL
FT                   ASSESV"
FT   CDS             join(12773661..12773675,12781357..12781449,
FT                   12784045..12784152,12789406..12789448,12793047..12793162,
FT                   12794314..12794476,12794965..12795152,12797503..12797607,
FT                   12801640..12801741,12802391..12802594,12802685..12802885)
FT                   /codon_start=1
FT                   /gene="Slc2a2"
FT                   /locus_tag="mCG_16972"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG16972.2 transcript_id=mCT172185.0
FT                   protein_id=mCP95104.0 isoform=CRA_a"
FT                   /protein_id="EDL34941.1"
FT                   /translation="MSEDKITGTLAFTVFTAVLSSFQFGYDIGVINAPQEVIISHYRHV
FT                   LGVPLDDRKAAINYDVNGTDTPLTVTPALIIAGRSVSGLYCGLISGLVPMYIGEIAPTT
FT                   LRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHILLGLSAVPALLQCLLLLFCPES
FT                   PRYLYIKLEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEEASTEQKVSVIQLFTDANYR
FT                   QPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISQPVYATIGVGAINMIFTAVSVLLV
FT                   EKAGRRTLFLTGMIGMFFCTIFMSVGLVLLDKFAWMSYVSMTAIFLFVSFFEIGPGPIP
FT                   WFMVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYIADFLGPYVFFLFAGVVLVFTL
FT                   FTFFKVPETKGKSFEEIAAEFRKKSGSAPPRKAAVQMEFLASSESV"
FT   assembly_gap    12796731..12796866
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    12799926..12799945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12810831..12810850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12815013..>12856864)
FT                   /locus_tag="mCG_146079"
FT                   /note="gene_id=mCG146079.0"
FT   mRNA            complement(join(12815013..12815195,12818355..12818476,
FT                   12856692..>12856864))
FT                   /locus_tag="mCG_146079"
FT                   /product="mCG146079"
FT                   /note="gene_id=mCG146079.0 transcript_id=mCT186182.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(12815183..12815195,12818355..12818476,
FT                   12856692..>12856769))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146079"
FT                   /product="mCG146079"
FT                   /note="gene_id=mCG146079.0 transcript_id=mCT186182.0
FT                   protein_id=mCP107280.0"
FT                   /protein_id="EDL34944.1"
FT                   /translation="RQRFSRSVLSFHSFIIASSLTLERIKSSGFPKPQDLTDIRHYAHS
FT                   TKRSCLQSTDHHPGREALFLMRTYF"
FT   assembly_gap    12817504..12817534
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    12821870..12821892
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    12834381..12834400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12839468..12840605
FT                   /estimated_length=1138
FT                   /gap_type="unknown"
FT   gene            complement(12840606..12841568)
FT                   /locus_tag="mCG_120086"
FT                   /note="gene_id=mCG120086.0"
FT   mRNA            complement(12840606..12841568)
FT                   /locus_tag="mCG_120086"
FT                   /product="mCG120086"
FT                   /note="gene_id=mCG120086.0 transcript_id=mCT121267.0
FT                   created on 20-AUG-2002"
FT   CDS             complement(12840886..12841536)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120086"
FT                   /product="mCG120086"
FT                   /note="gene_id=mCG120086.0 transcript_id=mCT121267.0
FT                   protein_id=mCP79301.1"
FT                   /protein_id="EDL34945.1"
FT                   /translation="MSWFRAAPENASLGDQDVFDEEADESLLAQREWQGHMRKRVQEGY
FT                   RDGLDAGKALTLQRGFNQGYKEGADVIINYGLLRGTLSALLSWCHLHGNSSTLISKISN
FT                   LLDTVDQCEECVLRRLKSVTSQPRVTDLLDAIEDMDLCHVVPSDQAEGDSNAEINTDSD
FT                   SPNGMGCSHPEHCRPKEHAHLEKPSLSWILEQTSSLVKQLGVPADILQHLRQL"
FT   assembly_gap    12857398..12858069
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   gene            12858255..12873627
FT                   /gene="Eif5a2"
FT                   /locus_tag="mCG_16974"
FT                   /note="gene_id=mCG16974.1"
FT   mRNA            join(12858255..12858463,12858975..12859079,
FT                   12872634..12872765,12873345..12873627)
FT                   /gene="Eif5a2"
FT                   /locus_tag="mCG_16974"
FT                   /product="eukaryotic translation initiation factor 5A2"
FT                   /note="gene_id=mCG16974.1 transcript_id=mCT15129.1 created
FT                   on 20-AUG-2002"
FT   CDS             join(12858299..12858463,12858975..12859079,
FT                   12872634..12872765,12873345..12873404)
FT                   /codon_start=1
FT                   /gene="Eif5a2"
FT                   /locus_tag="mCG_16974"
FT                   /product="eukaryotic translation initiation factor 5A2"
FT                   /note="gene_id=mCG16974.1 transcript_id=mCT15129.1
FT                   protein_id=mCP6986.2"
FT                   /protein_id="EDL34946.1"
FT                   /translation="MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMST
FT                   SKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTE
FT                   TGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK"
FT   assembly_gap    12863198..12863217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12864668..12864687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12866390..12866409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12879107..12879126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12881385..12881404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12885019..12887931)
FT                   /locus_tag="mCG_148196"
FT                   /note="gene_id=mCG148196.0"
FT   mRNA            complement(join(12885019..12885175,12887855..12887931))
FT                   /locus_tag="mCG_148196"
FT                   /product="mCG148196"
FT                   /note="gene_id=mCG148196.0 transcript_id=mCT188459.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12885048..12885158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148196"
FT                   /product="mCG148196"
FT                   /note="gene_id=mCG148196.0 transcript_id=mCT188459.0
FT                   protein_id=mCP108124.0"
FT                   /protein_id="EDL34947.1"
FT                   /translation="MAITDTMKTRLALNPQRYSSFCFISAGIKDVLNHAW"
FT   assembly_gap    12886394..12886413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12888021..12890008
FT                   /locus_tag="mCG_16976"
FT                   /note="gene_id=mCG16976.1"
FT   mRNA            join(12888021..12888174,12889096..12889185,
FT                   12889263..12889451,12889780..12889939)
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, transcript variant mCT172190"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT172190.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(12888100..12888136,12889093..12889185,
FT                   12889330..12889451,12889780..12890008)
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, transcript variant mCT15131"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT15131.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(12888118..12888136,12889096..12889185,
FT                   12889330..12889451,12889780..12890008)
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, transcript variant mCT179954"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT179954.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(12888121..12888174,12889093..12889453)
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, transcript variant mCT172191"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT172191.0 created
FT                   on 11-FEB-2003"
FT   CDS             join(12888128..12888136,12889093..12889185,
FT                   12889330..12889451,12889780..12889924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, isoform CRA_c"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT15131.0
FT                   protein_id=mCP6988.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q0VBA4"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR028370"
FT                   /db_xref="MGI:MGI:1915278"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBA4"
FT                   /protein_id="EDL34950.1"
FT                   /translation="MAPQKDKKPKKSTWRFHLDLTHPVEDGIFDSGNFEQFLREKVKVN
FT                   GKTGNLGNVVHIERLKNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETY
FT                   ELRYFQISQDEDGSESED"
FT   CDS             join(12888128..12888136,12889096..12889185,
FT                   12889330..12889451,12889780..12889924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, isoform CRA_b"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT179954.0
FT                   protein_id=mCP102876.0 isoform=CRA_b"
FT                   /protein_id="EDL34949.1"
FT                   /translation="MAPKDKKPKKSTWRFHLDLTHPVEDGIFDSGNFEQFLREKVKVNG
FT                   KTGNLGNVVHIERLKNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYE
FT                   LRYFQISQDEDGSESED"
FT   CDS             join(12888128..12888174,12889093..12889156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, isoform CRA_a"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT172191.0
FT                   protein_id=mCP95109.0 isoform=CRA_a"
FT                   /protein_id="EDL34948.1"
FT                   /translation="MAPVSARACAGLGCYSRKTRSLRSPPGGFIWTLLIQ"
FT   CDS             join(12888128..12888174,12889096..12889156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16976"
FT                   /product="mCG16976, isoform CRA_d"
FT                   /note="gene_id=mCG16976.1 transcript_id=mCT172190.0
FT                   protein_id=mCP95110.0 isoform=CRA_d"
FT                   /protein_id="EDL34951.1"
FT                   /translation="MAPVSARACAGLGCYRKTRSLRSPPGGFIWTLLIQ"
FT   assembly_gap    12896686..12896705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12922897..12922916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12924064..12924083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12925389..12925672
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    12927062..12928273
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   assembly_gap    12930894..12931174
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    12961252..12986071
FT                   /estimated_length=24820
FT                   /gap_type="unknown"
FT   assembly_gap    12987648..12995573
FT                   /estimated_length=7926
FT                   /gap_type="unknown"
FT   assembly_gap    13000058..13002594
FT                   /estimated_length=2537
FT                   /gap_type="unknown"
FT   assembly_gap    13003575..13005727
FT                   /estimated_length=2153
FT                   /gap_type="unknown"
FT   assembly_gap    13006999..13007018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13007941..13008657
FT                   /estimated_length=717
FT                   /gap_type="unknown"
FT   assembly_gap    13012780..13012799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13018415..13018434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13064671..13065281
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    13067230..13067727
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    13072785..13077370
FT                   /estimated_length=4586
FT                   /gap_type="unknown"
FT   assembly_gap    13081316..13081335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13103598..13105186
FT                   /estimated_length=1589
FT                   /gap_type="unknown"
FT   assembly_gap    13108780..13109125
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    13116765..13119317
FT                   /estimated_length=2553
FT                   /gap_type="unknown"
FT   gene            13135022..13716218
FT                   /locus_tag="mCG_140927"
FT                   /note="gene_id=mCG140927.0"
FT   mRNA            join(13135022..13135386,13195364..13195498,
FT                   13198844..13198953,13200501..13200605,13554675..13554797,
FT                   13624900..13625022,13689688..13689807,13692240..13692362,
FT                   13701720..13701857,13706965..13707087,13712832..13713029,
FT                   13715156..13716218)
FT                   /locus_tag="mCG_140927"
FT                   /product="mCG140927"
FT                   /note="gene_id=mCG140927.0 transcript_id=mCT172250.0
FT                   created on 20-AUG-2002"
FT   CDS             join(13135298..13135386,13195364..13195498,
FT                   13198844..13198953,13200501..13200605,13554675..13554797,
FT                   13624900..13625022,13689688..13689807,13692240..13692362,
FT                   13701720..13701857,13706965..13707087,13712832..13713029,
FT                   13715156..13715355)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140927"
FT                   /product="mCG140927"
FT                   /note="gene_id=mCG140927.0 transcript_id=mCT172250.0
FT                   protein_id=mCP95169.0"
FT                   /protein_id="EDL34952.1"
FT                   /translation="MTSPLCFWCFCVWAAANWPPGSALQLQPGMPNVCREEQLTLVRLS
FT                   RPCAQAFIDTIQFWKQGCSGPRWCVGYERRIRYYIIYRHVYATEHQTVFRCCPGWIQWD
FT                   DEPGCFSSLSSLGTHFSGRECSYQDTRQCLCSQGFHGPHCQYDINECAVDNGGCRDRCC
FT                   NTIGSYYCRCQAGQKLEEDGRGCEDVDECAVVNGGCQQRCINTLGTFHCECDTGYRRHA
FT                   DERTCIKTDPCAGANGCAHLCQTENGMARCACHAGYQLSEDKKACEDINECAEELAPCA
FT                   HHCVNSKGSFTCTCHPGFELGADRKHCYRIELEIVNICEKNNGGCSHHCEPAIGGAHCS
FT                   CNHGHQLDTDGKTCIDFDECESGEACCAQLCINYLGGYECSCEEGFQISSDGCGCDALD
FT                   EQLEEEEEEIDILRFPGRLAQNPPQPFPYLDPSLTASYEDEDNDDADSEAEGEVQGLTA
FT                   LYRVVCLDGTFGLDCSLSCEDCMNGGRCQEGKSGCLCPAEWTGLICNESSVLRTGEDQQ
FT                   APAGEFSTKAP"
FT   assembly_gap    13137045..13137064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13139932..13140681
FT                   /estimated_length=750
FT                   /gap_type="unknown"
FT   assembly_gap    13143290..13145278
FT                   /estimated_length=1989
FT                   /gap_type="unknown"
FT   assembly_gap    13151050..13151069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13152124..13152143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13235947..13236076
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    13291369..13291389
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13292385..13292448
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    13295939..13295977
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    13305563..13306430
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   assembly_gap    13336449..13336687
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    13346130..13346149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13365095..13365114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13367335..13367448
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    13368460..13368479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13371588..13371726
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    13374991..13375271
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    13387351..13387402
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    13462147..13462187
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    13474961..13474980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13493407..13493464
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    13500549..13500685
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    13519114..13520471
FT                   /estimated_length=1358
FT                   /gap_type="unknown"
FT   assembly_gap    13528338..13529007
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    13530747..13531361
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    13533697..13534251
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    13541614..13541706
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    13564186..13566097
FT                   /estimated_length=1912
FT                   /gap_type="unknown"
FT   assembly_gap    13567562..13567637
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    13584837..13584856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13593963..13595122
FT                   /estimated_length=1160
FT                   /gap_type="unknown"
FT   assembly_gap    13596527..13597593
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   assembly_gap    13623826..13623935
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13637214..13637941
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   assembly_gap    13659439..13659458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13663282..13663600
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    13694595..13695578
FT                   /estimated_length=984
FT                   /gap_type="unknown"
FT   assembly_gap    13696876..13696895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13730952..13730971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13738537..13738556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13761577..13761596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13765932..13765951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13767248..13767267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13779593..13779612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13782823..13782842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13791522..13791541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13792908..13797051
FT                   /estimated_length=4144
FT                   /gap_type="unknown"
FT   assembly_gap    13798159..13798178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13819034..13935578)
FT                   /locus_tag="mCG_4639"
FT                   /note="gene_id=mCG4639.1"
FT   mRNA            complement(join(13819034..13819120,13880715..13880812,
FT                   13913128..13913315,13935451..13935578))
FT                   /locus_tag="mCG_4639"
FT                   /product="mCG4639"
FT                   /note="gene_id=mCG4639.1 transcript_id=mCT3962.1 created on
FT                   20-AUG-2002"
FT   assembly_gap    13825937..13826602
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    13828676..13831174
FT                   /estimated_length=2499
FT                   /gap_type="unknown"
FT   assembly_gap    13844464..13844483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13848250..13848269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13863264..13863283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13866683..13866702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13869006..13869025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13880790..13880812,13913128..13913315,
FT                   13935451..13935542))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4639"
FT                   /product="mCG4639"
FT                   /note="gene_id=mCG4639.1 transcript_id=mCT3962.1
FT                   protein_id=mCP2224.2"
FT                   /protein_id="EDL34953.1"
FT                   /translation="MINWGKVSLPRKHEIPLGTRAFTHGILSSFTSGQSLNCWLFYKGR
FT                   AATARSNAIIKNRIIRLSGGYNSKINSYFCQPQHSTKPSDHNWAVEDTVQVYSPP"
FT   assembly_gap    13891099..13891732
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    13947651..13947673
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    13954792..13955333
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    13957482..13957501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13967290..13967309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13982016..13982241
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            complement(13994116..14582656)
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /note="gene_id=mCG140922.1"
FT   mRNA            complement(join(13994116..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14020103..14020190,
FT                   14022445..14023801,14028181..14028334,14029923..14030070,
FT                   14036328..14036544,14040421..14040523,14052476..14052610,
FT                   14176248..14176344))
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, transcript
FT                   variant mCT172122"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT172122.1
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(13994116..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14015524..14015550,
FT                   14020103..14020190,14022445..14023801,14028181..14028334,
FT                   14029923..14030070,14036328..14036544,14040421..14040523,
FT                   14052476..14052610,14176248..14176344))
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, transcript
FT                   variant mCT172121"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT172121.1
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(13994122..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14015524..14015550,
FT                   14020103..14020190,14022445..14023801,14028181..14028337,
FT                   14029923..14030070,14040421..14040523,14052476..14052610,
FT                   14272229..14272572,14581849..14582656))
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, transcript
FT                   variant mCT185350"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185350.0
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(13995531..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14020103..14020190,
FT                   14022445..14023801,14028181..14028334,14029923..14030070,
FT                   14036328..14036544,14040421..14040469))
FT                   /codon_start=1
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT172122.1
FT                   protein_id=mCP95041.0 isoform=CRA_a"
FT                   /db_xref="GOA:H9T841"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036970"
FT                   /db_xref="MGI:MGI:95457"
FT                   /db_xref="UniProtKB/TrEMBL:H9T841"
FT                   /protein_id="EDL34954.1"
FT                   /translation="MKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCS
FT                   TPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYK
FT                   CDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACP
FT                   ECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDC
FT                   GQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADY
FT                   FGTNRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPL
FT                   LTHPQILPATQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVST
FT                   PSGSDLETTSGSDLESDLESDKEKCKENGKMFKDKVSPLQNLASITNKKEHNNHSVFSA
FT                   SVEEQSAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQ
FT                   SMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGPSKPSGT
FT                   PATSQDQPLDLSMGSRGRASGTKLTEPRKNHVFGEKKGSNMDTRPSSDGSLQHARPTPF
FT                   FMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASE
FT                   LLQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYR
FT                   CKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTA
FT                   TSSPHSELESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDKKALA
FT                   TSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKPRKELGVTRLDEEIPEDDYEEAGALEMS
FT                   CKASPVRYKEEDYKSGLSALDHIRHFTDSLKMREMEENQYTDAELSSISSSHVPEELKQ
FT                   TLHRKSKSQAYAMMLSLSDKDSLHPTSHSSSNVWHSMARAAAESSAIQSISHV"
FT   CDS             complement(join(13995531..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14015524..14015550,
FT                   14020103..14020190,14022445..14023801,14028181..14028334,
FT                   14029923..14030070,14036328..14036544,14040421..14040469))
FT                   /codon_start=1
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT172121.1
FT                   protein_id=mCP95040.1 isoform=CRA_d"
FT                   /db_xref="GOA:G3UZT5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036970"
FT                   /db_xref="MGI:MGI:95457"
FT                   /db_xref="UniProtKB/TrEMBL:G3UZT5"
FT                   /protein_id="EDL34957.1"
FT                   /translation="MKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCS
FT                   TPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYK
FT                   CDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACP
FT                   ECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDC
FT                   GQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADY
FT                   FGTNRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPL
FT                   LTHPQILPATQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVST
FT                   PSGSDLETTSGSDLESDLESDKEKCKENGKMFKDKVSPLQNLASITNKKEHNNHSVFSA
FT                   SVEEQSAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQ
FT                   SMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGPSKPSGT
FT                   PATSQDQPLDLSMGSRGRASGTKLTEPRKNHVFGEKKGSNMDTRPSSDGSLQHARPTPF
FT                   FMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFPLPDQRTWMSAIENMAEKLESF
FT                   SALKPEASELLQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLR
FT                   THTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH
FT                   ENGNMSGTATSSPHSELESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGS
FT                   HFKDKKALATSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKPRKELGVTRLDEEIPEDDY
FT                   EEAGALEMSCKASPVRYKEEDYKSGLSALDHIRHFTDSLKMREMEENQYTDAELSSISS
FT                   SHVPEELKQTLHRKSKSQAYAMMLSLSDKDSLHPTSHSSSNVWHSMARAAAESSAIQSI
FT                   SHV"
FT   CDS             complement(join(13995531..13995665,13999123..13999306,
FT                   14000130..14000366,14003792..14003936,14005878..14006047,
FT                   14008266..14008343,14009470..14009636,14015524..14015550,
FT                   14020103..14020190,14022445..14023801,14028181..14028337,
FT                   14029923..14030057))
FT                   /codon_start=1
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185350.0
FT                   protein_id=mCP106608.0 isoform=CRA_b"
FT                   /protein_id="EDL34955.1"
FT                   /translation="MLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAK
FT                   QVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKS
FT                   YTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGI
FT                   SLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAGLTFPTAPGFSFSFPGLFPSGLYHR
FT                   PPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKHPPVGDNKPVELLP
FT                   ERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESDKEKCKENGKMFK
FT                   DKVSPLQNLASITNKKEHNNHSVFSASVEEQSAVSGAVNDSIKAIASIAEKYFGSTGLV
FT                   GLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSS
FT                   ESPFDLTTKRKDEKPLTSGPSKPSGTPATSQDQPLDLSMGSRGRASGTKLTEPRKNHVF
FT                   GEKKGSNMDTRPSSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLF
FT                   HPQFPLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPNTLPENLLR
FT                   KGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNK
FT                   EKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESAGAILDDKEDAYFT
FT                   EIRNFIGNSNHGSQSPRNMEERMNGSHFKDKKALATSQNSDLLDDEEVEDEVLLDEEDE
FT                   DNDIPGKPRKELGVTRLDEEIPEDDYEEAGALEMSCKASPVRYKEEDYKSGLSALDHIR
FT                   HFTDSLKMREMEENQYTDAELSSISSSHVPEELKQTLHRKSKSQAYAMMLSLSDKDSLH
FT                   PTSHSSSNVWHSMARAAAESSAIQSISHV"
FT   mRNA            complement(join(14026824..14028337,14029923..14030070,
FT                   14036328..14036544,14040421..14040523,14052476..14052610,
FT                   14055255..14055917))
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, transcript
FT                   variant mCT185351"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185351.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(14026824..14027106,14028181..14028337,
FT                   14029923..14030070,14036328..14036544,14040421..14040523,
FT                   14052476..14052610,14055255..14055774))
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, transcript
FT                   variant mCT185352"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185352.0
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(14027105..14027106,14028181..14028337,
FT                   14029923..14030070,14036328..14036544,14040421..14040469))
FT                   /codon_start=1
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185352.0
FT                   protein_id=mCP106609.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8BQB3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036970"
FT                   /db_xref="MGI:MGI:95457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQB3"
FT                   /protein_id="EDL34958.1"
FT                   /translation="MKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCS
FT                   TPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYK
FT                   CDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHAC
FT                   PECGKTFATSSGLKQHKHIHSSVKPFI"
FT   CDS             complement(join(14028131..14028337,14029923..14030070,
FT                   14036328..14036544,14040421..14040469))
FT                   /codon_start=1
FT                   /gene="Evi1"
FT                   /locus_tag="mCG_140922"
FT                   /product="ecotropic viral integration site 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG140922.1 transcript_id=mCT185351.0
FT                   protein_id=mCP106610.0 isoform=CRA_c"
FT                   /protein_id="EDL34956.1"
FT                   /translation="MKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCS
FT                   TPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYK
FT                   CDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHAC
FT                   PECGKTFATSSGLKQHKHIHSSVKPFICKSLNTPAFFLHPSLL"
FT   assembly_gap    14029070..14029240
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    14036614..14036633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14042065..14042084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14092427..14092599
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    14099287..14099530
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    14115893..14116300
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    14132267..14132341
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    14156174..14156193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14160231..14160426
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    14161460..14161922
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    14164257..14164276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14191007..14191026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14199884..14199939
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    14205633..14206105
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    14214219..14214739
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    14216206..14216225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14218627..14218843
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    14263639..14265673
FT                   /estimated_length=2035
FT                   /gap_type="unknown"
FT   assembly_gap    14287331..14287350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14314514..14314642
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    14350112..14350131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14427321..14427340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14432133..14432746
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    14435185..14435204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14436413..14436432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14440060..14440130
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    14454778..14455104
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    14456505..14456827
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    14458591..14458639
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    14482623..14482745
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    14495800..14495846
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    14506389..14507176
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    14515072..14515091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14561730..14561922
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    14590102..14590121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14600084..14600103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14600867..14600886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14606591..14606610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14615674..14615796
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    14623602..14623621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14625303..14625452
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    14627511..14627996
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    14629059..14629181
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            complement(14631447..>14633136)
FT                   /gene="Arpm1"
FT                   /locus_tag="mCG_54131"
FT                   /note="gene_id=mCG54131.2"
FT   mRNA            complement(14631447..>14633136)
FT                   /gene="Arpm1"
FT                   /locus_tag="mCG_54131"
FT                   /product="actin related protein M1"
FT                   /note="gene_id=mCG54131.2 transcript_id=mCT54314.2 created
FT                   on 13-FEB-2003"
FT   CDS             complement(14632209..>14633135)
FT                   /codon_start=1
FT                   /gene="Arpm1"
FT                   /locus_tag="mCG_54131"
FT                   /product="actin related protein M1"
FT                   /note="gene_id=mCG54131.2 transcript_id=mCT54314.2
FT                   protein_id=mCP25220.1"
FT                   /protein_id="EDL34959.1"
FT                   /translation="PPSSYPVERGLISSWGDMEIMWKHIYDYNLNLNASDGPVLVTEPA
FT                   LNPLADRQHISEVFFENLGVPAFYMSAQAVLALFAAGFTTGLVLNSGAGITQCVPIFEG
FT                   YCLSHGVKQLNVAGSDLTSYLMMLLKGDGIMLLRTGDRKVVTDIKENACYVAMNYEDEM
FT                   TKDSNLEKIYTLPDGKTVKLHKQLFHCPEALFSPYLVNVDAPGIDKMCFGSIMKCDTDL
FT                   RNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPANTAVQVIAPPERKISVWMGGSILAS
FT                   LSAFQDMWITAAEFEEVGPNIVHQRCF"
FT   assembly_gap    14633862..14634928
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   gene            14637008..14654227
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /note="gene_id=mCG4734.2"
FT   mRNA            join(14637008..14637067,14637876..14638172,
FT                   14641408..14642201,14643353..14643512,14645809..14645987,
FT                   14647920..14648006,14650920..14652725)
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, transcript variant mCT172234"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT172234.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(14637016..14637067,14637876..14638042,
FT                   14641408..14642201,14643353..14643512,14645809..14645987,
FT                   14646837..14646920,14647920..14648006,14650920..14652725)
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, transcript variant mCT172233"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT172233.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(14637019..14637067,14637876..14638172,
FT                   14641408..14642201,14643353..14643512,14645809..14645987,
FT                   14646837..14646920,14647920..14648006,14650920..14654227)
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, transcript variant mCT3473"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT3473.2 created on
FT                   20-AUG-2002"
FT   CDS             join(14637907..14638172,14641408..14642201,
FT                   14643353..14643512,14645809..14645987,14646837..14646920,
FT                   14647920..14648006,14650920..14651182)
FT                   /codon_start=1
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, isoform CRA_c"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT3473.2
FT                   protein_id=mCP2208.2 isoform=CRA_c partial"
FT                   /protein_id="EDL34962.1"
FT                   /translation="MQYSHHCEHLLERLNKQREAGFLCDCTVVIGEFQFKAHRNVLASF
FT                   SEYFGAIYRSTSENNVFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKV
FT                   EEVVTKCKIKMEDFAFIASPSSTEISSITGNIELNQQACLLTLRDYNNREKSEVSTDSV
FT                   QANPKPRALTKKSSQSKKKKKAFSSQKPGQSKAVQYPSDVLESASVELFLETSKLSSPV
FT                   VEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQSHCALKEHSMSNIASVK
FT                   SPYELENAGEELDARFSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFT
FT                   QCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATS
FT                   SNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSL
FT                   ITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKH
FT                   KTKVHSGTDKNPDCSVDDHAVSEQDSVQRSPLSETLDVKPSDMTLPLALPLGTEDHQML
FT                   LPVTDSQSPASDTLLRSTVNGYSEPQLIFLQQLY"
FT   CDS             join(14637907..14638172,14641408..14642201,
FT                   14643353..14643512,14645809..14645987,14647920..14648006,
FT                   14650920..14651182)
FT                   /codon_start=1
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, isoform CRA_b"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT172234.0
FT                   protein_id=mCP95152.0 isoform=CRA_b partial"
FT                   /protein_id="EDL34961.1"
FT                   /translation="MQYSHHCEHLLERLNKQREAGFLCDCTVVIGEFQFKAHRNVLASF
FT                   SEYFGAIYRSTSENNVFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKV
FT                   EEVVTKCKIKMEDFAFIASPSSTEISSITGNIELNQQACLLTLRDYNNREKSEVSTDSV
FT                   QANPKPRALTKKSSQSKKKKKAFSSQKPGQSKAVQYPSDVLESASVELFLETSKLSSPV
FT                   VEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQSHCALKEHSMSNIASVK
FT                   SPYELENAGEELDARFSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFT
FT                   QCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATS
FT                   SNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSL
FT                   ITHSRKHTGERPFICELCGNSYTDIKNLKKHKTKVHSGTDKNPDCSVDDHAVSEQDSVQ
FT                   RSPLSETLDVKPSDMTLPLALPLGTEDHQMLLPVTDSQSPASDTLLRSTVNGYSEPQLI
FT                   FLQQLY"
FT   CDS             join(14641484..14642201,14643353..14643512,
FT                   14645809..14645987,14646837..14646920,14647920..14648006,
FT                   14650920..14651182)
FT                   /codon_start=1
FT                   /gene="Mynn"
FT                   /locus_tag="mCG_4734"
FT                   /product="myoneurin, isoform CRA_a"
FT                   /note="gene_id=mCG4734.2 transcript_id=mCT172233.0
FT                   protein_id=mCP95153.0 isoform=CRA_a partial"
FT                   /protein_id="EDL34960.1"
FT                   /translation="MEDFAFIASPSSTEISSITGNIELNQQACLLTLRDYNNREKSEVS
FT                   TDSVQANPKPRALTKKSSQSKKKKKAFSSQKPGQSKAVQYPSDVLESASVELFLETSKL
FT                   SSPVVEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQSHCALKEHSMSNI
FT                   ASVKSPYELENAGEELDARFSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCG
FT                   KAFTQCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQ
FT                   FATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAV
FT                   SSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKN
FT                   LKKHKTKVHSGTDKNPDCSVDDHAVSEQDSVQRSPLSETLDVKPSDMTLPLALPLGTED
FT                   HQMLLPVTDSQSPASDTLLRSTVNGYSEPQLIFLQQLY"
FT   assembly_gap    14651721..14651740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14658612..14682346)
FT                   /locus_tag="mCG_4732"
FT                   /note="gene_id=mCG4732.1"
FT   mRNA            complement(join(14658612..14659246,14664317..14664443,
FT                   14665622..14665777,14666133..14666287,14668885..14668980,
FT                   14670582..14670710,14677215..14677298,14677760..14677824,
FT                   14677924..14678045,14679671..14679791,14682145..14682346))
FT                   /locus_tag="mCG_4732"
FT                   /product="mCG4732"
FT                   /note="gene_id=mCG4732.1 transcript_id=mCT3478.2 created on
FT                   20-AUG-2002"
FT   CDS             complement(join(14659043..14659246,14664317..14664443,
FT                   14665622..14665777,14666133..14666287,14668885..14668980,
FT                   14670582..14670710,14677215..14677298,14677760..14677824,
FT                   14677924..14678045,14679671..14679780))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4732"
FT                   /product="mCG4732"
FT                   /note="gene_id=mCG4732.1 transcript_id=mCT3478.2
FT                   protein_id=mCP2218.1"
FT                   /db_xref="GOA:Q9DAM1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1919077"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAM1"
FT                   /protein_id="EDL34963.1"
FT                   /translation="MEKLQAQYCYLCSENIRKTNPFILNILQKLDEEIEKRPKEKFTVN
FT                   IAGNNRLDSGQRITGEDFWLLSKTLRNQPCISGVDVRYNLIGDVGAFYAAKLLQKQPSI
FT                   TYLNLMFNDIGPEGGELIAKALHKNKTLKYLRMTGNKIENTGGMLFAAMLQMNSSLEKL
FT                   DLGDCDLGLQCVIAFSTVLTQNQAIKGINLNRPILYGEQEESTVHIGHMLKENHVLVEL
FT                   HMCKHGMKNYGLQQLCNALYLNSSLRYLDVSCNKITRDGMVFLADVLKSNTTLEVLDLS
FT                   FNRIETAGAKYLSETLTSHNRSLKALSVVSNKIEGEGLVALSQSMKTNLVLSNIYIWGN
FT                   KFDEDTCVAYSDLIKSGRLKPDNTDVEPYMVDEHIYLSEVSNGLKRHYYWAPTYGETYM
FT                   PSSSAGFALVPVGEHL"
FT   assembly_gap    14672757..14672934
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    14675143..14675209
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            14678981..14707260
FT                   /gene="4930558O21Rik"
FT                   /locus_tag="mCG_4731"
FT                   /note="gene_id=mCG4731.2"
FT   mRNA            join(14678981..14679328,14679694..14679824,
FT                   14680728..14680788,14684368..14685415,14690108..14690281,
FT                   14693882..14694020,14694729..14694925,14706970..14707260)
FT                   /gene="4930558O21Rik"
FT                   /locus_tag="mCG_4731"
FT                   /product="RIKEN cDNA 4930558O21, transcript variant
FT                   mCT3480"
FT                   /note="gene_id=mCG4731.2 transcript_id=mCT3480.2 created on
FT                   20-AUG-2002"
FT   CDS             join(14679806..14679824,14680728..14680788,
FT                   14684368..14685415,14690108..14690281,14693882..14694020,
FT                   14694729..14694925,14706970..14707122)
FT                   /codon_start=1
FT                   /gene="4930558O21Rik"
FT                   /locus_tag="mCG_4731"
FT                   /product="RIKEN cDNA 4930558O21, isoform CRA_b"
FT                   /note="gene_id=mCG4731.2 transcript_id=mCT3480.2
FT                   protein_id=mCP2212.0 isoform=CRA_b"
FT                   /protein_id="EDL34965.1"
FT                   /translation="MHHSSSGSRCVLQNGLELTVILPRLHRFDIIDTFKTLTKELLRQE
FT                   HLPKVLQKKEPHQLTDRTFFIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIPQGIQ
FT                   QLQNTKVLYLHNNSLQDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTLRELRLYR
FT                   TGLTEIPTGICKSLHHLELFGLSENFLESLPEEIVNQTKLREIYLKQNHFEVFPCDLCV
FT                   LYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNS
FT                   IHSLPSSLELLTELTEVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLIN
FT                   LRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQLPPSISLLSNLKILGLTGNDLLS
FT                   FPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPN
FT                   LEVLDCRHNLLKQLPDAICRTRNLRELLLEDNLLCCLPENLDHLVNLKVLTLMNNPMVD
FT                   PPIYVCNQGNEAIWKHLKENRIRKMMATTIQAWWRGIMVRKGYGSYEELLKARKKGKSP
FT                   PKDKKGKKAAKGKPEKGNKK"
FT   mRNA            join(14682409..14682735,14684368..14685415,
FT                   14690108..14690281,14693882..14694020,14694729..14694925,
FT                   14706970..14707260)
FT                   /gene="4930558O21Rik"
FT                   /locus_tag="mCG_4731"
FT                   /product="RIKEN cDNA 4930558O21, transcript variant
FT                   mCT172231"
FT                   /note="gene_id=mCG4731.2 transcript_id=mCT172231.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(14682701..14682735,14684368..14685415,
FT                   14690108..14690281,14693882..14694020,14694729..14694925,
FT                   14706970..14707122)
FT                   /codon_start=1
FT                   /gene="4930558O21Rik"
FT                   /locus_tag="mCG_4731"
FT                   /product="RIKEN cDNA 4930558O21, isoform CRA_a"
FT                   /note="gene_id=mCG4731.2 transcript_id=mCT172231.0
FT                   protein_id=mCP95150.0 isoform=CRA_a"
FT                   /protein_id="EDL34964.1"
FT                   /translation="MAYPSAKLQMHRFDIIDTFKTLTKELLRQEHLPKVLQKKEPHQLT
FT                   DRTFFIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIPQGIQQLQNTKVLYLHNNSL
FT                   QDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTLRELRLYRTGLTEIPTGICKSLH
FT                   HLELFGLSENFLESLPEEIVNQTKLREIYLKQNHFEVFPCDLCVLYNLEVIDLDENKLK
FT                   SIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELT
FT                   EVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFP
FT                   VQICALKNLEILALDDNKVRQLPPSISLLSNLKILGLTGNDLLSFPEEIFSLISLEKLY
FT                   IGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLP
FT                   DAICRTRNLRELLLEDNLLCCLPENLDHLVNLKVLTLMNNPMVDPPIYVCNQGNEAIWK
FT                   HLKENRIRKMMATTIQAWWRGIMVRKGYGSYEELLKARKKGKSPPKDKKGKKAAKGKPE
FT                   KGNKK"
FT   assembly_gap    14683258..14683277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14692137..14692156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<14713905..14734674)
FT                   /locus_tag="mCG_4729"
FT                   /note="gene_id=mCG4729.2"
FT   mRNA            complement(join(<14713905..14714222,14715785..14715952,
FT                   14719697..14719864,14722253..14722420,14723977..14724144,
FT                   14724688..14724855,14725995..14726138,14730326..14730469,
FT                   14734544..14734674))
FT                   /locus_tag="mCG_4729"
FT                   /product="mCG4729"
FT                   /note="gene_id=mCG4729.2 transcript_id=mCT3491.2 created on
FT                   20-AUG-2002"
FT   CDS             complement(join(<14713905..14714222,14715785..14715952,
FT                   14719697..14719864,14722253..14722420,14723977..14724144,
FT                   14724688..14724855,14725995..14726138,14730326..14730467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4729"
FT                   /product="mCG4729"
FT                   /note="gene_id=mCG4729.2 transcript_id=mCT3491.2
FT                   protein_id=mCP2217.2"
FT                   /protein_id="EDL34966.1"
FT                   /translation="MPLDLEMDLKSNMEDSDWFLRKLCGRAADTGLDLNSYGLTAVDVK
FT                   ETDLEELDVSWNDFARGALHMLTQQMHPVNKLKVLRLSSCRLTTEDVQTLGGALEMTPE
FT                   LEELSLSWNSQVGGKLPRVLHTFQQGSKIRTLELVDCALTSQDGVFVGHLLPKLQSLQV
FT                   FDLSNNRNIGSCLEVIAQGLRSASGLKELKLRSCGLSQKSIRLLDGVFASLDVLRILDL
FT                   SCNKELGGGFEDVPAQLASLKHLEVLDLHQCSLTAGDVTSLTQIIPLLSNLEELDLSSN
FT                   RDVGGSSENLLCRLRFLPALKSLLINSCALQSEAFAALADASVYLPALEILNLSWNKCV
FT                   GGNLELLQQTLHLSRLLRVLRLSSCSLVTEDVVLLASVIQSGHLATLQKLDLSYNDGIC
FT                   DAGWAILCQNLCFLKELTELDISLRPSSSQDCGQWFSHLLCAVTQLPVITEIEMRRWVI
FT                   PALQERELDCFTQDHQREIRFDH"
FT   assembly_gap    14739056..14739414
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   gene            14780548..14791492
FT                   /gene="Samd7"
FT                   /locus_tag="mCG_121986"
FT                   /note="gene_id=mCG121986.0"
FT   mRNA            join(14780548..14780571,14785101..14785223,
FT                   14787156..14787280,14788356..14788434,14790299..14791492)
FT                   /gene="Samd7"
FT                   /locus_tag="mCG_121986"
FT                   /product="sterile alpha motif domain containing 7"
FT                   /note="gene_id=mCG121986.0 transcript_id=mCT123190.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    14785033..14785052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             14790597..14791088
FT                   /codon_start=1
FT                   /gene="Samd7"
FT                   /locus_tag="mCG_121986"
FT                   /product="sterile alpha motif domain containing 7"
FT                   /note="gene_id=mCG121986.0 transcript_id=mCT123190.1
FT                   protein_id=mCP79396.1"
FT                   /protein_id="EDL34967.1"
FT                   /translation="MESQLRFPPTPTENSIHTRGNRLPWRQTHGMMGRESPLNRSMKAV
FT                   MERMGFSGQSPSCLCQVGVWDCGRVLRSSRVAASSPCGGSGSHACFWSPFPFSGPLSTF
FT                   SSPSFKKYLHIFIICVWVFCLHVCMGIGWAQFLQRPERLTGSFGTGVTRGSEWPHGGWD
FT                   "
FT   assembly_gap    14809698..14809717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14813498..14813954
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    14814700..14814967
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    14820178..14820197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<14826860..14827679)
FT                   /locus_tag="mCG_148189"
FT                   /note="gene_id=mCG148189.0"
FT   mRNA            complement(<14826860..14827679)
FT                   /locus_tag="mCG_148189"
FT                   /product="mCG148189"
FT                   /note="gene_id=mCG148189.0 transcript_id=mCT188452.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<14826860..14826995)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148189"
FT                   /product="mCG148189"
FT                   /note="gene_id=mCG148189.0 transcript_id=mCT188452.0
FT                   protein_id=mCP108117.0"
FT                   /protein_id="EDL34968.1"
FT                   /translation="MSAPHVTPHNPSLDSRRLDEPREVKMERSKTSWDAVDCRPLLYDY
FT                   "
FT   gene            14827009..14854504
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /note="gene_id=mCG4735.2"
FT   mRNA            join(14827009..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14844140,14844559..14844651,
FT                   14846414..14846474,14848352..14848471,14852614..14854504)
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, transcript variant
FT                   mCT3474"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT3474.2 created on
FT                   20-AUG-2002"
FT   mRNA            join(14827009..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14844140,14844559..14844651,
FT                   14846414..14846474,14848352..14848471,14852614..14853050,
FT                   14853675..14854245)
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, transcript variant
FT                   mCT172235"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT172235.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(14827009..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14843999,14844115..14844140,
FT                   14844571..14844651,14846414..14846474,14848352..14848471,
FT                   14852614..14853181)
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, transcript variant
FT                   mCT172236"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT172236.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(14827482..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14844140,14844559..14844651,
FT                   14846414..14846474,14848352..14848471,14852614..14853050,
FT                   14853675..14853755)
FT                   /codon_start=1
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT172235.0
FT                   protein_id=mCP95154.0 isoform=CRA_a"
FT                   /protein_id="EDL34969.1"
FT                   /translation="MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVD
FT                   YFIASKAVECLLDSKWAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDK
FT                   DVKKEKDKGKSESGKEDDKKSKKESVKEEKTKKEKEKKKDGEKEDSKKEETPGTPKKKE
FT                   TKKKFKLEPHDDQVFLDGNEVFVWIYDPVHIKTFVMGLILVIAVIAATLFPLWPAEMRV
FT                   GVYYLSVGAGCFVASILLLAIARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPL
FT                   YTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKGAPADHGPEGSGGERH
FT                   SDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCDEEDDDKDGEILLFQLRKSQ
FT                   LTCAFNPEKGGHLQQK"
FT   CDS             join(14827482..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14844140,14844559..14844651,
FT                   14846414..14846474,14848352..14848471,14852614..14853080)
FT                   /codon_start=1
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT3474.2
FT                   protein_id=mCP2222.2 isoform=CRA_c"
FT                   /protein_id="EDL34971.1"
FT                   /translation="MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVD
FT                   YFIASKAVECLLDSKWAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDK
FT                   DVKKEKDKGKSESGKEDDKKSKKESVKEEKTKKEKEKKKDGEKEDSKKEETPGTPKKKE
FT                   TKKKFKLEPHDDQVFLDGNEVFVWIYDPVHIKTFVMGLILVIAVIAATLFPLWPAEMRV
FT                   GVYYLSVGAGCFVASILLLAIARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPL
FT                   YTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKGAPADHGPEGSGGERH
FT                   SDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCDEEDDDKDGEVPKSAHEKS"
FT   CDS             join(14827482..14827517,14834243..14834351,
FT                   14835172..14835277,14843936..14843999,14844115..14844140,
FT                   14844571..14844651,14846414..14846468)
FT                   /codon_start=1
FT                   /gene="Tloc1"
FT                   /locus_tag="mCG_4735"
FT                   /product="translocation protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG4735.2 transcript_id=mCT172236.0
FT                   protein_id=mCP95155.0 isoform=CRA_b"
FT                   /protein_id="EDL34970.1"
FT                   /translation="MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVD
FT                   YFIASKAVECLLDSKWAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDK
FT                   DMVKRKIPKRELQKRRKLRKNSNLSHMMIKFFWMEMRFLCGSMTQFTLKHLSWD"
FT   assembly_gap    14827680..14827830
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    14870214..14870233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14883259..14883299
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    14884478..14884497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14890043..14930834
FT                   /locus_tag="mCG_4733"
FT                   /note="gene_id=mCG4733.2"
FT   mRNA            join(14890043..14890326,14911368..14911694,
FT                   14929386..14930834)
FT                   /locus_tag="mCG_4733"
FT                   /product="mCG4733, transcript variant mCT172232"
FT                   /note="gene_id=mCG4733.2 transcript_id=mCT172232.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(14890070..14890138,14911368..14911694,
FT                   14923632..14923731,14929386..14930834)
FT                   /locus_tag="mCG_4733"
FT                   /product="mCG4733, transcript variant mCT3472"
FT                   /note="gene_id=mCG4733.2 transcript_id=mCT3472.2 created on
FT                   20-AUG-2002"
FT   assembly_gap    14893337..14893853
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    14916206..14918180
FT                   /estimated_length=1975
FT                   /gap_type="unknown"
FT   CDS             14929457..14930467
FT                   /codon_start=1
FT                   /locus_tag="mCG_4733"
FT                   /product="mCG4733, isoform CRA_a"
FT                   /note="gene_id=mCG4733.2 transcript_id=mCT172232.0
FT                   protein_id=mCP95151.0 isoform=CRA_a"
FT                   /protein_id="EDL34972.1"
FT                   /translation="MTALSSKNCSLQYQLHQSPQLLEASCLLFLIILGKVLLNILLLRV
FT                   RRGDARWTLMEYFCFSLALVDLLLLVNISILTYFRDFVVLGIRFTRYHICLLTQIISFT
FT                   YGFLHYPVCSLACIDYWCNLSRASKQSSRWQKLLYFLTVILTWISVLAYVLVDPAISVS
FT                   LKAHRGYVYQCPAYVSTQSHWLSLSMLMVLFVAFLISWQEVVALLQAMRIASYKSKAAL
FT                   YFPFPLHCGYALSCREALLPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLY
FT                   FVNSFLIAAVYWFNCHKLDLRDSSLPVDPFINWKCCFVPVHRLKQVERPMSIVIC"
FT   CDS             14929457..14930467
FT                   /codon_start=1
FT                   /locus_tag="mCG_4733"
FT                   /product="mCG4733, isoform CRA_a"
FT                   /note="gene_id=mCG4733.2 transcript_id=mCT3472.2
FT                   protein_id=mCP2220.2 isoform=CRA_a"
FT                   /protein_id="EDL34973.1"
FT                   /translation="MTALSSKNCSLQYQLHQSPQLLEASCLLFLIILGKVLLNILLLRV
FT                   RRGDARWTLMEYFCFSLALVDLLLLVNISILTYFRDFVVLGIRFTRYHICLLTQIISFT
FT                   YGFLHYPVCSLACIDYWCNLSRASKQSSRWQKLLYFLTVILTWISVLAYVLVDPAISVS
FT                   LKAHRGYVYQCPAYVSTQSHWLSLSMLMVLFVAFLISWQEVVALLQAMRIASYKSKAAL
FT                   YFPFPLHCGYALSCREALLPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLY
FT                   FVNSFLIAAVYWFNCHKLDLRDSSLPVDPFINWKCCFVPVHRLKQVERPMSIVIC"
FT   gene            complement(14933036..14937889)
FT                   /locus_tag="mCG_148190"
FT                   /note="gene_id=mCG148190.0"
FT   mRNA            complement(14933036..14937889)
FT                   /locus_tag="mCG_148190"
FT                   /product="mCG148190"
FT                   /note="gene_id=mCG148190.0 transcript_id=mCT188453.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14933601..14933978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148190"
FT                   /product="mCG148190"
FT                   /note="gene_id=mCG148190.0 transcript_id=mCT188453.0
FT                   protein_id=mCP108118.0"
FT                   /protein_id="EDL34974.1"
FT                   /translation="MGLGLYSRGLKIKIQKLLESAGIMLEMRVVHYRQPCTGRQGREAA
FT                   DFKPLEFGENALRMALKICFTKAGCWDYLFFNILSTFLEILLLVLTIVLKSKFYNLKKK
FT                   KNSKHDSSRKKASPRGKENMF"
FT   gene            complement(14940448..14999741)
FT                   /gene="Phc3"
FT                   /locus_tag="mCG_121978"
FT                   /note="gene_id=mCG121978.1"
FT   mRNA            complement(join(14940448..14941154,14947759..14947990,
FT                   14948082..14948214,14950254..14950368,14955849..14956008,
FT                   14963459..14963709,14965385..14965538,14969929..14970800,
FT                   14976059..14976302,14984519..14984674,14991688..14991760,
FT                   14995526..14995681,14999572..14999741))
FT                   /gene="Phc3"
FT                   /locus_tag="mCG_121978"
FT                   /product="polyhomeotic-like 3 (Drosophila)"
FT                   /note="gene_id=mCG121978.1 transcript_id=mCT123183.1
FT                   created on 20-AUG-2002"
FT   CDS             complement(join(14941000..14941154,14947759..14947990,
FT                   14948082..14948214,14950254..14950368,14955849..14956008,
FT                   14963459..14963709,14965385..14965538,14969929..14970800,
FT                   14976059..14976302,14984519..14984674,14991688..14991702))
FT                   /codon_start=1
FT                   /gene="Phc3"
FT                   /locus_tag="mCG_121978"
FT                   /product="polyhomeotic-like 3 (Drosophila)"
FT                   /note="gene_id=mCG121978.1 transcript_id=mCT123183.1
FT                   protein_id=mCP79368.1"
FT                   /protein_id="EDL34975.1"
FT                   /translation="MSQTSILSASPAPAQLMNRSQTSSSTSGSITQQTMLLGSTSPTLT
FT                   ASQAQMYLRAQMVQNLTLRSQKLGVLSSSQNGSPKSAGQTQSLTICHNKTTVTSSKISQ
FT                   RDPSPESKKGGSPGLESRSTAVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPPK
FT                   VSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNHGLSPAPSNAQPQHCSPVQSH
FT                   PPPLTVSPNQAQSAQQSVVVSPPPPHSPSQSPTIIIHPQALIQPHPLVSSALQTGPNLQ
FT                   QAAADQVQSTAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQMVSPTSHQQYSALQSS
FT                   PIPIATPPQMSASPPAQLPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEAL
FT                   VQLPFQTLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECARMDRTPPPP
FT                   TLSPAAVTVGRGEDLTSEHPLLEQVELPAVASVSASVIKSPSDPTHASAPAPPLLIPAA
FT                   STRSSSTSLASSTPSLENKPPQAIVKPQILTHVIEGFVIQEGLEPFPVSRSSLLIEQPV
FT                   KKRPLLDNQVVNSVCVQPELQNNTKHADNSSDTEIEDMMAEETLEEMDSELLKCEFCGK
FT                   MGYPNEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRRPSGPEGAAR
FT                   EHILRQLPITYPSAEEDVASHEDPVPSAMTTRLRRQSERERERELRDVRIRKMPENSDL
FT                   LPVAQTEPSIWTVDDVWAFIHSLPGCQDVADEFRAQEIDGQALLLLKEDHLMSAMNMKL
FT                   GPALKICARINSLKDS"
FT   assembly_gap    14990908..14990927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14992335..14992493
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            15008446..15008860
FT                   /pseudo
FT                   /locus_tag="mCG_122206"
FT                   /note="gene_id=mCG122206.1"
FT   mRNA            15008446..15008860
FT                   /pseudo
FT                   /locus_tag="mCG_122206"
FT                   /note="gene_id=mCG122206.1 transcript_id=mCT123422.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    15015294..15015334
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    15021055..15021074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15029657..15085580
FT                   /gene="Prkci"
FT                   /locus_tag="mCG_4730"
FT                   /note="gene_id=mCG4730.2"
FT   mRNA            join(15029657..15029839,15051396..15051517,
FT                   15057974..15058063,15059097..15059147,15062330..15062415,
FT                   15063928..15064068,15066022..15066073,15067343..15067401,
FT                   15070688..15070864,15071292..15071389,15071871..15071957,
FT                   15072210..15072345,15074284..15074371,15076537..15076662,
FT                   15077728..15077807,15079319..15079408,15079818..15079933,
FT                   15083036..15085580)
FT                   /gene="Prkci"
FT                   /locus_tag="mCG_4730"
FT                   /product="protein kinase C, iota"
FT                   /note="gene_id=mCG4730.2 transcript_id=mCT3479.1 created on
FT                   20-AUG-2002"
FT   CDS             join(15029739..15029839,15051396..15051517,
FT                   15057974..15058063,15059097..15059147,15062330..15062415,
FT                   15063928..15064068,15066022..15066073,15067343..15067401,
FT                   15070688..15070864,15071292..15071389,15071871..15071957,
FT                   15072210..15072345,15074284..15074371,15076537..15076662,
FT                   15077728..15077807,15079319..15079408,15079818..15079933,
FT                   15083036..15083123)
FT                   /codon_start=1
FT                   /gene="Prkci"
FT                   /locus_tag="mCG_4730"
FT                   /product="protein kinase C, iota"
FT                   /note="gene_id=mCG4730.2 transcript_id=mCT3479.1
FT                   protein_id=mCP2219.1"
FT                   /protein_id="EDL34976.1"
FT                   /translation="MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHFEPSI
FT                   SFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIH
FT                   VFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWG
FT                   LGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQTMHPDHTQTVIPYNPSS
FT                   HESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAM
FT                   KVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLM
FT                   FHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMC
FT                   KEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSS
FT                   DNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQG
FT                   HPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQS
FT                   EFEGFEYINPLLMSAEECV"
FT   assembly_gap    15043046..15043147
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    15096833..15096852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15103516..15105939
FT                   /estimated_length=2424
FT                   /gap_type="unknown"
FT   assembly_gap    15114622..15115112
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    15124723..15125419
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    15126064..15126154
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    15130162..15130525
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            15130897..15155172
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /note="gene_id=mCG4728.2"
FT   mRNA            join(15130897..15130967,15133081..15134234,
FT                   15147437..15147530,15149217..15149311,15152625..15152848,
FT                   15153182..15153406,15154264..15155172)
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, transcript variant mCT172229"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172229.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(15130922..15130967,15132514..15134234,
FT                   15147437..15147530,15149217..15149449,15152625..15152848,
FT                   15153182..15153406,15154264..15154800)
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, transcript variant mCT172230"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172230.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(15132642..15134234,15147437..15147530,
FT                   15149217..15149449,15152625..15152848,15153182..15153406,
FT                   15154264..15154800)
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, transcript variant mCT3481"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT3481.0 created on
FT                   20-AUG-2002"
FT   mRNA            join(15132642..15134234,15147437..15147530,
FT                   15149217..15149311,15152625..15152848,15153182..15153406,
FT                   15154264..15154800)
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, transcript variant mCT172228"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172228.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(15133142..15134234,15147437..15147530,
FT                   15149217..15149449,15152625..15152848,15153182..15153406,
FT                   15154264..15154422)
FT                   /codon_start=1
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, isoform CRA_b"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172230.0
FT                   protein_id=mCP95148.0 isoform=CRA_b"
FT                   /protein_id="EDL34979.1"
FT                   /translation="MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTK
FT                   VKKEHLDDYGDASVEPDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAF
FT                   SARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLC
FT                   LPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTD
FT                   AQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQP
FT                   DAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKK
FT                   LKIILEEMKEKFSMRNGKRIQSKANTPSGMELPSWYPVIKQEGDHVPQTHSFLHPSYYL
FT                   YMCDKVVAPNVSLTSAASQSKEATKAETSKSTSKQSEKPHESSQHQKTVSYPDVSLEEQ
FT                   EKMDLKTSRELYSCLDSSISNNSTSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDD
FT                   KGKIMEDVMRTYVRQQEKLNSILQRKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESL
FT                   QSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAE
FT                   ADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD"
FT   CDS             join(15133142..15134234,15147437..15147530,
FT                   15149217..15149449,15152625..15152848,15153182..15153406,
FT                   15154264..15154422)
FT                   /codon_start=1
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, isoform CRA_b"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT3481.0
FT                   protein_id=mCP2216.1 isoform=CRA_b"
FT                   /protein_id="EDL34980.1"
FT                   /translation="MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTK
FT                   VKKEHLDDYGDASVEPDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAF
FT                   SARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLC
FT                   LPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTD
FT                   AQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQP
FT                   DAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKK
FT                   LKIILEEMKEKFSMRNGKRIQSKANTPSGMELPSWYPVIKQEGDHVPQTHSFLHPSYYL
FT                   YMCDKVVAPNVSLTSAASQSKEATKAETSKSTSKQSEKPHESSQHQKTVSYPDVSLEEQ
FT                   EKMDLKTSRELYSCLDSSISNNSTSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDD
FT                   KGKIMEDVMRTYVRQQEKLNSILQRKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESL
FT                   QSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAE
FT                   ADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD"
FT   CDS             join(15133142..15134234,15147437..15147530,
FT                   15149217..15149311,15152625..15152848,15153182..15153406,
FT                   15154264..15154422)
FT                   /codon_start=1
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, isoform CRA_a"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172228.0
FT                   protein_id=mCP95149.0 isoform=CRA_a"
FT                   /protein_id="EDL34977.1"
FT                   /translation="MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTK
FT                   VKKEHLDDYGDASVEPDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAF
FT                   SARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLC
FT                   LPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTD
FT                   AQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQP
FT                   DAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKK
FT                   LKIILEEMKEKFSMRNGKRIQSKANTPSGMELPSWYPVIKQEGDHVPQTHSFLHPSYYL
FT                   YMCDKVVAPNVSLTSAASQSKEATKAETNSSISNNSTSRKKSESAVCSLVRGTSKRDSE
FT                   DSSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSILQRKQQLQMEVEMLSSSKAMKELT
FT                   EEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAA
FT                   QLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD"
FT   CDS             join(15133142..15134234,15147437..15147530,
FT                   15149217..15149311,15152625..15152848,15153182..15153406,
FT                   15154264..15154422)
FT                   /codon_start=1
FT                   /gene="Skil"
FT                   /locus_tag="mCG_4728"
FT                   /product="SKI-like, isoform CRA_a"
FT                   /note="gene_id=mCG4728.2 transcript_id=mCT172229.0
FT                   protein_id=mCP95147.0 isoform=CRA_a"
FT                   /protein_id="EDL34978.1"
FT                   /translation="MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTK
FT                   VKKEHLDDYGDASVEPDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAF
FT                   SARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLC
FT                   LPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTD
FT                   AQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQP
FT                   DAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKK
FT                   LKIILEEMKEKFSMRNGKRIQSKANTPSGMELPSWYPVIKQEGDHVPQTHSFLHPSYYL
FT                   YMCDKVVAPNVSLTSAASQSKEATKAETNSSISNNSTSRKKSESAVCSLVRGTSKRDSE
FT                   DSSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSILQRKQQLQMEVEMLSSSKAMKELT
FT                   EEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAA
FT                   QLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD"
FT   gene            15156499..15158384
FT                   /locus_tag="mCG_1049476"
FT                   /note="gene_id=mCG1049476.1"
FT   mRNA            15156499..15158384
FT                   /locus_tag="mCG_1049476"
FT                   /product="mCG1049476"
FT                   /note="gene_id=mCG1049476.1 transcript_id=mCT167180.1
FT                   created on 05-SEP-2002"
FT   CDS             15156688..15156867
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049476"
FT                   /product="mCG1049476"
FT                   /note="gene_id=mCG1049476.1 transcript_id=mCT167180.1
FT                   protein_id=mCP79693.1"
FT                   /protein_id="EDL34981.1"
FT                   /translation="MGGLSLWSRLRALHQVLKCGSSCAIKEEFKQTTCQSQLRLSTERF
FT                   YQLRFGSGFNSFEV"
FT   assembly_gap    15180777..15180935
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            <15185677..15200072
FT                   /gene="Cldn11"
FT                   /locus_tag="mCG_4726"
FT                   /note="gene_id=mCG4726.1"
FT   mRNA            join(<15185677..15186061,15189600..15189764,
FT                   15198824..15200072)
FT                   /gene="Cldn11"
FT                   /locus_tag="mCG_4726"
FT                   /product="claudin 11"
FT                   /note="gene_id=mCG4726.1 transcript_id=mCT3482.0 created on
FT                   20-AUG-2002"
FT   CDS             join(<15185761..15186061,15189600..15189764,
FT                   15198824..15199056)
FT                   /codon_start=1
FT                   /gene="Cldn11"
FT                   /locus_tag="mCG_4726"
FT                   /product="claudin 11"
FT                   /note="gene_id=mCG4726.1 transcript_id=mCT3482.0
FT                   protein_id=mCP2213.0"
FT                   /protein_id="EDL34982.1"
FT                   /translation="GRLCPGRHRGHNPCESSCVDVAAATMVATCLQVVGFVTSFVGWIG
FT                   IIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQ
FT                   ACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVAT
FT                   IWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYYSSGSS
FT                   SPTHAKSAHV"
FT   assembly_gap    15191076..15191261
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    15198709..15198728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15203868..15203963
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    15212286..15215677
FT                   /estimated_length=3392
FT                   /gap_type="unknown"
FT   assembly_gap    15218222..15218336
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    15222076..15224850
FT                   /estimated_length=2775
FT                   /gap_type="unknown"
FT   assembly_gap    15229367..15229516
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    15236898..15237530
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   gene            complement(<15246010..15347105)
FT                   /gene="Slc7a14"
FT                   /locus_tag="mCG_4725"
FT                   /note="gene_id=mCG4725.2"
FT   mRNA            complement(join(<15246010..15246332,15260384..15261261,
FT                   15263947..15264155,15267195..15267341,15274269..15274486,
FT                   15275514..15275750,15294559..15295017,15346964..15347105))
FT                   /gene="Slc7a14"
FT                   /locus_tag="mCG_4725"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 14"
FT                   /note="gene_id=mCG4725.2 transcript_id=mCT3483.2 created on
FT                   20-AUG-2002"
FT   CDS             complement(join(15246010..15246332,15260384..15261261,
FT                   15263947..15264155,15267195..15267341,15274269..15274486,
FT                   15275514..15275750,15294559..15294862))
FT                   /codon_start=1
FT                   /gene="Slc7a14"
FT                   /locus_tag="mCG_4725"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 14"
FT                   /note="gene_id=mCG4725.2 transcript_id=mCT3483.2
FT                   protein_id=mCP2211.1"
FT                   /protein_id="EDL34983.1"
FT                   /translation="MSGFLASLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGTTSAH
FT                   GTKLAQVLTTVDLISLGVGSCVGTGMYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVC
FT                   YAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLILEYLIGTAAGASALSSMFDSLAN
FT                   HSISRWMVDTVGTLNGLGKGEESYPDLLALVIAVIVTIIVALGVKNSVGFNNVLNVLNL
FT                   AVWVFIMIAGLFFINGKYWAEGQFLPHGWSGVLQGAATCFYAFIGFDIIATTGEEAKNP
FT                   NTSIPYAITASLVICLTAYVSVSMILTLMVPYYAIDTESPLMEMFVAHGFYAAKFVVAI
FT                   GSVAGLTVSLLGSLFPMPRVIYAMAGDGLLFRFLAHVSSYTETPVVACIVSGFLAALLS
FT                   LLVSLRDLIEMMSIGTLLAYTLVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILAD
FT                   CEKETCSPVSEGEEFSSPATNTCGAKNLPSLGDNEMLIGKSDKSAYNVNHPNYGTVDMT
FT                   TGIEADESENIYLIKLKKLIGPRYYTMRIRLGLPGKMDRPTAATGHTVTICVLLLFILM
FT                   FIFCSFIIFGSEYISGQSWWAILLVVLMMLLISVLVFVILQQPENPKKLPYMAPCLPFV
FT                   PAFAMLVNIYLMLKLSTITWIRFAVWCFVGMLIYFGYGIWNSTLEISAREQALHQSTYQ
FT                   RYDVDDPFSVEEGFSYATEGESQEDWGGPAEDKGFYYQQMSDAKANSRTSSKAKSKSKH
FT                   KQNSEALIANDELDCSPE"
FT   assembly_gap    15266835..15266886
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15282475..15282520
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    15303904..15303923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15327242..15327331
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    15338708..15338744
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    15347227..15347246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15377872..15377891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15387409..15390833
FT                   /estimated_length=3425
FT                   /gap_type="unknown"
FT   assembly_gap    15414562..15414581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15447642..15447661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15449821..15451449
FT                   /estimated_length=1629
FT                   /gap_type="unknown"
FT   assembly_gap    15453401..15455486
FT                   /estimated_length=2086
FT                   /gap_type="unknown"
FT   assembly_gap    15466734..15467915
FT                   /estimated_length=1182
FT                   /gap_type="unknown"
FT   assembly_gap    15470506..15470525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15472032..15472051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15473159..15473178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15476708..15477656
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    15480320..15480392
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    15481557..15481576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15492971..15492990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15494301..15494320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15506358..15506582
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    15508118..15508137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15542495..15542514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15545767..15545786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15550944..15550963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15552176..15552195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15577132..15577726
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    15597707..15597726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15599187..15599418
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    15611616..15612136
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    15617492..15617511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15619716..15619773
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15624009..15624028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15655590..15657463
FT                   /estimated_length=1874
FT                   /gap_type="unknown"
FT   assembly_gap    15658197..15659235
FT                   /estimated_length=1039
FT                   /gap_type="unknown"
FT   assembly_gap    15667849..15667868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15676462..15708420
FT                   /estimated_length=31959
FT                   /gap_type="unknown"
FT   assembly_gap    15715198..15715328
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    15719430..15719449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15721115..15721134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15728523..15731841
FT                   /estimated_length=3319
FT                   /gap_type="unknown"
FT   assembly_gap    15733696..15733875
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    15751257..15751484
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    15768566..15769009
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    15770958..15770977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15773044..15773721
FT                   /estimated_length=678
FT                   /gap_type="unknown"
FT   assembly_gap    15786039..15787736
FT                   /estimated_length=1698
FT                   /gap_type="unknown"
FT   assembly_gap    15794743..15801130
FT                   /estimated_length=6388
FT                   /gap_type="unknown"
FT   assembly_gap    15802490..15803674
FT                   /estimated_length=1185
FT                   /gap_type="unknown"
FT   assembly_gap    15804890..15805023
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    15808245..15808264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15819366..15819414
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    15828580..15828599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15846039..15846058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15847601..15850006
FT                   /estimated_length=2406
FT                   /gap_type="unknown"
FT   assembly_gap    15900516..15900606
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    15903016..15903035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15913660..15913679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15927619..16217888
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /note="gene_id=mCG20271.2"
FT   mRNA            join(15927619..15928038,16175718..16175840,
FT                   16196926..16197096,16199906..16200101,16216198..16217887)
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, transcript variant
FT                   mCT19854"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT19854.3 created
FT                   on 06-JAN-2003"
FT   mRNA            join(15927785..15927940,15928021..15928038,
FT                   16175718..16175840,16196926..16197096,16199906..16200101,
FT                   16216198..16217888)
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, transcript variant
FT                   mCT172207"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT172207.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(15927816..15928038,15933527..15933626,
FT                   16175718..16175840,16196926..16197096,16199906..16200101,
FT                   16216198..16217887)
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, transcript variant
FT                   mCT172206"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT172206.0 created
FT                   on 06-JAN-2003"
FT   assembly_gap    15983489..15983909
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    15985214..15985383
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    15990951..15991039
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    16019689..16019916
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    16020814..16021093
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    16042557..16042576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16062307..16062326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16072248..16072321
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    16097230..16097249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16098641..16098660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16099924..16099943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16103809..16109160
FT                   /estimated_length=5352
FT                   /gap_type="unknown"
FT   assembly_gap    16132550..16132569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16151547..16151566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16160942..16161017
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    16171326..16172019
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   CDS             join(16175785..16175840,16196926..16197096,
FT                   16199906..16200101,16216198..16216482)
FT                   /codon_start=1
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, isoform CRA_a"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT172206.0
FT                   protein_id=mCP95125.0 isoform=CRA_a"
FT                   /protein_id="EDL34984.1"
FT                   /translation="MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
FT                   RAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEEAQCALLNVSITETFNCSFSCGPD
FT                   CWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQKCSYIPKCGNNFEESMSLVSVVM
FT                   ENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQY
FT                   LSLLCERIQRINR"
FT   CDS             join(16175785..16175840,16196926..16197096,
FT                   16199906..16200101,16216198..16216482)
FT                   /codon_start=1
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, isoform CRA_a"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT19854.3
FT                   protein_id=mCP3750.2 isoform=CRA_a"
FT                   /protein_id="EDL34985.1"
FT                   /translation="MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
FT                   RAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEEAQCALLNVSITETFNCSFSCGPD
FT                   CWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQKCSYIPKCGNNFEESMSLVSVVM
FT                   ENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQY
FT                   LSLLCERIQRINR"
FT   CDS             join(16175785..16175840,16196926..16197096,
FT                   16199906..16200101,16216198..16216482)
FT                   /codon_start=1
FT                   /gene="Kcnmb2"
FT                   /locus_tag="mCG_20271"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 2, isoform CRA_a"
FT                   /note="gene_id=mCG20271.2 transcript_id=mCT172207.0
FT                   protein_id=mCP95126.0 isoform=CRA_a"
FT                   /protein_id="EDL34986.1"
FT                   /translation="MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
FT                   RAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEEAQCALLNVSITETFNCSFSCGPD
FT                   CWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQKCSYIPKCGNNFEESMSLVSVVM
FT                   ENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQY
FT                   LSLLCERIQRINR"
FT   assembly_gap    16178843..16178862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16180419..16186134
FT                   /estimated_length=5716
FT                   /gap_type="unknown"
FT   assembly_gap    16187145..16187992
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    16196683..16196702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16197851..16198244
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    16221563..16221582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16223418..16223828
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    16231909..16232136
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    16250452..16254397
FT                   /estimated_length=3946
FT                   /gap_type="unknown"
FT   assembly_gap    16255515..16255534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16257094..16257113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16259732..16259751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16260870..16260889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16264027..16264046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16265455..16265474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16266643..16266662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16279969..16280758
FT                   /pseudo
FT                   /locus_tag="mCG_49326"
FT                   /note="gene_id=mCG49326.2"
FT   mRNA            join(16279969..16280201,16280231..16280758)
FT                   /pseudo
FT                   /locus_tag="mCG_49326"
FT                   /note="gene_id=mCG49326.2 transcript_id=mCT49509.2 created
FT                   on 21-FEB-2003"
FT   assembly_gap    16285727..16285746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16287789..16288847
FT                   /estimated_length=1059
FT                   /gap_type="unknown"
FT   assembly_gap    16297173..16297192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16312785..16318250
FT                   /estimated_length=5466
FT                   /gap_type="unknown"
FT   assembly_gap    16320828..16320847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16337444..16337463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16343826..16344394
FT                   /estimated_length=569
FT                   /gap_type="unknown"
FT   assembly_gap    16346692..16346819
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    16355164..16357765
FT                   /estimated_length=2602
FT                   /gap_type="unknown"
FT   assembly_gap    16361635..16364918
FT                   /estimated_length=3284
FT                   /gap_type="unknown"
FT   gene            complement(16368317..16401462)
FT                   /gene="Zmat3"
FT                   /locus_tag="mCG_20266"
FT                   /note="gene_id=mCG20266.1"
FT   mRNA            complement(join(16368317..16375209,16376846..16376946,
FT                   16377064..16377230,16378972..16379094,16396721..16397047,
FT                   16401346..16401462))
FT                   /gene="Zmat3"
FT                   /locus_tag="mCG_20266"
FT                   /product="zinc finger matrin type 3"
FT                   /note="gene_id=mCG20266.1 transcript_id=mCT19848.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(16374998..16375209,16376846..16376946,
FT                   16377064..16377230,16378972..16379094,16396721..16396990))
FT                   /codon_start=1
FT                   /gene="Zmat3"
FT                   /locus_tag="mCG_20266"
FT                   /product="zinc finger matrin type 3"
FT                   /note="gene_id=mCG20266.1 transcript_id=mCT19848.2
FT                   protein_id=mCP3754.1"
FT                   /protein_id="EDL34987.1"
FT                   /translation="MILLQQVWLPLPNRPSTSPPMSVAARSTRTLQLPPQKAFGQEASL
FT                   PLAGEEDLAKRGEPDSALEELCKPLFCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAA
FT                   NSCPPPARVSSVVAEPVATPLVPVPPQVGSCKPGGRVILATENDYCKLCDASFSSPAVA
FT                   QAHYQGKNHAKRLRLAEAQSHSFSDSAEAGQRRTRKEGSEFKMVATRRNMNPVQSNSGP
FT                   YFNARSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEVEFRQHLESKQHKSKVSEQRYRS
FT                   EMENLGYVQ"
FT   assembly_gap    16387213..16387232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16401574..16401593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16401645..16403307
FT                   /gene="4930429B21Rik"
FT                   /locus_tag="mCG_20267"
FT                   /note="gene_id=mCG20267.0"
FT   mRNA            16401645..16403307
FT                   /gene="4930429B21Rik"
FT                   /locus_tag="mCG_20267"
FT                   /product="RIKEN cDNA 4930429B21"
FT                   /note="gene_id=mCG20267.0 transcript_id=mCT19849.0 created
FT                   on 20-AUG-2002"
FT   CDS             16401754..16402146
FT                   /codon_start=1
FT                   /gene="4930429B21Rik"
FT                   /locus_tag="mCG_20267"
FT                   /product="RIKEN cDNA 4930429B21"
FT                   /note="gene_id=mCG20267.0 transcript_id=mCT19849.0
FT                   protein_id=mCP3756.1"
FT                   /db_xref="MGI:MGI:1914826"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQQ1"
FT                   /protein_id="EDL34988.1"
FT                   /translation="MRAEAWQSLVGGRRFSSETWKLHSLRLRPKTLERSPLTGRTRRTA
FT                   EVPGIPSREALGWIAALACSAGLYLLHVNTCIVARGFSLDNMTRIFHITGRVWFRSIKY
FT                   FHIVCGYCVNHKLKCQDLNMVSLNSA"
FT   assembly_gap    16406952..16407613
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    16428192..16428452
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    16429299..16429404
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            <16467836..16497733
FT                   /gene="Pik3ca"
FT                   /locus_tag="mCG_20268"
FT                   /note="gene_id=mCG20268.2"
FT   mRNA            join(<16467836..16468187,16468748..16468957,
FT                   16469447..16469697,16471334..16471579,16472255..16472340,
FT                   16474354..16474459,16475208..16475360,16475444..16475578,
FT                   16479584..16479708,16481152..16481233,16481539..16481703,
FT                   16481892..16481995,16483390..16483561,16485495..16485601,
FT                   16486013..16486134,16487723..16487801,16491492..16491662,
FT                   16493110..16493227,16493327..16493478,16494191..16497733)
FT                   /gene="Pik3ca"
FT                   /locus_tag="mCG_20268"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, alpha
FT                   polypeptide, transcript variant mCT19850"
FT                   /note="gene_id=mCG20268.2 transcript_id=mCT19850.2 created
FT                   on 20-AUG-2002"
FT   CDS             join(16467836..16468187,16468748..16468957,
FT                   16469447..16469697,16471334..16471579,16472255..16472340,
FT                   16474354..16474459,16475208..16475360,16475444..16475578,
FT                   16479584..16479708,16481152..16481233,16481539..16481703,
FT                   16481892..16481995,16483390..16483561,16485495..16485601,
FT                   16486013..16486134,16487723..16487801,16491492..16491662,
FT                   16493110..16493227,16493327..16493478,16494191..16494461)
FT                   /codon_start=1
FT                   /gene="Pik3ca"
FT                   /locus_tag="mCG_20268"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, alpha
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG20268.2 transcript_id=mCT19850.2
FT                   protein_id=mCP3757.1 isoform=CRA_b"
FT                   /db_xref="GOA:P42337"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR037704"
FT                   /db_xref="MGI:MGI:1206581"
FT                   /db_xref="PDB:4A55"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42337"
FT                   /protein_id="EDL34990.1"
FT                   /translation="MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTI
FT                   KHELFREARKYPLHQLLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEP
FT                   VGNREEKILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRA
FT                   MYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIA
FT                   EAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGR
FT                   MPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILC
FT                   ATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRA
FT                   ARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNP
FT                   IGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRL
FT                   ARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNS
FT                   RDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQL
FT                   VQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRA
FT                   CGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLS
FT                   PLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDML
FT                   TLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQ
FT                   FNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLF
FT                   HIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYL
FT                   AIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHH
FT                   GGWTTKMDWIFHTIKQHALN"
FT   mRNA            join(16468011..16468045,16468748..16468957,
FT                   16469447..16469697,16471334..16471579,16472255..16472340,
FT                   16474354..16474459,16475208..16475360,16475444..16475578,
FT                   16479584..16479708,16481152..16481233,16481539..16481703,
FT                   16481892..16481995,16483390..16483561,16485495..16485601,
FT                   16486013..16486134,16487723..16487801,16491492..16491662,
FT                   16493110..16493227,16493327..16493478,16494191..16497733)
FT                   /gene="Pik3ca"
FT                   /locus_tag="mCG_20268"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, alpha
FT                   polypeptide, transcript variant mCT172199"
FT                   /note="gene_id=mCG20268.2 transcript_id=mCT172199.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(16468762..16468957,16469447..16469697,
FT                   16471334..16471579,16472255..16472340,16474354..16474459,
FT                   16475208..16475360,16475444..16475578,16479584..16479708,
FT                   16481152..16481233,16481539..16481703,16481892..16481995,
FT                   16483390..16483561,16485495..16485601,16486013..16486134,
FT                   16487723..16487801,16491492..16491662,16493110..16493227,
FT                   16493327..16493478,16494191..16494461)
FT                   /codon_start=1
FT                   /gene="Pik3ca"
FT                   /locus_tag="mCG_20268"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, alpha
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG20268.2 transcript_id=mCT172199.0
FT                   protein_id=mCP95118.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3YY41"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR037704"
FT                   /db_xref="MGI:MGI:1206581"
FT                   /db_xref="UniProtKB/TrEMBL:D3YY41"
FT                   /protein_id="EDL34989.1"
FT                   /translation="MPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVY
FT                   PPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIR
FT                   KKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNL
FT                   MLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYV
FT                   NVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLC
FT                   LSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVT
FT                   GSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDN
FT                   ELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEV
FT                   AQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVL
FT                   KYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMY
FT                   LKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNP
FT                   AHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQI
FT                   IRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSH
FT                   TLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDF
FT                   GHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQ
FT                   HANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWT
FT                   TKMDWIFHTIKQHALN"
FT   gene            complement(16503953..16514158)
FT                   /pseudo
FT                   /locus_tag="mCG_20273"
FT                   /note="gene_id=mCG20273.2"
FT   mRNA            complement(join(16503953..16504249,16505323..16505521,
FT                   16513985..16514158))
FT                   /pseudo
FT                   /locus_tag="mCG_20273"
FT                   /note="gene_id=mCG20273.2 transcript_id=mCT19855.1 created
FT                   on 20-AUG-2002"
FT   assembly_gap    16527728..16528015
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    16529637..16529858
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   gene            16542076..16552632
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /note="gene_id=mCG50458.2"
FT   mRNA            join(16542076..16542407,16544819..16545010,
FT                   16546206..16546276,16548851..16548961,16550932..16551066,
FT                   16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT179978"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179978.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(16542367..16542407,16544819..16545010,
FT                   16546206..16546276,16547106..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT50641"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT50641.1 created
FT                   on 11-FEB-2003"
FT   mRNA            join(16542408..16542550,16544819..16545010,
FT                   16546206..16546276,16547106..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT172596"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT172596.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(16542482..16542550,16544858..16545010,
FT                   16546206..16546276,16547106..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT179980"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179980.0 created
FT                   on 11-FEB-2003"
FT   mRNA            join(16544390..16545010,16546206..16546276,
FT                   16547106..16547174,16548851..16548961,16550932..16551066,
FT                   16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT179979"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179979.0 created
FT                   on 11-FEB-2003"
FT   CDS             join(16547117..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_a"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT172596.0
FT                   protein_id=mCP95516.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99KZ6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1915028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99KZ6"
FT                   /protein_id="EDL34991.1"
FT                   /translation="MNEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSM
FT                   RQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKS
FT                   TEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESL
FT                   QDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQH
FT                   VILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIAD
FT                   THFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEH
FT                   ARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTK
FT                   IFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADL
FT                   PHKCSECLMRFGNERDLLGHLQVHETT"
FT   CDS             join(16547117..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_a"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179980.0
FT                   protein_id=mCP102901.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99KZ6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1915028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99KZ6"
FT                   /protein_id="EDL34994.1"
FT                   /translation="MNEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSM
FT                   RQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKS
FT                   TEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESL
FT                   QDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQH
FT                   VILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIAD
FT                   THFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEH
FT                   ARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTK
FT                   IFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADL
FT                   PHKCSECLMRFGNERDLLGHLQVHETT"
FT   CDS             join(16547117..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_a"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT50641.1
FT                   protein_id=mCP26837.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99KZ6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1915028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99KZ6"
FT                   /protein_id="EDL34995.1"
FT                   /translation="MNEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSM
FT                   RQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKS
FT                   TEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESL
FT                   QDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQH
FT                   VILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIAD
FT                   THFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEH
FT                   ARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTK
FT                   IFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADL
FT                   PHKCSECLMRFGNERDLLGHLQVHETT"
FT   CDS             join(16547117..16547174,16548851..16548961,
FT                   16550932..16551066,16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_a"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179979.0
FT                   protein_id=mCP102902.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99KZ6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1915028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99KZ6"
FT                   /protein_id="EDL34996.1"
FT                   /translation="MNEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSM
FT                   RQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKS
FT                   TEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESL
FT                   QDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQH
FT                   VILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIAD
FT                   THFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEH
FT                   ARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTK
FT                   IFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADL
FT                   PHKCSECLMRFGNERDLLGHLQVHETT"
FT   mRNA            join(16548480..16548961,16550932..16551066,
FT                   16551354..16552632)
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, transcript variant
FT                   mCT172597"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT172597.0 created
FT                   on 11-FEB-2003"
FT   CDS             join(16548805..16548961,16550932..16551066,
FT                   16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_b"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT172597.0
FT                   protein_id=mCP95515.0 isoform=CRA_b"
FT                   /protein_id="EDL34992.1"
FT                   /translation="MSLLCWELSSFCLHSDSSGISRIADGVSGIFSDHCYSVCSMRQPD
FT                   LKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKSTEVE
FT                   ICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESLQDQA
FT                   DEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHVILK
FT                   HKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFS
FT                   DHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEHARRL
FT                   IELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPH
FT                   VCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADLPHKC
FT                   SECLMRFGNERDLLGHLQVHETT"
FT   CDS             join(16548925..16548961,16550932..16551066,
FT                   16551354..16552507)
FT                   /codon_start=1
FT                   /gene="Zfp639"
FT                   /locus_tag="mCG_50458"
FT                   /product="zinc finger protein 639, isoform CRA_c"
FT                   /note="gene_id=mCG50458.2 transcript_id=mCT179978.0
FT                   protein_id=mCP102900.0 isoform=CRA_c"
FT                   /protein_id="EDL34993.1"
FT                   /translation="MRQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSP
FT                   VLRILDHTVFSTEKSTEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAIS
FT                   EDYDIEAENNSSESLQDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCE
FT                   LCEFNSKYFSDLKQHVILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCD
FT                   YKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHE
FT                   TGDPEDLHSHVVNEHARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSR
FT                   LHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQI
FT                   DDLKIHLDFKHSADLPHKCSECLMRFGNERDLLGHLQVHETT"
FT   assembly_gap    16557007..16557026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16559659..16559795
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            16561417..16610250
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /note="gene_id=mCG20270.2"
FT   mRNA            join(16561417..16561632,16563822..16563940,
FT                   16566368..16566503,16570400..16570562,16574939..16575063,
FT                   16576200..16576308,16578721..16578828,16586286..16586439,
FT                   16587605..16587672,16593519..16593640,16595065..16595191,
FT                   16595429..16595533,16595847..16595949,16596130..16596359,
FT                   16600296..16600448,16601555..16601751,16606266..16606400,
FT                   16609018..16609163,16609399..16610250)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT172203"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172203.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(16561417..16561632,16563822..16563940,
FT                   16566368..16566503,16570400..16570562,16574939..16575063,
FT                   16576200..16576308,16578721..16578828,16586286..16586439,
FT                   16587605..16587672,16593519..16593640,16595065..16595191,
FT                   16595429..16595533,16595847..16595949,16596130..16596359,
FT                   16600296..16600448,16601555..16601751,16606266..16606400,
FT                   16609018..16610169)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT19853"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT19853.1 created
FT                   on 20-AUG-2002"
FT   mRNA            join(16561434..16561632,16563822..16563940,
FT                   16566368..16566503,16570400..16570562,16574939..16575063,
FT                   16576200..16576308,16578721..16579071)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT172205"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172205.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(16561476..16561497,16563822..16563940,
FT                   16566368..16566503,16570400..16570562,16574939..16575063,
FT                   16576200..16576308,16578721..16578828,16586286..16586439,
FT                   16587605..16587672,16593519..16593640,16595065..16595191,
FT                   16595429..16595533,16595847..16595949,16596130..16596359,
FT                   16600296..16600448,16601555..16601751,16606266..16606400,
FT                   16609018..16610169)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT172202"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172202.0 created
FT                   on 20-AUG-2002"
FT   mRNA            join(<16563477..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578828,16586286..16586439,16587605..16587672,
FT                   16593519..16593640,16595065..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609308)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT193290"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT193290.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16563805..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578828,16586286..16586439,16587605..16587672,
FT                   16593519..16593640,16595065..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609096)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_c"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT193290.0
FT                   protein_id=mCP114275.0 isoform=CRA_c"
FT                   /protein_id="EDL35000.1"
FT                   /translation="PFSQPRCIMAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVE
FT                   ATYRNPELDRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAML
FT                   WDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAG
FT                   CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMN
FT                   TEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSP
FT                   SEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSA
FT                   VKTKFEQHTIRAKQILDTVKNILDSVNVAAAEKRVYSMEEREDQIDRLDFIRNQMNLLT
FT                   LDVKKKIKEVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIE
FT                   DGMGRNLADRCTNEVNASILQSQQEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNC
FT                   HKLCSDFQEDIVFRFSLGWSSLVHRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSN
FT                   PAAPDNAAQEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYL
FT                   YERLTWTTRAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDV
FT                   TQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAIQLESELENFSKQFLHPSSGES"
FT   CDS             join(16563829..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578828,16586286..16586439,16587605..16587672,
FT                   16593519..16593640,16595065..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609096)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_a"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172202.0
FT                   protein_id=mCP95121.0 isoform=CRA_a"
FT                   /protein_id="EDL34997.1"
FT                   /translation="MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPEL
FT                   DRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSG
FT                   IGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP
FT                   KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHK
FT                   VNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIF
FT                   FVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQH
FT                   TIRAKQILDTVKNILDSVNVAAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIK
FT                   EVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLA
FT                   DRCTNEVNASILQSQQEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQ
FT                   EDIVFRFSLGWSSLVHRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAA
FT                   QEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTT
FT                   RAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDVTQKHLEEE
FT                   IARLSKEIDQLEKIQNNSKLLRNKAIQLESELENFSKQFLHPSSGES"
FT   CDS             join(16563829..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578828,16586286..16586439,16587605..16587672,
FT                   16593519..16593640,16595065..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609096)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_a"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172203.0
FT                   protein_id=mCP95124.0 isoform=CRA_a"
FT                   /protein_id="EDL34998.1"
FT                   /translation="MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPEL
FT                   DRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSG
FT                   IGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP
FT                   KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHK
FT                   VNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIF
FT                   FVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQH
FT                   TIRAKQILDTVKNILDSVNVAAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIK
FT                   EVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLA
FT                   DRCTNEVNASILQSQQEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQ
FT                   EDIVFRFSLGWSSLVHRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAA
FT                   QEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTT
FT                   RAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDVTQKHLEEE
FT                   IARLSKEIDQLEKIQNNSKLLRNKAIQLESELENFSKQFLHPSSGES"
FT   CDS             join(16563829..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578828,16586286..16586439,16587605..16587672,
FT                   16593519..16593640,16595065..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609096)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_a"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT19853.1
FT                   protein_id=mCP3742.2 isoform=CRA_a"
FT                   /protein_id="EDL35002.1"
FT                   /translation="MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPEL
FT                   DRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSG
FT                   IGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP
FT                   KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHK
FT                   VNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIF
FT                   FVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQH
FT                   TIRAKQILDTVKNILDSVNVAAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIK
FT                   EVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLA
FT                   DRCTNEVNASILQSQQEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQ
FT                   EDIVFRFSLGWSSLVHRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAA
FT                   QEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTT
FT                   RAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDVTQKHLEEE
FT                   IARLSKEIDQLEKIQNNSKLLRNKAIQLESELENFSKQFLHPSSGES"
FT   CDS             join(16563829..16563940,16566368..16566503,
FT                   16570400..16570562,16574939..16575063,16576200..16576308,
FT                   16578721..16578915)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_b"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172205.0
FT                   protein_id=mCP95122.0 isoform=CRA_b"
FT                   /protein_id="EDL34999.1"
FT                   /translation="MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPEL
FT                   DRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSG
FT                   IGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP
FT                   KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHK
FT                   VNERLSKPNIFILNNRWDASASEPEYMEDVSLSPLFELHSCTVLSAKTVDLRECLEK"
FT   assembly_gap    16571189..16571281
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    16589341..16589365
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    16590024..16590082
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   mRNA            join(16594090..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16610169)
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, transcript variant mCT172204"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172204.0 created
FT                   on 20-AUG-2002"
FT   CDS             join(16595075..16595191,16595429..16595533,
FT                   16595847..16595949,16596130..16596359,16600296..16600448,
FT                   16601555..16601751,16606266..16606400,16609018..16609096)
FT                   /codon_start=1
FT                   /gene="Mfn1"
FT                   /locus_tag="mCG_20270"
FT                   /product="mitofusin 1, isoform CRA_d"
FT                   /note="gene_id=mCG20270.2 transcript_id=mCT172204.0
FT                   protein_id=mCP95123.0 isoform=CRA_d"
FT                   /protein_id="EDL35001.1"
FT                   /translation="MEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMT
FT                   DEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTNEVNASILQSQ
FT                   QEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLV
FT                   HRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASL
FT                   TSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYA
FT                   TEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQ
FT                   NNSKLLRNKAIQLESELENFSKQFLHPSSGES"
FT   assembly_gap    16604412..16604594
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            complement(16614378..16648430)
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /note="gene_id=mCG20269.2"
FT   mRNA            complement(join(16614378..16617181,16619532..16619748,
FT                   16621680..16621881,16621968..16622034,16623084..16623246,
FT                   16625130..16625193,16628252..16628358,16630111..16630149,
FT                   16634021..16634116,16648347..16648415))
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   transcript variant mCT19851"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT19851.2 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(16614378..16617181,16619532..16619748,
FT                   16621680..16621881,16621968..16622034,16623084..16623246,
FT                   16628252..16628358,16630111..16630149,16634021..16634116,
FT                   16648347..16648387))
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   transcript variant mCT172200"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT172200.0 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(16617075..16617181,16619532..16619748,
FT                   16621680..16621881,16621968..16622034,16623084..16623246,
FT                   16625130..16625193,16628252..16628358,16630111..16630149,
FT                   16634021..16634077))
FT                   /codon_start=1
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT19851.2
FT                   protein_id=mCP3733.1 isoform=CRA_b"
FT                   /protein_id="EDL35004.1"
FT                   /translation="MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQM
FT                   RTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCA
FT                   YAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDGQIITSSGD
FT                   TTCALWDIETGQQTTTFTGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSF
FT                   TGHISDINAVSFFPSGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKS
FT                   GRLLLAGYDDFNCSVWDALKGGRSGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
FT                   "
FT   CDS             complement(join(16617075..16617181,16619532..16619748,
FT                   16621680..16621881,16621968..16622034,16623084..16623246))
FT                   /codon_start=1
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT172200.0
FT                   protein_id=mCP95119.0 isoform=CRA_a"
FT                   /protein_id="EDL35003.1"
FT                   /translation="MHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVR
FT                   VSRELPGHTGYLSCCRFLDDGQIITSSGDTTCALWDIETGQQTTTFTGHSGDVMSLSLS
FT                   PDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRL
FT                   FDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKGGRSGVLAGH
FT                   DNRVSCLGVTDDGMAVATGSWDSFLRIWN"
FT   mRNA            complement(join(16627954..16628358,16630111..16630149,
FT                   16634021..16634116,16648347..16648430))
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   transcript variant mCT172201"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT172201.0 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(16628149..16628358,16630111..16630149,
FT                   16634021..16634077))
FT                   /codon_start=1
FT                   /gene="Gnb4"
FT                   /locus_tag="mCG_20269"
FT                   /product="guanine nucleotide binding protein, beta 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20269.2 transcript_id=mCT172201.0
FT                   protein_id=mCP95120.0 isoform=CRA_c"
FT                   /protein_id="EDL35005.1"
FT                   /translation="MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQM
FT                   RTRRTLRGHLAKIYAMHWGYDSRSVAVTVKLPQEWFSLRIVLCISFVHKSLICAVL"
FT   assembly_gap    16648695..16650638
FT                   /estimated_length=1944
FT                   /gap_type="unknown"
FT   assembly_gap    16657418..16657905
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    16688269..16688408
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    16706032..16706240
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    16726798..16726855
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    16738455..16738474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16739353..16759549
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /note="gene_id=mCG124456.1"
FT   mRNA            join(16739353..16739462,16744904..16744980,
FT                   16745137..16745311,16747503..16747603,16748402..16748499,
FT                   16750607..16750701,16750944..16751050,16751143..16751232,
FT                   16752477..16752538,16752762..16752876,16753011..16753091,
FT                   16755196..16755291,16757823..16757909,16759098..16759507)
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, transcript variant mCT172134"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172134.0
FT                   created on 20-AUG-2002"
FT   CDS             join(16739426..16739462,16744904..16744980,
FT                   16745137..16745311,16747503..16747603,16748402..16748499,
FT                   16750607..16750701,16750944..16751050,16751143..16751232,
FT                   16752477..16752538,16752762..16752876,16753011..16753091,
FT                   16755196..16755291,16757823..16757909,16759098..16759178)
FT                   /codon_start=1
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, isoform CRA_c"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172134.0
FT                   protein_id=mCP95053.0 isoform=CRA_c"
FT                   /protein_id="EDL35008.1"
FT                   /translation="MEQILDSSSAQRDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAI
FT                   GVVLERDDGSTMMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQ
FT                   AILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYSIPAFFLCKTAVLTA
FT                   FANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELI
FT                   PPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQ
FT                   VAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMC
FT                   DIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWI
FT                   GGSILASLGTFQQMWISKQEYEEGGKQCVERKCP"
FT   mRNA            join(16741762..16741916,16744904..16744980,
FT                   16745137..16745311,16747503..16747603,16748402..16748499,
FT                   16750607..16750701,16750944..16751050,16751143..16751232,
FT                   16752477..16752538,16752762..16752876,16753011..16753091,
FT                   16755196..16755291,16757823..16757909,16759098..16759535)
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, transcript variant mCT125699"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT125699.0
FT                   created on 20-AUG-2002"
FT   CDS             join(16741892..16741916,16744904..16744980,
FT                   16745137..16745311,16747503..16747603,16748402..16748499,
FT                   16750607..16750701,16750944..16751050,16751143..16751232,
FT                   16752477..16752538,16752762..16752876,16753011..16753091,
FT                   16755196..16755291,16757823..16757909,16759098..16759178)
FT                   /codon_start=1
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, isoform CRA_a"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT125699.0
FT                   protein_id=mCP79654.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q505L1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR029912"
FT                   /db_xref="MGI:MGI:1861453"
FT                   /db_xref="UniProtKB/TrEMBL:Q505L1"
FT                   /protein_id="EDL35006.1"
FT                   /translation="MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVL
FT                   ERDDGSTMMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILD
FT                   HTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYSIPAFFLCKTAVLTAFANG
FT                   RSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELIPPYM
FT                   IASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQ
FT                   MPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDI
FT                   RPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSI
FT                   LASLGTFQQMWISKQEYEEGGKQCVERKCP"
FT   mRNA            join(16744419..16744980,16745137..16745311,
FT                   16747503..16747603,16748402..16748499,16750607..16750701,
FT                   16750944..16751050,16751143..16751232,16752477..16752538,
FT                   16752762..16752876,16753011..16753091,16755196..16755291,
FT                   16757823..16757909,16759098..16759549)
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, transcript variant mCT172135"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172135.0
FT                   created on 20-AUG-2002"
FT   CDS             join(16744675..16744980,16745137..16745311,
FT                   16747503..16747603,16748402..16748499,16750607..16750701,
FT                   16750944..16751050,16751143..16751232,16752477..16752538,
FT                   16752762..16752876,16753011..16753091,16755196..16755291,
FT                   16757823..16757909,16759098..16759178)
FT                   /codon_start=1
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, isoform CRA_d"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172135.0
FT                   protein_id=mCP95054.0 isoform=CRA_d"
FT                   /protein_id="EDL35009.1"
FT                   /translation="MDFYKVLNFHFIYIKYVLFFVETRVSLCSSGCPRISYVDQFGLEL
FT                   RDLSASASLIGIKGICNSIFNLFSNSLLISSDEVGALVFDIGSYTVRAGYAGEDCPKVD
FT                   FPTAIGVVLERDDGSTMMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVED
FT                   WDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYSIPAFFLCKT
FT                   AVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEM
FT                   NIELIPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDS
FT                   TYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTT
FT                   SVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERR
FT                   FSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP"
FT   mRNA            join(16752762..16753091,16755196..16755291,
FT                   16757823..16757909,16759098..16759549)
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, transcript variant mCT172133"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172133.0
FT                   created on 20-AUG-2002"
FT   CDS             join(16753029..16753091,16755196..16755291,
FT                   16757823..16757909,16759098..16759178)
FT                   /codon_start=1
FT                   /gene="Actl6a"
FT                   /locus_tag="mCG_124456"
FT                   /product="actin-like 6A, isoform CRA_b"
FT                   /note="gene_id=mCG124456.1 transcript_id=mCT172133.0
FT                   protein_id=mCP95052.0 isoform=CRA_b"
FT                   /protein_id="EDL35007.1"
FT                   /translation="MLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNR
FT                   ELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVE
FT                   RKCP"
FT   assembly_gap    16761284..16766466
FT                   /estimated_length=5183
FT                   /gap_type="unknown"
FT   gene            16770867..16780867
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /note="gene_id=mCG5158.2"
FT   mRNA            join(16770867..16771049,16774129..16774217,
FT                   16775751..16775817,16777031..16777092,16777764..16777870,
FT                   16780332..16780867)
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, transcript variant mCT172237"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172237.0 created
FT                   on 21-AUG-2002"
FT   mRNA            join(16770867..16771049,16774129..16774217,
FT                   16775751..16775817,16776900..16777092,16777764..16777870,
FT                   16780332..16780855)
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, transcript variant mCT172238"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172238.0 created
FT                   on 21-AUG-2002"
FT   mRNA            join(16770911..16771049,16774129..16774217,
FT                   16775751..16775817,16777764..16777870,16780339..16780858)
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, transcript variant mCT172239"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172239.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(16770932..16771049,16774129..16774217,
FT                   16775751..16775817,16777031..16777092,16777764..16777870,
FT                   16780332..16780452)
FT                   /codon_start=1
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, isoform CRA_a"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172237.0
FT                   protein_id=mCP95159.0 isoform=CRA_a"
FT                   /protein_id="EDL35010.1"
FT                   /translation="MDTGPTCTQTNMQAKHSYKETSTLSPSRLQCCQSPGHLPAPVRHS
FT                   GDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYI
FT                   PEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGD
FT                   GPWYQFPTPEKEFIDHSPKATPDN"
FT   CDS             join(16770932..16771049,16774129..16774217,
FT                   16775751..16775817,16777764..16777801)
FT                   /codon_start=1
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, isoform CRA_c"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172239.0
FT                   protein_id=mCP95157.0 isoform=CRA_c"
FT                   /protein_id="EDL35012.1"
FT                   /translation="MDTGPTCTQTNMQAKHSYKETSTLSPSRLQCCQSPGHLPAPVRHS
FT                   GDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIASDIKMDRPEFL"
FT   CDS             join(16770932..16771049,16774129..16774217,
FT                   16775751..16775817,16776900..16776904)
FT                   /codon_start=1
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, isoform CRA_b"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172238.0
FT                   protein_id=mCP95156.0 isoform=CRA_b"
FT                   /protein_id="EDL35011.1"
FT                   /translation="MDTGPTCTQTNMQAKHSYKETSTLSPSRLQCCQSPGHLPAPVRHS
FT                   GDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIG"
FT   mRNA            join(16774031..16774217,16775751..16775817,
FT                   16777031..16777092,16777764..16777870,16780332..16780867)
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, transcript variant mCT4506"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT4506.1 created on
FT                   21-AUG-2002"
FT   mRNA            join(16774120..16774217,16775751..16775817,
FT                   16777031..16777092,16777764..16777878,16780339..16780855)
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, transcript variant mCT172240"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172240.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(16774215..16774217,16775751..16775817,
FT                   16777031..16777092,16777764..16777870,16780332..16780452)
FT                   /codon_start=1
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, isoform CRA_e"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT4506.1
FT                   protein_id=mCP3738.1 isoform=CRA_e"
FT                   /db_xref="GOA:D3Z568"
FT                   /db_xref="InterPro:IPR019173"
FT                   /db_xref="MGI:MGI:1913296"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z568"
FT                   /protein_id="EDL35014.1"
FT                   /translation="MKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKH
FT                   PISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTP
FT                   EKEFIDHSPKATPDN"
FT   CDS             join(16774215..16774217,16775751..16775817,
FT                   16777031..16777092,16777764..16777874)
FT                   /codon_start=1
FT                   /gene="Ndufb5"
FT                   /locus_tag="mCG_5158"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 5, isoform CRA_d"
FT                   /note="gene_id=mCG5158.2 transcript_id=mCT172240.0
FT                   protein_id=mCP95158.0 isoform=CRA_d"
FT                   /protein_id="EDL35013.1"
FT                   /translation="MKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKH
FT                   PISRWIARNFYDGPEKNYEKTLAILQIESEKAELR"
FT   assembly_gap    16775082..16775216
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    16785836..16786210
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    16797771..16797793
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    16813986..16814461
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   gene            16846938..16964626
FT                   /gene="Usp13"
FT                   /locus_tag="mCG_124464"
FT                   /note="gene_id=mCG124464.0"
FT   mRNA            join(16846938..16847119,16866786..16866911,
FT                   16876288..16876348,16883031..16883152,16890245..16890387,
FT                   16894259..16894443,16905380..16905474,16909823..16910010,
FT                   16914649..16914720,16915036..16915129,16923390..16923515,
FT                   16930579..16930732,16933921..16934095,16940719..16940807,
FT                   16943242..16943364,16944133..16944159,16944814..16944957,
FT                   16946574..16946731,16948032..16948185,16960711..16960795,
FT                   16962194..16964626)
FT                   /gene="Usp13"
FT                   /locus_tag="mCG_124464"
FT                   /product="ubiquitin specific peptidase 13 (isopeptidase
FT                   T-3)"
FT                   /note="gene_id=mCG124464.0 transcript_id=mCT125707.1
FT                   created on 21-AUG-2002"
FT   CDS             join(16846958..16847119,16866786..16866911,
FT                   16876288..16876348,16883031..16883152,16890245..16890387,
FT                   16894259..16894443,16905380..16905474,16909823..16910010,
FT                   16914649..16914720,16915036..16915129,16923390..16923515,
FT                   16930579..16930732,16933921..16934095,16940719..16940807,
FT                   16943242..16943364,16944133..16944159,16944814..16944957,
FT                   16946574..16946731,16948032..16948185,16960711..16960795,
FT                   16962194..16962287)
FT                   /codon_start=1
FT                   /gene="Usp13"
FT                   /locus_tag="mCG_124464"
FT                   /product="ubiquitin specific peptidase 13 (isopeptidase
FT                   T-3)"
FT                   /note="gene_id=mCG124464.0 transcript_id=mCT125707.1
FT                   protein_id=mCP79370.1"
FT                   /db_xref="GOA:Q5BKP2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="MGI:MGI:1919857"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BKP2"
FT                   /protein_id="EDL35015.1"
FT                   /translation="MQRRGALFSVPGGGGKMAAGDLGELLVPHMPTIRVPRSGDRVYKN
FT                   ECAFSYDSPNSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHMREKVRGASGG
FT                   ALPKRRNSKIFLDLDMDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACD
FT                   AVLSSKSPYRKQDPDTWENEVPVSKYANNLVQLDNGVRIPPSGWKCARCDLRENLWLNL
FT                   TDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEGPVSDPH
FT                   LAKHLAHFGIDMLHTQGTENGLRDNDIKPRVSEWEVIQESGTKLKPMYGPGYTGLKNLG
FT                   NSCYLSSVMQAIFSIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSK
FT                   PPVKSELIEQVMKEEHKPQQNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVE
FT                   RNRIGSENPSDVFRFLVEERIQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELITYEL
FT                   MRREAEANRRPLPELVRAKIPFSACLQAFAEPDNVDDFWSSALQAKSAGVKTSRFASFP
FT                   EYLVVQIKKFTFGLDWVPRKFDVSIDMPDLLDISHLRARGLQPGEEELPDISPPIVIPD
FT                   DSKDRLMNQLIDPSDIDESSVMQLAEMGFPLEACRKAVYFTGNTGAEVAFNWIIVHMEE
FT                   PDFAEPLAIPGYGGAGASVFGATGLDNQPPEEIVAIITSMGFQRNQAVQALQATNHNLE
FT                   RALDWIFSHPEFEEDSDFVIEMENNANANIVSEAKPEGPRVKDGSGMYELFAFISHMGT
FT                   STMSGHYVCHIKKEGRWVIYNDHKVCASERPPKDLGYMYFYRRIPS"
FT   assembly_gap    16864727..16865139
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   gene            complement(16907743..16909114)
FT                   /pseudo
FT                   /locus_tag="mCG_5159"
FT                   /note="gene_id=mCG5159.1"
FT   mRNA            complement(join(16907743..16908847,16909041..16909114))
FT                   /pseudo
FT                   /locus_tag="mCG_5159"
FT                   /note="gene_id=mCG5159.1 transcript_id=mCT4507.1 created on
FT                   21-AUG-2002"
FT   assembly_gap    16911641..16911702
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    16919731..16919750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16938894..16938913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16959103..16959122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16967651..16967670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16968391..17012088
FT                   /locus_tag="mCG_146078"
FT                   /note="gene_id=mCG146078.0"
FT   mRNA            join(<16968391..16968519,16973715..16973758,
FT                   16976135..16976311,16979479..16979605,16981222..16981433,
FT                   16983111..16983207,16990118..16990263,17000883..17000995,
FT                   17008582..17009254,17010967..17012088)
FT                   /locus_tag="mCG_146078"
FT                   /product="mCG146078"
FT                   /note="gene_id=mCG146078.0 transcript_id=mCT186181.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    16974733..16975125
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            complement(16978213..>17174893)
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /note="gene_id=mCG5160.3"
FT   mRNA            complement(join(16978213..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17174634..17174862))
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, transcript variant mCT172241"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT172241.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(16978213..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17055848..17055952,17174634..17174672))
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, transcript variant mCT125705"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT125705.1 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(16978213..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17110157..17110228,17111668..17111827,
FT                   17112508..17112722))
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, transcript variant mCT4509"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT4509.2 created on
FT                   21-AUG-2002"
FT   CDS             complement(join(16979474..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17174634..17174654))
FT                   /codon_start=1
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, isoform CRA_a"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT172241.0
FT                   protein_id=mCP95161.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="InterPro:IPR024112"
FT                   /db_xref="MGI:MGI:1916672"
FT                   /db_xref="UniProtKB/TrEMBL:F8SLP9"
FT                   /protein_id="EDL35017.1"
FT                   /translation="MYQGHMQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAV
FT                   LTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPET
FT                   SSLDLDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLWSAEHRSQPELST
FT                   GKSALNSESASELELVAPAQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWD
FT                   KMQAEWEEMARRNWISENQEAQNQVTVSASEKGYYFHTENPFKDWPGAFEEGLKRLKEG
FT                   DLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMA
FT                   LAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDSSVLEGVK
FT                   ELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGAT
FT                   LANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSR
FT                   NQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP"
FT   CDS             complement(join(16979474..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17055848..17055952,17174634..17174654))
FT                   /codon_start=1
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, isoform CRA_d"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT125705.1
FT                   protein_id=mCP79258.1 isoform=CRA_d"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="InterPro:IPR024112"
FT                   /db_xref="MGI:MGI:1916672"
FT                   /db_xref="UniProtKB/TrEMBL:F8SLP8"
FT                   /protein_id="EDL35020.1"
FT                   /translation="MYQGHMQGKGSRAADKAVAMVMKEIPREESAEEKPLLTVTSQLVN
FT                   EQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKS
FT                   EPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQLEKWDDVKFHGDRT
FT                   SKGHLMAERKSCSSRTGSKELLWSAEHRSQPELSTGKSALNSESASELELVAPAQARLT
FT                   KEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAQNQ
FT                   VTVSASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQ
FT                   FLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQ
FT                   NPKYKYLVKNKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGV
FT                   LFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGF
FT                   IRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSL
FT                   MDQPELFQAANLGDLDVLLRAFNLDP"
FT   CDS             complement(join(16979474..16979678,16981286..16981443,
FT                   16981851..16982016,16983143..16983340,16984577..16984647,
FT                   16985488..16985631,16987561..16987677,17021691..17021786,
FT                   17035457..17035553,17037073..17037196,17038273..17038467,
FT                   17046115..17046226,17110157..17110228,17111668..17111760))
FT                   /codon_start=1
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, isoform CRA_e"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT4509.2
FT                   protein_id=mCP3744.2 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="InterPro:IPR024112"
FT                   /db_xref="MGI:MGI:1916672"
FT                   /db_xref="UniProtKB/TrEMBL:F8SLQ3"
FT                   /protein_id="EDL35021.1"
FT                   /translation="MSDSEMDGRTHIPSLLNALLSRNRVMQMSYLKSKEQGYGKLSSDE
FT                   DLEIIVDQKQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLS
FT                   EPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQL
FT                   EKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLWSAEHRSQPELSTGKSALNSESAS
FT                   ELELVAPAQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMAR
FT                   RNWISENQEAQNQVTVSASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEA
FT                   AILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQ
FT                   QDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNG
FT                   DMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAV
FT                   EAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAIS
FT                   GNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP"
FT   mRNA            complement(join(16984999..16985631,16987561..16987677,
FT                   17021691..17021786,17035457..17035553,17037073..17037196,
FT                   17038273..17038467,17046115..17046226,17110157..17110228,
FT                   17111668..17111827,17112508..17112722))
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, transcript variant mCT172242"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT172242.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(16985128..16985631,16987561..16987677,
FT                   17021691..17021786,17035457..17035553,17037073..17037199,
FT                   17038273..17038467,17046115..17046226,17055848..17055952,
FT                   17110157..17110228,17174634..>17174893))
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, transcript variant mCT193283"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT193283.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16985452..16985631,16987561..16987677,
FT                   17021691..17021786,17035457..17035553,17037073..17037199,
FT                   17038273..17038467,17046115..17046226,17055848..17055952,
FT                   17110157..17110228,17174634..>17174669))
FT                   /codon_start=1
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, isoform CRA_c"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT193283.0
FT                   protein_id=mCP114278.0 isoform=CRA_c"
FT                   /protein_id="EDL35019.1"
FT                   /translation="GRRSRMYQGHMQKSKEQGYGKLSSDEDLEIIVDQKQGKGSRAADK
FT                   AVAMVMKEIPREESAEEKPLLTVTSQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVT
FT                   SNTAVLTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQAL
FT                   RGPETSSLDLVDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLWSAEHRS
FT                   QPELSTGKSALNSESASELELVAPAQARLTKEHRWGSALLSRNHSLEEEFERAKAAVES
FT                   DTEFWDKMQAEWEEMARRNWISENQEAQNQVTVSASEKGYYFHTENPFKDWPGAFEEGL
FT                   KRLKEGDLPVTILFMEAAILQDPGDAEVALPFPLSRLG"
FT   CDS             complement(join(16985452..16985631,16987561..16987677,
FT                   17021691..17021786,17035457..17035553,17037073..17037196,
FT                   17038273..17038467,17046115..17046226,17110157..17110228,
FT                   17111668..17111760))
FT                   /codon_start=1
FT                   /gene="Pex2"
FT                   /locus_tag="mCG_5160"
FT                   /product="peroxin 2, isoform CRA_b"
FT                   /note="gene_id=mCG5160.3 transcript_id=mCT172242.0
FT                   protein_id=mCP95160.0 isoform=CRA_b"
FT                   /protein_id="EDL35018.1"
FT                   /translation="MSDSEMDGRTHIPSLLNALLSRNRVMQMSYLKSKEQGYGKLSSDE
FT                   DLEIIVDQKQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLS
FT                   EPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQL
FT                   EKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLWSAEHRSQPELSTGKSALNSESAS
FT                   ELELVAPAQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMAR
FT                   RNWISENQEAQNQVTVSASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEA
FT                   AILQDPGDAEVALPFPLSRLG"
FT   assembly_gap    16999707..16999726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <17008836..17009219
FT                   /codon_start=1
FT                   /locus_tag="mCG_146078"
FT                   /product="mCG146078"
FT                   /note="gene_id=mCG146078.0 transcript_id=mCT186181.0
FT                   protein_id=mCP107282.0"
FT                   /protein_id="EDL35016.1"
FT                   /translation="RHSGQSSCWTPACPLYLRALTRDLLVEICYERSQGQKNDQLVTQG
FT                   HALSSTNLIRTRHSPFPSRLKLLQQEFRTDKKKSVLIEMIARQRDGSPGWFWSVLSLNA
FT                   KNRVDTQGLPESQTHRPSWWEIA"
FT   assembly_gap    17031654..17031673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17055928..17118293
FT                   /locus_tag="mCG_5163"
FT                   /note="gene_id=mCG5163.2"
FT   mRNA            join(17055928..17056054,17085405..17085488,
FT                   17109692..17109742,17113369..17113540,17115957..17116134,
FT                   17117814..17117918,17118015..17118293)
FT                   /locus_tag="mCG_5163"
FT                   /product="mCG5163"
FT                   /note="gene_id=mCG5163.2 transcript_id=mCT4496.2 created on
FT                   21-AUG-2002"
FT   CDS             join(17116010..17116134,17117814..17117826)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5163"
FT                   /product="mCG5163"
FT                   /note="gene_id=mCG5163.2 transcript_id=mCT4496.2
FT                   protein_id=mCP3726.2"
FT                   /protein_id="EDL35022.1"
FT                   /translation="MGRANRKQGGQSLPSGKVDSCQPCSQFQVLSGLPKWTWNDSWKKK
FT                   "
FT   assembly_gap    17124639..17126324
FT                   /estimated_length=1686
FT                   /gap_type="unknown"
FT   assembly_gap    17135279..17135298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17136463..17136482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17140368..17140387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17161824..17161848
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    17174894..17175101
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    17187415..17189790
FT                   /estimated_length=2376
FT                   /gap_type="unknown"
FT   assembly_gap    17267111..17267317
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    17278396..17278415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17281457..17281476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17292263..17292282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17300086..17300105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17301317..17301336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17302372..17302391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17308230..17308249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17309349..17309368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17314873..17314892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17316209..17316228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17317271..17317290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17325188..17325727
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    17328888..17328907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17389594..17389613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17418829..17418951
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    17485788..17485822
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    17505729..17505748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17507173..17507228
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    17541583..17541602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17545362..17545597
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    17562974..17563377
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    17584160..17585442
FT                   /estimated_length=1283
FT                   /gap_type="unknown"
FT   assembly_gap    17611503..17611542
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    17614988..17615007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17626759..17647976
FT                   /estimated_length=21218
FT                   /gap_type="unknown"
FT   assembly_gap    17690591..17690610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17706680..17707351)
FT                   /pseudo
FT                   /locus_tag="mCG_49257"
FT                   /note="gene_id=mCG49257.2"
FT   mRNA            complement(17706680..17707351)
FT                   /pseudo
FT                   /locus_tag="mCG_49257"
FT                   /note="gene_id=mCG49257.2 transcript_id=mCT49440.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    17718815..17718834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17737929..17737948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17753701..17756403
FT                   /pseudo
FT                   /locus_tag="mCG_1049478"
FT                   /note="gene_id=mCG1049478.0"
FT   mRNA            join(17753701..17754261,17756357..17756403)
FT                   /pseudo
FT                   /locus_tag="mCG_1049478"
FT                   /note="gene_id=mCG1049478.0 transcript_id=mCT167182.1
FT                   created on 21-FEB-2003"
FT   assembly_gap    17791292..17795736
FT                   /estimated_length=4445
FT                   /gap_type="unknown"
FT   assembly_gap    17797783..17797938
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   gene            17821143..17831057
FT                   /locus_tag="mCG_123425"
FT                   /note="gene_id=mCG123425.1"
FT   mRNA            join(17821143..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17828952)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT172126"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172126.0
FT                   created on 21-AUG-2002"
FT   mRNA            join(17821145..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17827853,17828759..17828868,
FT                   17829606..17831057)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT172127"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172127.0
FT                   created on 21-AUG-2002"
FT   mRNA            join(17821145..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17827853,17828776..17828868,
FT                   17829606..17829906)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT172129"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172129.0
FT                   created on 21-AUG-2002"
FT   mRNA            join(17821148..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17828345,17828759..17828951)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT124657"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT124657.1
FT                   created on 21-AUG-2002"
FT   mRNA            join(17821151..17821361,17821507..17821599,
FT                   17821875..17821999,17822110..17822309,17823779..17823863,
FT                   17823995..17824124,17824370..17824525,17824920..17824991,
FT                   17825341..17825460,17825560..17825682,17827736..17828345,
FT                   17828759..17828951)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT172128"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172128.0
FT                   created on 21-AUG-2002"
FT   mRNA            join(17821188..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824920..17824991,17825341..17825460,17825560..17825682,
FT                   17827736..17828345,17828759..17828951)
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, transcript variant mCT172125"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172125.0
FT                   created on 21-AUG-2002"
FT   CDS             join(17821204..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17827853,17828759..17828868,
FT                   17829606..17830509)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_b"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172127.0
FT                   protein_id=mCP95045.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9T5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914370"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9T5"
FT                   /protein_id="EDL35024.1"
FT                   /translation="MDRDLLRQSLGCHGPALLSLLRSEQQDNPHFRSLLGTAAEPARGA
FT                   APPPGAGRKEKRVDNIEIQKFISKKADLLFALSWKSDASPPSEVHDDNDNLYAVMPPLE
FT                   QFMEMPSMDRRELFFRDIERGDIVIGRISSIREFGFFMVLICLGSGIVRDISHLEITAL
FT                   CPLRDVPSHSNHGDPLSYYQTGDIIRAGIKDIDRYHEKLAVSLYSSSLPPHMAGIKLGV
FT                   ITSEELPLYYRRSVELNSNSLESYENIMQSSLGFVNPGVVEFLLEKLGIDESHPPSLMR
FT                   GLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNV
FT                   EALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLN
FT                   AESYYKKALTLDETFKDAEDALQKLHKYMQKSLELREKQAEKEEKQKTKKIETSAEKLR
FT                   KLLKEEKRLKKKRRKSSSSSSVSSADESVSSSSSSSSSSHKRHKKSKRNRSESSRSSKR
FT                   HWSRPSSGHTDQSRKDDCYPVPTNTSASFLNQKQEVEKLLEKQDRLQCPNAQVKEKERG
FT                   LLTSSGEVPDDLGGRSDFYNSYKTQAGSSKTEKPYKSERHFSRRNSSDSFSRNSEDKMK
FT                   ASSYRRFEKDTEGRKDHSRRWEPSSVKYSTSPASSDYSWKSLEKQKKYTYSGSRDVSKH
FT                   EQRYQLNTNQGERVYEKEDSCGEGNRNEAPEEMLNSKEQPDSRVKKNLPQNLLNIFNQI
FT                   AEFEKEKGNKPKK"
FT   CDS             join(17821204..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17827853,17828776..17828790)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_f"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172129.0
FT                   protein_id=mCP95044.0 isoform=CRA_f"
FT                   /db_xref="GOA:A0A0G2JEX0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEX0"
FT                   /protein_id="EDL35028.1"
FT                   /translation="MDRDLLRQSLGCHGPALLSLLRSEQQDNPHFRSLLGTAAEPARGA
FT                   APPPGAGRKEKRVDNIEIQKFISKKADLLFALSWKSDASPPSEVHDDNDNLYAVMPPLE
FT                   QFMEMPSMDRRELFFRDIERGDIVIGRISSIREFGFFMVLICLGSGIVRDISHLEITAL
FT                   CPLRDVPSHSNHGDPLSYYQTGDIIRAGIKDIDRYHEKLAVSLYSSSLPPHMAGIKLGV
FT                   ITSEELPLYYRRSVELNSNSLESYENIMQSSLGFVNPGVVEFLLEKLGIDESHPPSLMR
FT                   GLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNV
FT                   EALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLN
FT                   AESYYKKALTLDETFKDAEDALQKLHKYMQRKTS"
FT   CDS             join(17821204..17821361,17821507..17821599,
FT                   17821875..17821999,17822110..17822309,17823779..17823863,
FT                   17823995..17824124,17824370..17824525,17824920..17824991,
FT                   17825341..17825460,17825560..17825682,17827736..17827883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_c"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172128.0
FT                   protein_id=mCP95046.0 isoform=CRA_c"
FT                   /protein_id="EDL35025.1"
FT                   /translation="MDRDLLRQSLGCHGPALLSLLRSEQQDNPHFRSLLGTAAEPARGA
FT                   APPPGAGRENGLKTSSGTQWVKSLSIERPDLTDSQASQGKEKRVDNIEIQKFISKKADL
FT                   LFALSWKSDASPPSEVHDDNDNLYAVMPPLEQFMEMPSMDRRELFFRDIERGDIVIGRI
FT                   SSIREFGFFMVLICLGSGIVRDISHLEITALCPLRDVPSHSNHGDPLSYYQTGDIIRAG
FT                   IKDIDRYHEKLAVSLYSSSLPPHMAGIKLGVITSEELPLYYRRSVELNSNSLESYENIM
FT                   QSSLGFVNPGVVEFLLEKLGIDESHPPSLMRGLQSKNFSEDDFASALRKKQSASWALKC
FT                   VKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALE
FT                   NCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALTLDETFKDAEDALQKLHKY
FT                   MQVILYFLFEI"
FT   CDS             join(17821204..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824370..17824525,17824920..17824991,17825341..17825460,
FT                   17825560..17825682,17827736..17827883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_e"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172126.0
FT                   protein_id=mCP95047.0 isoform=CRA_e"
FT                   /db_xref="GOA:A6H6N9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914370"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6N9"
FT                   /protein_id="EDL35027.1"
FT                   /translation="MDRDLLRQSLGCHGPALLSLLRSEQQDNPHFRSLLGTAAEPARGA
FT                   APPPGAGRKEKRVDNIEIQKFISKKADLLFALSWKSDASPPSEVHDDNDNLYAVMPPLE
FT                   QFMEMPSMDRRELFFRDIERGDIVIGRISSIREFGFFMVLICLGSGIVRDISHLEITAL
FT                   CPLRDVPSHSNHGDPLSYYQTGDIIRAGIKDIDRYHEKLAVSLYSSSLPPHMAGIKLGV
FT                   ITSEELPLYYRRSVELNSNSLESYENIMQSSLGFVNPGVVEFLLEKLGIDESHPPSLMR
FT                   GLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNV
FT                   EALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLN
FT                   AESYYKKALTLDETFKDAEDALQKLHKYMQVILYFLFEI"
FT   CDS             join(17821204..17821361,17821875..17821999,
FT                   17822110..17822309,17823779..17823863,17823995..17824124,
FT                   17824920..17824991,17825341..17825460,17825560..17825682,
FT                   17827736..17827883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_a"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT172125.0
FT                   protein_id=mCP95048.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0G2JE97"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JE97"
FT                   /protein_id="EDL35023.1"
FT                   /translation="MDRDLLRQSLGCHGPALLSLLRSEQQDNPHFRSLLGTAAEPARGA
FT                   APPPGAGRKEKRVDNIEIQKFISKKADLLFALSWKSDASPPSEVHDDNDNLYAVMPPLE
FT                   QFMEMPSMDRRELFFRDIERGDIVIGRISSIREFGFFMVLICLGSGIVRDISHLEITAL
FT                   CPLRDVPSHSNHGDPLSYYQTGDIIRAGIKDIDRYHEKLAVSLYSSSLPPHMAGIKLGV
FT                   ITSEELPLYYSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKAL
FT                   EIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLE
FT                   EEEKFLNAESYYKKALTLDETFKDAEDALQKLHKYMQVILYFLFEI"
FT   CDS             join(17822145..17822309,17823779..17823863,
FT                   17823995..17824124,17824370..17824525,17824920..17824991,
FT                   17825341..17825460,17825560..17825682,17827736..17827883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123425"
FT                   /product="mCG123425, isoform CRA_d"
FT                   /note="gene_id=mCG123425.1 transcript_id=mCT124657.1
FT                   protein_id=mCP79800.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9CYE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914370"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CYE8"
FT                   /protein_id="EDL35026.1"
FT                   /translation="MEMPSMDRRELFFRDIERGDIVIGRISSIREFGFFMVLICLGSGI
FT                   VRDISHLEITALCPLRDVPSHSNHGDPLSYYQTGDIIRAGIKDIDRYHEKLAVSLYSSS
FT                   LPPHMAGIKLGVITSEELPLYYRRSVELNSNSLESYENIMQSSLGFVNPGVVEFLLEKL
FT                   GIDESHPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNE
FT                   YNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVER
FT                   GGQLEEEEKFLNAESYYKKALTLDETFKDAEDALQKLHKYMQVILYFLFEI"
FT   gene            complement(17832901..17864809)
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /note="gene_id=mCG15248.2"
FT   mRNA            complement(join(17832901..17834120,17835110..17835186,
FT                   17835273..17835449,17835575..17835715,17836332..17836438,
FT                   17836832..17836991,17837759..17837882,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864494..17864571))
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, transcript
FT                   variant mCT172168"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT172168.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(17833282..17834120,17835110..17835186,
FT                   17835273..17835449,17835575..17835715,17836332..17836438,
FT                   17836832..17836991,17837759..17837882,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864601..17864809))
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, transcript
FT                   variant mCT14504"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT14504.2 created
FT                   on 21-AUG-2002"
FT   CDS             complement(join(17833967..17834120,17835110..17835186,
FT                   17835273..17835449,17835575..17835715,17836332..17836438,
FT                   17836832..17836991,17837759..17837882,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864601..17864690))
FT                   /codon_start=1
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, isoform CRA_a"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT14504.2
FT                   protein_id=mCP3747.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D5Y1"
FT                   /db_xref="InterPro:IPR033290"
FT                   /db_xref="MGI:MGI:1289263"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D5Y1"
FT                   /protein_id="EDL35029.1"
FT                   /translation="MCSEFLSELHWEDGFAIPVANQENKILEDQLAKLREEKSNLQDQL
FT                   HDYEERINSMTSHLKNVNQEFLFTQSLYKARESEIESEEHFKAIAERELGRVKNETQLL
FT                   EKEMAIIRERKSQMENNIFKTTQKLDDLKCQMNWDQQALEAWLEESAHKDSDSLTLQKY
FT                   SQQDDNKIRALTLQLEKLTMEYNEKRKLLDSELTETLSAQLELDKAAQDFRKIHLERQE
FT                   LIQQWENTIEQMQRRDQEIDNCALALSRIKQEAREKEGVVKEKIKFLENEVENNIEYER
FT                   KISVAERKVSKCRMDYQRHEGNRSQLKDELDTLKTTLNRTSSDLQALRKNISKVKKDIF
FT                   DETLRLQKLKHHNEVVKHKLKMITEKTLSIEEKATNMEDMLKEEEKGLKEVEVQLGIVK
FT                   DVLFKKVQELQNEIAKEKALVSEIEGTRSSLKHLNKQLHKLDFETLKQQEIMYSQDFYI
FT                   QQVERRMSRLKGEINSEEKQALEAKILELKKTMDEKKSTLSLLESQIKKLHNDLYFIKK
FT                   SNGKNNDEKESLMNKISELNLFIDRSEKELSKAKAVKEDMMIEDNLLKLQVKRARELLY
FT                   SKAEEVLSLEKRKQQLGKDMEERAEEIKVHKAMLTSQIRCVEQQRKTMSSEFHERLSKI
FT                   DKLKNRYEILTVVMLPPEGEEEKTQSYYVIKAAQEKEELQREGDSLDAKINKAEKEIYA
FT                   LQNTLQVLNSCNSNYKQSFKKVTPSSDEYALKIQLEEQKRTADERYRCKQRQIRELQED
FT                   IQSMENTFEVIGHLANNAKEKLTEKQTLAFQLRKETEEQKPKLQRITKQCGRLRREIRI
FT                   LKQTDNETLEEQDIQLREIIQFHKDIDQMLVNAMENAEIHAIFKTYFEQNGLELPTARG
FT                   PSSRSSSQSSSLSSFRSLEDVTLQSPPTAKVIQLRFPEPPPATNDSSRSASSGSNSNIP
FT                   KEKKLSK"
FT   CDS             complement(join(17833967..17834120,17835110..17835186,
FT                   17835273..17835449,17835575..17835715,17836332..17836438,
FT                   17836832..17836991,17837759..17837882,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864494..17864505))
FT                   /codon_start=1
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, isoform CRA_c"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT172168.0
FT                   protein_id=mCP95088.0 isoform=CRA_c"
FT                   /protein_id="EDL35031.1"
FT                   /translation="MDDQLAKLREEKSNLQDQLHDYEERINSMTSHLKNVNQEFLFTQS
FT                   LYKARESEIESEEHFKAIAERELGRVKNETQLLEKEMAIIRERKSQMENNIFKTTQKLD
FT                   DLKCQMNWDQQALEAWLEESAHKDSDSLTLQKYSQQDDNKIRALTLQLEKLTMEYNEKR
FT                   KLLDSELTETLSAQLELDKAAQDFRKIHLERQELIQQWENTIEQMQRRDQEIDNCALAL
FT                   SRIKQEAREKEGVVKEKIKFLENEVENNIEYERKISVAERKVSKCRMDYQRHEGNRSQL
FT                   KDELDTLKTTLNRTSSDLQALRKNISKVKKDIFDETLRLQKLKHHNEVVKHKLKMITEK
FT                   TLSIEEKATNMEDMLKEEEKGLKEVEVQLGIVKDVLFKKVQELQNEIAKEKALVSEIEG
FT                   TRSSLKHLNKQLHKLDFETLKQQEIMYSQDFYIQQVERRMSRLKGEINSEEKQALEAKI
FT                   LELKKTMDEKKSTLSLLESQIKKLHNDLYFIKKSNGKNNDEKESLMNKISELNLFIDRS
FT                   EKELSKAKAVKEDMMIEDNLLKLQVKRARELLYSKAEEVLSLEKRKQQLGKDMEERAEE
FT                   IKVHKAMLTSQIRCVEQQRKTMSSEFHERLSKIDKLKNRYEILTVVMLPPEGEEEKTQS
FT                   YYVIKAAQEKEELQREGDSLDAKINKAEKEIYALQNTLQVLNSCNSNYKQSFKKVTPSS
FT                   DEYALKIQLEEQKRTADERYRCKQRQIRELQEDIQSMENTFEVIGHLANNAKEKLTEKQ
FT                   TLAFQLRKETEEQKPKLQRITKQCGRLRREIRILKQTDNETLEEQDIQLREIIQFHKDI
FT                   DQMLVNAMENAEIHAIFKTYFEQNGLELPTARGPSSRSSSQSSSLSSFRSLEDVTLQSP
FT                   PTAKVIQLRFPEPPPATNDSSRSASSGSNSNIPKEKKLSK"
FT   mRNA            complement(join(17839579..17839728,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864601..17864754))
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, transcript
FT                   variant mCT172169"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT172169.0 created
FT                   on 21-AUG-2002"
FT   CDS             complement(join(17839692..17839728,17840745..17840953,
FT                   17842314..17842451,17845855..17846019,17846919..17847113,
FT                   17850533..17850665,17851165..17851268,17853036..17853227,
FT                   17857214..17857342,17857438..17857530,17858302..17858460,
FT                   17859574..17859720,17861565..17861684,17864601..17864690))
FT                   /codon_start=1
FT                   /gene="Ccdc39"
FT                   /locus_tag="mCG_15248"
FT                   /product="coiled-coil domain containing 39, isoform CRA_b"
FT                   /note="gene_id=mCG15248.2 transcript_id=mCT172169.0
FT                   protein_id=mCP95087.0 isoform=CRA_b"
FT                   /protein_id="EDL35030.1"
FT                   /translation="MCSEFLSELHWEDGFAIPVANQENKILEDQLAKLREEKSNLQDQL
FT                   HDYEERINSMTSHLKNVNQEFLFTQSLYKARESEIESEEHFKAIAERELGRVKNETQLL
FT                   EKEMAIIRERKSQMENNIFKTTQKLDDLKCQMNWDQQALEAWLEESAHKDSDSLTLQKY
FT                   SQQDDNKIRALTLQLEKLTMEYNEKRKLLDSELTETLSAQLELDKAAQDFRKIHLERQE
FT                   LIQQWENTIEQMQRRDQEIDNCALALSRIKQEAREKEGVVKEKIKFLENEVENNIEYER
FT                   KISVAERKVSKCRMDYQRHEGNRSQLKDELDTLKTTLNRTSSDLQALRKNISKVKKDIF
FT                   DETLRLQKLKHHNEVVKHKLKMITEKTLSIEEKATNMEDMLKEEEKGLKEVEVQLGIVK
FT                   DVLFKKVQELQNEIAKEKALVSEIEGTRSSLKHLNKQLHKLDFETLKQQEIMYSQDFYI
FT                   QQVERRMSRLKGEINSEEKQALEAKILELKKTMDEKKSTLSLLESQIKKLHNDLYFIKK
FT                   SNGKNNDEKESLMNKISELNLFIDRSEKELSKAKAVKEDMMIEDNLLKLQVKRARELLY
FT                   SKAEEVLSLEKRKQQLGKDMEERAEEIKVHKAMLTSQIRCVEQQRKTMRLKQGLHVCWT
FT                   R"
FT   assembly_gap    17848814..17848931
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    17879279..17879298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17885489..17885800
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    17886948..17887074
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(17887603..17918277)
FT                   /locus_tag="mCG_1051087"
FT                   /note="gene_id=mCG1051087.0"
FT   mRNA            complement(join(17887603..17887869,17891755..17891856,
FT                   17918031..17918277))
FT                   /locus_tag="mCG_1051087"
FT                   /product="mCG1051087"
FT                   /note="gene_id=mCG1051087.0 transcript_id=mCT194876.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(17887825..17887869,17891755..17891826))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051087"
FT                   /product="mCG1051087"
FT                   /note="gene_id=mCG1051087.0 transcript_id=mCT194876.0
FT                   protein_id=mCP115905.0"
FT                   /protein_id="EDL35032.1"
FT                   /translation="MLKSSFVQKEHHLQRRKGSSEPRERLHCKLSVYILGSQ"
FT   assembly_gap    17894997..17895031
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    17896632..17896651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17899210..17899229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17908332..17908451
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    17912810..17912829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17940839..17941047
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    17941884..17945210
FT                   /estimated_length=3327
FT                   /gap_type="unknown"
FT   assembly_gap    17946025..17946044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17954321..17954340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17956618..17956637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17958246..17958265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17971624..17971643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17987132..17987939
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    17988658..17988677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<17996238..18011585)
FT                   /locus_tag="mCG_140734"
FT                   /note="gene_id=mCG140734.0"
FT   mRNA            complement(join(<17996238..17996491,18011467..18011585))
FT                   /locus_tag="mCG_140734"
FT                   /product="mCG140734"
FT                   /note="gene_id=mCG140734.0 transcript_id=mCT171114.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(<17996238..17996375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140734"
FT                   /product="mCG140734"
FT                   /note="gene_id=mCG140734.0 transcript_id=mCT171114.0
FT                   protein_id=mCP94032.0"
FT                   /protein_id="EDL35033.1"
FT                   /translation="MRASEGTRLHHRAWLSHPDAPTARPGLCLLLISLICYWDRSYSFG
FT                   V"
FT   gene            complement(18022598..18023307)
FT                   /locus_tag="mCG_1049436"
FT                   /note="gene_id=mCG1049436.1"
FT   mRNA            complement(18022598..18023307)
FT                   /locus_tag="mCG_1049436"
FT                   /product="mCG1049436"
FT                   /note="gene_id=mCG1049436.1 transcript_id=mCT167140.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(18022843..18023289)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049436"
FT                   /product="mCG1049436"
FT                   /note="gene_id=mCG1049436.1 transcript_id=mCT167140.1
FT                   protein_id=mCP79491.0"
FT                   /db_xref="GOA:Q5M9P7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="MGI:MGI:1196368"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9P7"
FT                   /protein_id="EDL35034.1"
FT                   /translation="MSSEPPPPPLQPPTHQTSVGLLDTPRTRDRSPSPLRGNVVPSPLP
FT                   TRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE
FT                   GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVISN"
FT   gene            18037890..18087797
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /note="gene_id=mCG15249.1"
FT   mRNA            join(18037890..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18076096,18079659..18079862,18081946..18082146,
FT                   18082801..18082881,18085988..18086079,18086744..18087797)
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, transcript variant mCT14505"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT14505.1 created
FT                   on 21-AUG-2002"
FT   mRNA            join(18037894..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18075946,18076034..18076096,18079659..18079862,
FT                   18081946..18082146,18086744..18087164)
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, transcript variant mCT172170"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172170.0 created
FT                   on 21-AUG-2002"
FT   mRNA            join(18037901..18037951,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064431,
FT                   18087024..18087791)
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, transcript variant mCT172173"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172173.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(18037905..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18076096,18079659..18079862,18081946..18082146,
FT                   18082801..18082881,18085988..18086079,18086744..18086914)
FT                   /codon_start=1
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, isoform CRA_a"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT14505.1
FT                   protein_id=mCP3753.2 isoform=CRA_a"
FT                   /protein_id="EDL35035.1"
FT                   /translation="MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFN
FT                   EVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYN
FT                   EIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHP
FT                   ETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEE
FT                   FVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESAEAVKKARGFLEF
FT                   VEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGT
FT                   KESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGMGFRPSSTRGPEREKGYATD
FT                   ESTVSSVQGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDD
FT                   RETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQT
FT                   ADTDASESHHSTNRRRRSRRRRTDEDAVLMDGLTESDTASVNENGLDDSEKKPQRRNRS
FT                   RRRRFRGQAEDRQPVTVADYISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKA
FT                   INGPTSASGDEIPKLPRTLGEEKTKTLKEDSTQEAAVLNGVS"
FT   CDS             join(18037905..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18075946,18076034..18076096,18079659..18079862,
FT                   18081946..18082146,18086744..18086760)
FT                   /codon_start=1
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, isoform CRA_d"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172170.0
FT                   protein_id=mCP95091.0 isoform=CRA_d"
FT                   /protein_id="EDL35038.1"
FT                   /translation="MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFN
FT                   EVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYN
FT                   EIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHP
FT                   ETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEE
FT                   FVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESAEAVKKARGFLEF
FT                   VEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGT
FT                   KESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGY
FT                   GTNSELSNPSETESERKDELSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGP
FT                   RGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVL
FT                   MDGLTESDTASVNENGLGKRCD"
FT   mRNA            join(18037924..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18064406)
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, transcript variant mCT172172"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172172.0 created
FT                   on 21-AUG-2002"
FT   mRNA            join(18037928..18037955,18057401..18057453,
FT                   18058937..18059030,18063901..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18075946,18076034..18076096,18079659..18079862,
FT                   18081946..18082146,18085988..18086079,18086744..18087164)
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, transcript variant mCT172171"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172171.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(18063958..18063972,18064306..18064431,
FT                   18087024..18087077)
FT                   /codon_start=1
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, isoform CRA_e"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172173.0
FT                   protein_id=mCP95090.0 isoform=CRA_e"
FT                   /protein_id="EDL35039.1"
FT                   /translation="MMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCT
FT                   VDFLHLEFRKGRDPEEIIC"
FT   CDS             join(18063958..18063972,18064306..18064454,
FT                   18064835..18064928,18065506..18065622,18067027..18067197,
FT                   18067949..18068027,18072096..18072205,18074196..18074282,
FT                   18075889..18075946,18076034..18076096,18079659..18079862,
FT                   18081946..18082146,18085988..18086079,18086744..18086914)
FT                   /codon_start=1
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, isoform CRA_b"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172171.0
FT                   protein_id=mCP95092.0 isoform=CRA_b"
FT                   /protein_id="EDL35036.1"
FT                   /translation="MMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCT
FT                   VDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHL
FT                   RSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVP
FT                   GVTAIELDEDTGTFRIYGESAEAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEI
FT                   VDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRM
FT                   ERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLA
FT                   GEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTE
FT                   SDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGLTESDTASVNENGLVTVADYISR
FT                   AESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDEIPKLPRTLGEEK
FT                   TKTLKEDSTQEAAVLNGVS"
FT   CDS             18063958..18064161
FT                   /codon_start=1
FT                   /gene="Fxr1h"
FT                   /locus_tag="mCG_15249"
FT                   /product="fragile X mental retardation gene 1, autosomal
FT                   homolog, isoform CRA_c"
FT                   /note="gene_id=mCG15249.1 transcript_id=mCT172172.0
FT                   protein_id=mCP95089.0 isoform=CRA_c"
FT                   /protein_id="EDL35037.1"
FT                   /translation="MMKGEVSDCFPRRHLNSELLCPSPPIDRVNPLLTHSCIVNFNFVY
FT                   CQTPRILFSRIPQGYNYKGSCL"
FT   gene            complement(18073885..18099149)
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /note="gene_id=mCG15246.1"
FT   mRNA            complement(join(18073885..18075979,18096601..18096671,
FT                   18097031..18097110,18097910..18097983,18098057..18098108,
FT                   18099012..18099139))
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   transcript variant mCT181914"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT181914.0 created
FT                   on 15-APR-2003"
FT   CDS             complement(join(18075786..18075979,18096601..18096671,
FT                   18097031..18097110,18097910..18097983,18098057..18098108,
FT                   18099012..18099014))
FT                   /codon_start=1
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT181914.0
FT                   protein_id=mCP104836.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="MGI:MGI:1914963"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S1"
FT                   /protein_id="EDL35042.1"
FT                   /translation="MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAF
FT                   GGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGPLVEEGLKPI
FT                   PICRSCSSICRRSILSCSTSYDQNKNPFTVCVCVHSRAHTGIHTPVKPCETTM"
FT   mRNA            complement(join(18095111..18095350,18096601..18096671,
FT                   18097031..18097110,18097910..18097983,18098057..18098108,
FT                   18099012..18099149))
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   transcript variant mCT14502"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT14502.1 created
FT                   on 15-APR-2003"
FT   mRNA            complement(join(18095262..18096671,18097031..18097110,
FT                   18097910..18097983,18098057..18098108,18099012..18099149))
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   transcript variant mCT181913"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT181913.0 created
FT                   on 15-APR-2003"
FT   CDS             complement(join(18095280..18095350,18096601..18096671,
FT                   18097031..18097110,18097910..18097983,18098057..18098108,
FT                   18099012..18099014))
FT                   /codon_start=1
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT14502.1
FT                   protein_id=mCP3730.1 isoform=CRA_a"
FT                   /protein_id="EDL35040.1"
FT                   /translation="MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAF
FT                   GGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKIN
FT                   EAKDLLEGQAKK"
FT   CDS             complement(join(18096488..18096671,18097031..18097110,
FT                   18097910..18097983,18098057..18098108,18099012..18099014))
FT                   /codon_start=1
FT                   /gene="Dnajc19"
FT                   /locus_tag="mCG_15246"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 19,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15246.1 transcript_id=mCT181913.0
FT                   protein_id=mCP104835.0 isoform=CRA_b"
FT                   /protein_id="EDL35041.1"
FT                   /translation="MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAF
FT                   GGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGKQLLLLYWTV
FT                   NGIANSWCYECLCVSSFPVVDHIVVS"
FT   assembly_gap    18141108..18141127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18190075..18190094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18191172..18191191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18192409..18192428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18203471..18203490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18203669..18204537
FT                   /pseudo
FT                   /locus_tag="mCG_122957"
FT                   /note="gene_id=mCG122957.1"
FT   mRNA            18203669..18204537
FT                   /pseudo
FT                   /locus_tag="mCG_122957"
FT                   /note="gene_id=mCG122957.1 transcript_id=mCT124183.1
FT                   created on 21-AUG-2002"
FT   assembly_gap    18205973..18205992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18215704..18216038
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    18263162..18263301
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    18284023..18284226
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    18285701..18287181
FT                   /estimated_length=1481
FT                   /gap_type="unknown"
FT   assembly_gap    18295377..18295396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18324197..18324656
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    18386206..18390326
FT                   /estimated_length=4121
FT                   /gap_type="unknown"
FT   assembly_gap    18405782..18405801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18418906..18419079
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    18437429..18437456
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            complement(18449388..18457113)
FT                   /locus_tag="mCG_148199"
FT                   /note="gene_id=mCG148199.0"
FT   mRNA            complement(join(18449388..18450069,18452971..18457113))
FT                   /locus_tag="mCG_148199"
FT                   /product="mCG148199"
FT                   /note="gene_id=mCG148199.0 transcript_id=mCT188462.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(18454578..18455021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148199"
FT                   /product="mCG148199"
FT                   /note="gene_id=mCG148199.0 transcript_id=mCT188462.0
FT                   protein_id=mCP108127.0"
FT                   /protein_id="EDL35043.1"
FT                   /translation="MSFEEQVHTLQLCVLSITTTVHHFAVAMVTQPWQKQLNGDFILAH
FT                   SFRGTKPIMHGRHGGRSKRQANHIASTLRMWGQTQSFKASPLTLVAYFLFPRLSPLKAP
FT                   QSCKQLHQVEKKCSNMQVSGGHFTSKPQQSIRGTISHAVLPSC"
FT   assembly_gap    18460929..18461255
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    18486539..18486558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18493095..18493313
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    18507939..18508095
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    18512677..18512696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18514698..18514934
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    18522761..18523961
FT                   /estimated_length=1201
FT                   /gap_type="unknown"
FT   gene            18530513..18705986
FT                   /locus_tag="mCG_142516"
FT                   /note="gene_id=mCG142516.0"
FT   mRNA            join(18530513..18530606,18661752..18662033,
FT                   18699063..18699364,18705801..18705986)
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, transcript variant mCT180613"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180613.0
FT                   created on 19-JUN-2003"
FT   assembly_gap    18532575..18532594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18562794..18563336
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   mRNA            join(18582462..18582650,18582797..18582863,
FT                   18661752..18662033,18676585..18676691,18699063..18699191)
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, transcript variant mCT180616"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180616.0
FT                   created on 19-JUN-2003"
FT   gene            complement(<18587368..18594286)
FT                   /locus_tag="mCG_148193"
FT                   /note="gene_id=mCG148193.0"
FT   mRNA            complement(join(<18587368..18587911,18594036..18594286))
FT                   /locus_tag="mCG_148193"
FT                   /product="mCG148193"
FT                   /note="gene_id=mCG148193.0 transcript_id=mCT188456.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<18587368..18587588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148193"
FT                   /product="mCG148193"
FT                   /note="gene_id=mCG148193.0 transcript_id=mCT188456.0
FT                   protein_id=mCP108121.0"
FT                   /protein_id="EDL35049.1"
FT                   /translation="MRSEVGCAHELPPFPLHICLPSHQCTHSCITTEESQRYLLVHKWS
FT                   SGGPPSCTFCTPDHLLFSLSLESGKKKN"
FT   assembly_gap    18597063..18597274
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    18602271..18602290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18607310..18607329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18612369..18612421
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    18615941..18615960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18620689..18624411)
FT                   /locus_tag="mCG_60698"
FT                   /note="gene_id=mCG60698.2"
FT   mRNA            complement(join(18620689..18621092,18622785..18622816,
FT                   18622914..18623147,18624285..18624411))
FT                   /locus_tag="mCG_60698"
FT                   /product="mCG60698"
FT                   /note="gene_id=mCG60698.2 transcript_id=mCT60881.2 created
FT                   on 13-MAR-2003"
FT   CDS             complement(join(18620923..18621092,18622785..18622816,
FT                   18622914..18622987))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60698"
FT                   /product="mCG60698"
FT                   /note="gene_id=mCG60698.2 transcript_id=mCT60881.2
FT                   protein_id=mCP26832.2"
FT                   /protein_id="EDL35050.1"
FT                   /translation="MGEIHMDTCLPSSTHKAKTGNHMRRKMDDRTGAHPVAQVLGSMEA
FT                   EVHSLRLLYCGLSASSVKSMEAKNGHEEFLLWNSISQQLLQSREQA"
FT   assembly_gap    18626252..18626371
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    18629308..18630071
FT                   /estimated_length=764
FT                   /gap_type="unknown"
FT   assembly_gap    18649048..18649067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18659004..18659042
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   mRNA            join(18660557..18660657,18661752..18662033,
FT                   18699063..18701387)
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, transcript variant mCT180612"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180612.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(18661645..18662033,18699063..18699364,
FT                   18701447..18704242)
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, transcript variant mCT180611"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180611.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(18661690..18662033,18699063..18699254,
FT                   18701447..18701546,18704074..18704205)
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, transcript variant mCT180615"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180615.0
FT                   created on 19-JUN-2003"
FT   CDS             join(18661874..18662033,18676585..18676691,
FT                   18699063..18699116)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, isoform CRA_b"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180616.0
FT                   protein_id=mCP103538.0 isoform=CRA_b"
FT                   /protein_id="EDL35048.1"
FT                   /translation="MEKEGGSASSFNSFCPVRSDPAWADERLRSLHVQCFLPANQTATR
FT                   QHPDLAWSPRVQACSPKSENLCSWYTQKRSQATDILQKKALNSEIEPRNCTFLKIRLRE
FT                   SG"
FT   CDS             join(18661874..18662033,18699063..18699073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, isoform CRA_a"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180611.0
FT                   protein_id=mCP103533.0 isoform=CRA_a"
FT                   /protein_id="EDL35044.1"
FT                   /translation="MEKEGGSASSFNSFCPVRSDPAWADERLRSLHVQCFLPANQTATR
FT                   QHPDLAWSHRT"
FT   CDS             join(18661874..18662033,18699063..18699073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, isoform CRA_a"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180612.0
FT                   protein_id=mCP103534.0 isoform=CRA_a"
FT                   /protein_id="EDL35045.1"
FT                   /translation="MEKEGGSASSFNSFCPVRSDPAWADERLRSLHVQCFLPANQTATR
FT                   QHPDLAWSHRT"
FT   CDS             join(18661874..18662033,18699063..18699073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, isoform CRA_a"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180613.0
FT                   protein_id=mCP103535.0 isoform=CRA_a"
FT                   /protein_id="EDL35046.1"
FT                   /translation="MEKEGGSASSFNSFCPVRSDPAWADERLRSLHVQCFLPANQTATR
FT                   QHPDLAWSHRT"
FT   CDS             join(18661874..18662033,18699063..18699073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142516"
FT                   /product="mCG142516, isoform CRA_a"
FT                   /note="gene_id=mCG142516.0 transcript_id=mCT180615.0
FT                   protein_id=mCP103537.0 isoform=CRA_a"
FT                   /protein_id="EDL35047.1"
FT                   /translation="MEKEGGSASSFNSFCPVRSDPAWADERLRSLHVQCFLPANQTATR
FT                   QHPDLAWSHRT"
FT   gene            18673460..18675866
FT                   /gene="Sox2"
FT                   /locus_tag="mCG_15247"
FT                   /note="gene_id=mCG15247.1"
FT   mRNA            join(18673460..18674993,18675081..18675866)
FT                   /gene="Sox2"
FT                   /locus_tag="mCG_15247"
FT                   /product="SRY-box containing gene 2"
FT                   /note="gene_id=mCG15247.1 transcript_id=mCT14503.2 created
FT                   on 20-FEB-2003"
FT   CDS             18673823..18674782
FT                   /codon_start=1
FT                   /gene="Sox2"
FT                   /locus_tag="mCG_15247"
FT                   /product="SRY-box containing gene 2"
FT                   /note="gene_id=mCG15247.1 transcript_id=mCT14503.2
FT                   protein_id=mCP3737.0"
FT                   /db_xref="GOA:Q60I23"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR022097"
FT                   /db_xref="InterPro:IPR032643"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="MGI:MGI:98364"
FT                   /db_xref="UniProtKB/TrEMBL:Q60I23"
FT                   /protein_id="EDL35051.1"
FT                   /translation="MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKR
FT                   PMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHM
FT                   KEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYA
FT                   HMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGS
FT                   PTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLP
FT                   GAEVPEPAAPSRLHMAQHYQSGPVPGTAINGTLPLSHM"
FT   assembly_gap    18684905..18684925
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    18704300..18704384
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    18706965..18707215
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    18712686..18712705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18751665..18751684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18775133..18775367
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    18785362..18785416
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    18787339..18787358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18793577..18794440
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   gene            18795468..18805739
FT                   /locus_tag="mCG_148201"
FT                   /note="gene_id=mCG148201.0"
FT   mRNA            join(18795468..18795691,18804808..18805739)
FT                   /locus_tag="mCG_148201"
FT                   /product="mCG148201"
FT                   /note="gene_id=mCG148201.0 transcript_id=mCT188464.0
FT                   created on 13-JAN-2004"
FT   CDS             join(18795593..18795691,18804808..18804864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148201"
FT                   /product="mCG148201"
FT                   /note="gene_id=mCG148201.0 transcript_id=mCT188464.0
FT                   protein_id=mCP108129.0"
FT                   /protein_id="EDL35052.1"
FT                   /translation="MCTTHVLQFLWRPEEDLRGRQISRIQASQSCYKVAANLIKSTVRK
FT                   KHYPPP"
FT   assembly_gap    18796455..18797100
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    18814678..18814697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18824716..18824735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18826957..18827711
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    18829030..18829049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18831123..18831142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18870654..18876035
FT                   /estimated_length=5382
FT                   /gap_type="unknown"
FT   assembly_gap    18880319..18880338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18908340..18908379
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    18962358..18963035
FT                   /estimated_length=678
FT                   /gap_type="unknown"
FT   assembly_gap    18972653..18973672
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    18997968..19000594
FT                   /estimated_length=2627
FT                   /gap_type="unknown"
FT   assembly_gap    19002834..19002853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19004478..19004497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19006373..19006900
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    19009866..19010395
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    19028367..19029011
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    19032963..19033191
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    19050248..19050267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19058338..19058379
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    19062253..19062272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19069840..19070749
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    19074653..19074672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19077276..19077295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19078341..19078460
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    19099907..19099926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19103039..19103130
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    19122536..19122555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19150394..19150413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19199246..19199265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19202840..19203415
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    19233773..19233792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19242517..19242754
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    19250312..19252376
FT                   /estimated_length=2065
FT                   /gap_type="unknown"
FT   assembly_gap    19294362..19294660
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    19316802..19316821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19319922..19319941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19323438..19323457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19335792..19335811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19339323..19339558
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    19409153..19409172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19450695..19450714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19453920..19453939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19485537..19485556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19491838..19491977
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    19494568..19494655
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    19494961..19496294
FT                   /estimated_length=1334
FT                   /gap_type="unknown"
FT   assembly_gap    19500649..19500884
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    19515865..19516369
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    19520990..19521053
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    19526729..19526752
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(19553383..19554396)
FT                   /pseudo
FT                   /locus_tag="mCG_20275"
FT                   /note="gene_id=mCG20275.1"
FT   mRNA            complement(19553383..19554396)
FT                   /pseudo
FT                   /locus_tag="mCG_20275"
FT                   /note="gene_id=mCG20275.1 transcript_id=mCT19452.1 created
FT                   on 21-AUG-2002"
FT   assembly_gap    19570051..19570070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19570773..19571029
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    19587674..19587693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19593685..19715132)
FT                   /locus_tag="mCG_20277"
FT                   /note="gene_id=mCG20277.2"
FT   mRNA            complement(join(19593685..19593819,19633128..19633248,
FT                   19634146..19634315,19650974..19651232,19655357..19655518,
FT                   19655775..19655892,19674098..19674247,19677315..19677495,
FT                   19714938..19715132))
FT                   /locus_tag="mCG_20277"
FT                   /product="mCG20277, transcript variant mCT19453"
FT                   /note="gene_id=mCG20277.2 transcript_id=mCT19453.2 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(19593686..19593819,19633128..19633248,
FT                   19634146..19634315,19650974..19651232,19655357..19655518,
FT                   19655775..19655892,19674098..19674247,19677315..19677495,
FT                   19714938..19715130))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20277"
FT                   /product="mCG20277, isoform CRA_b"
FT                   /note="gene_id=mCG20277.2 transcript_id=mCT19453.2
FT                   protein_id=mCP3743.2 isoform=CRA_b"
FT                   /protein_id="EDL35054.1"
FT                   /translation="MPDSTAAKELLASAEGLMLHSSQGFVGPSLVLVFTGFLSRKETLY
FT                   GVSLLEFCHQLAHTGSQATGGDLNQEYLIFFYTETLENEDTGGIYQTLLCQGPVELTRG
FT                   KKRNKRHLSLFNDVLVVSNNLNKKRFKINCIIPLNYLCTVDDVDLDNMNEMCTCKTIYL
FT                   FWPTGNFLATFWGSVPHQDQECPAPTFNTGKLFGKDLGSICHEGKWPTIIVDILSLIEE
FT                   KGPKTEGIFMISPNVKSCKILKDKFESGEEVDIKKYSVHEIAWILKISLVTFMIENSPK
FT                   IFGIDMVSVSYETSLFHPQGAKASCSQNTPPNIGNIQETEYGLSSCSNGRTRMPGHDAL
FT                   AISPAASLSYEGIIALVITRLEPTANIMGLKGFKVTVVQRLPIASTKKDKLMLAPDWST
FT                   APLARVETWESDMSIIQIVIDNCGDIFGDNDHIICNDNQKRSDDIKTLLNSAVPDWLSS
FT                   SVSLIFRLSGSLLFGPHVEVASTAVQPPDVYAEVLRQ"
FT   assembly_gap    19596839..19596858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19607654..19607768
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    19612516..19612741
FT                   /estimated