
ID   CH466529; SV 2; linear; genomic DNA; CON; MUS; 49370576 BP.
AC   CH466529;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
DE   Mus musculus 232000009782436 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
RN   [1]
RP   1-49370576
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-49370576
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-49370576
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; e09d7d73ef894d5eebf7ca80ed287350.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000213.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000148; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000568; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001166; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001847; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002748; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004814; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004821; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004951; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018143; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018263; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019494; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023078; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023348; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025532; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025825; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029279; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029283; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029298; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029306; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029335; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029388; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029390; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029404; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029406; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029422; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029446; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029449; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029491; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029499; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029503; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029518; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029545; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029586; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029595; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029597; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029602; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029621; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029623; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029699; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029710; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029711; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032623; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032690; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032959; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033794; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034110; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034118; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034173; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034528; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035266; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037221; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037563; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038690; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039296; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040013; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040532; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042096; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044060; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044197; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045348; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045502; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046658; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046709; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046959; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047182; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047501; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051306; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051391; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052776; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053293; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053765; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055725; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056966; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057315; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058291; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058558; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060371; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061979; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063406; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063430; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063919; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066861; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067010; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074817; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000081683; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000083012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000106631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005077; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031492; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031574; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031627; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031731; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036951; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041466; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041543; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044002; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044833; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048957; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049009; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051293; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066052; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066540; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066708; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071881; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072750; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077485; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080537; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080732; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100489; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100874; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110897; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112707; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000156722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000195985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202756; mus_musculus.
CC   On Sep 6, 2005 this sequence version replaced gi:70980451.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..49370576
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1515
FT                   /pseudo
FT                   /locus_tag="mCG_1030360"
FT                   /note="gene_id=mCG1030360.1"
FT   mRNA            1..1515
FT                   /pseudo
FT                   /locus_tag="mCG_1030360"
FT                   /note="gene_id=mCG1030360.1 transcript_id=mCT148064.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    20684..20703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    53184..53203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    54480..54499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    65559..65602
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    76636..77826
FT                   /estimated_length=1191
FT                   /gap_type="unknown"
FT   assembly_gap    90835..90998
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    105970..105989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    118513..122792
FT                   /estimated_length=4280
FT                   /gap_type="unknown"
FT   assembly_gap    132027..132129
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    135419..135551
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    141710..141729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            147920..152049
FT                   /gene="Cxcl13"
FT                   /locus_tag="mCG_8493"
FT                   /note="gene_id=mCG8493.1"
FT   mRNA            join(147920..148012,149613..149745,150862..150942,
FT                   151195..152049)
FT                   /gene="Cxcl13"
FT                   /locus_tag="mCG_8493"
FT                   /product="chemokine (C-X-C motif) ligand 13"
FT                   /note="gene_id=mCG8493.1 transcript_id=mCT7452.0 created on
FT                   06-NOV-2002"
FT   CDS             join(147952..148012,149613..149745,150862..150942,
FT                   151195..151249)
FT                   /codon_start=1
FT                   /gene="Cxcl13"
FT                   /locus_tag="mCG_8493"
FT                   /product="chemokine (C-X-C motif) ligand 13"
FT                   /note="gene_id=mCG8493.1 transcript_id=mCT7452.0
FT                   protein_id=mCP13046.1"
FT                   /db_xref="GOA:Q3U1E8"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="MGI:MGI:1888499"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1E8"
FT                   /protein_id="EDL20365.1"
FT                   KRRAA"
FT   gene            164920..166931
FT                   /pseudo
FT                   /locus_tag="mCG_8495"
FT                   /note="gene_id=mCG8495.2"
FT   mRNA            164920..166931
FT                   /pseudo
FT                   /locus_tag="mCG_8495"
FT                   /note="gene_id=mCG8495.2 transcript_id=mCT7443.2 created on
FT                   10-MAR-2003"
FT   assembly_gap    173199..173218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    204556..211496
FT                   /estimated_length=6941
FT                   /gap_type="unknown"
FT   assembly_gap    234911..234930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    243155..244404
FT                   /estimated_length=1250
FT                   /gap_type="unknown"
FT   gene            complement(259149..>346824)
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /note="gene_id=mCG8494.2"
FT   mRNA            complement(join(259149..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315903,318761..318882,
FT                   346463..346602))
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   transcript variant mCT7447"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT7447.2 created on
FT                   06-JAN-2003"
FT   mRNA            complement(join(260267..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315899,318761..318882,
FT                   346536..>346601))
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   transcript variant mCT191378"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT191378.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(261477..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315903,318761..318882,
FT                   346781..>346824))
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   transcript variant mCT191377"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT191377.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(261858..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315903,318761..318882,
FT                   346781..>346824))
FT                   /codon_start=1
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT191377.0
FT                   protein_id=mCP112351.0 isoform=CRA_a"
FT                   /protein_id="EDL20362.1"
FT   CDS             complement(join(261858..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315903,318761..318872))
FT                   /codon_start=1
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT7447.2
FT                   protein_id=mCP13055.2 isoform=CRA_c"
FT                   /protein_id="EDL20364.1"
FT   CDS             complement(join(261858..262070,264611..264813,
FT                   267548..267775,270821..270972,276257..276411,
FT                   278833..278990,282917..282985,290887..290976,
FT                   313601..313686,315717..315899,318761..>318852))
FT                   /codon_start=1
FT                   /gene="Cnot6l"
FT                   /locus_tag="mCG_8494"
FT                   /product="CCR4-NOT transcription complex, subunit 6-like,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8494.2 transcript_id=mCT191378.0
FT                   protein_id=mCP112352.0 isoform=CRA_b"
FT                   /protein_id="EDL20363.1"
FT   assembly_gap    307362..310595
FT                   /estimated_length=3234
FT                   /gap_type="unknown"
FT   assembly_gap    316129..316280
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    346124..346254
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    346825..347071
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    368346..368439
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    387455..387480
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   gene            394250..450676
FT                   /gene="Mrpl1"
FT                   /locus_tag="mCG_8498"
FT                   /note="gene_id=mCG8498.2"
FT   mRNA            join(394250..394329,394845..394957,398551..398674,
FT                   408521..408782,411035..411118,412430..412501,
FT                   416431..416542,423581..423687,446812..446893,
FT                   448951..450676)
FT                   /gene="Mrpl1"
FT                   /locus_tag="mCG_8498"
FT                   /product="mitochondrial ribosomal protein L1"
FT                   /note="gene_id=mCG8498.2 transcript_id=mCT7446.2 created on
FT                   12-DEC-2002"
FT   CDS             join(398586..398674,408521..408782,411035..411118,
FT                   412430..412501,416431..416542,423581..423687,
FT                   446812..446893,448951..449087)
FT                   /codon_start=1
FT                   /gene="Mrpl1"
FT                   /locus_tag="mCG_8498"
FT                   /product="mitochondrial ribosomal protein L1"
FT                   /note="gene_id=mCG8498.2 transcript_id=mCT7446.2
FT                   protein_id=mCP13049.2"
FT                   /protein_id="EDL20361.1"
FT   assembly_gap    468108..473412
FT                   /estimated_length=5305
FT                   /gap_type="unknown"
FT   assembly_gap    478601..479903
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    482945..482964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    513618..513637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    534752..535031
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    544315..544334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            554744..>777240
FT                   /locus_tag="mCG_127562"
FT                   /note="gene_id=mCG127562.1"
FT   mRNA            join(554744..555425,566606..566637,705836..705943,
FT                   712192..712284,720564..720723,722281..722414,
FT                   730052..730135,732114..732215,732495..732686,
FT                   737211..737300,745459..745494,746899..747046,
FT                   748447..748590,750377..750511,765546..765689,
FT                   773115..773255,775221..775361,776957..>777240)
FT                   /locus_tag="mCG_127562"
FT                   /product="mCG127562"
FT                   /note="gene_id=mCG127562.1 transcript_id=mCT128849.1
FT                   created on 14-MAR-2003"
FT   CDS             join(555353..555425,566606..566637,705836..705943,
FT                   712192..712284,720564..720723,722281..722414,
FT                   730052..730135,732114..732215,732495..732686,
FT                   737211..737300,745459..745494,746899..747046,
FT                   748447..748590,750377..750511,765546..765689,
FT                   773115..773255,775221..775361,776957..777240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127562"
FT                   /product="mCG127562"
FT                   /note="gene_id=mCG127562.1 transcript_id=mCT128849.1
FT                   protein_id=mCP63405.1"
FT                   /protein_id="EDL20359.1"
FT   assembly_gap    573705..574215
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    610550..611125
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    621780..621799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(636849..638184)
FT                   /locus_tag="mCG_147659"
FT                   /note="gene_id=mCG147659.0"
FT   mRNA            complement(join(636849..637233,638088..638184))
FT                   /locus_tag="mCG_147659"
FT                   /product="mCG147659"
FT                   /note="gene_id=mCG147659.0 transcript_id=mCT187922.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(637011..637178)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147659"
FT                   /product="mCG147659"
FT                   /note="gene_id=mCG147659.0 transcript_id=mCT187922.0
FT                   protein_id=mCP109050.0"
FT                   /protein_id="EDL20360.1"
FT                   APRSLGFVCF"
FT   assembly_gap    659940..659959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    661717..661736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    668783..668802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    691241..691260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    695771..695790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    742235..742800
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    755232..755508
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    756875..757610
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    765337..765356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    788959..789243
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    803299..803318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <869016..>885159
FT                   /locus_tag="mCG_127561"
FT                   /note="gene_id=mCG127561.1"
FT   mRNA            join(<869016..869118,870183..870308,872546..872793,
FT                   877795..877943,878139..878301,879780..879915,
FT                   884942..>885159)
FT                   /locus_tag="mCG_127561"
FT                   /product="mCG127561"
FT                   /note="gene_id=mCG127561.1 transcript_id=mCT128848.1
FT                   created on 14-MAR-2003"
FT   CDS             join(869016..869118,870183..870308,872546..872793,
FT                   877795..877943,878139..878301,879780..879915,
FT                   884942..885159)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127561"
FT                   /product="mCG127561"
FT                   /note="gene_id=mCG127561.1 transcript_id=mCT128848.1
FT                   protein_id=mCP63387.1"
FT                   /protein_id="EDL20358.1"
FT   gene            <912640..959213
FT                   /locus_tag="mCG_142611"
FT                   /note="gene_id=mCG142611.0"
FT   mRNA            join(<912640..912794,914443..914599,916716..916962,
FT                   918199..918663,919007..919154,923816..924021,
FT                   927246..927402,929767..929967,932429..932616,
FT                   933881..934156,936928..937160,939332..939492,
FT                   942732..942946,943961..944111,945124..945231,
FT                   946055..946214,947041..947157,951115..951281,
FT                   952519..952724,954512..954658,955668..959213)
FT                   /locus_tag="mCG_142611"
FT                   /product="mCG142611"
FT                   /note="gene_id=mCG142611.0 transcript_id=mCT181168.0
FT                   created on 14-MAR-2003"
FT   CDS             join(<918577..918663,919007..919154,923816..924021,
FT                   927246..927402,929767..929967,932429..932616,
FT                   933881..934156,936928..937160,939332..939492,
FT                   942732..942946,943961..944111,945124..945231,
FT                   946055..946214,947041..947157,951115..951281,
FT                   952519..952724,954512..954658,955668..956261)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142611"
FT                   /product="mCG142611"
FT                   /note="gene_id=mCG142611.0 transcript_id=mCT181168.0
FT                   protein_id=mCP104090.0"
FT                   /protein_id="EDL20357.1"
FT                   LQDGTEV"
FT   assembly_gap    918879..918898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    939680..939869
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    940717..940749
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    946358..946403
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    965586..965605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            965725..1018076
FT                   /gene="Anxa3"
FT                   /locus_tag="mCG_8497"
FT                   /note="gene_id=mCG8497.1"
FT   mRNA            join(965725..965869,969738..969790,983374..983461,
FT                   985151..985245,988645..988758,992716..992806,
FT                   997201..997280,1000661..1000717,1001006..1001099,
FT                   1002662..1002816,1010399..1010521,1017609..1018076)
FT                   /gene="Anxa3"
FT                   /locus_tag="mCG_8497"
FT                   /product="annexin A3"
FT                   /note="gene_id=mCG8497.1 transcript_id=mCT7445.2 created on
FT                   18-SEP-2002"
FT   assembly_gap    968596..968871
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   CDS             join(969776..969790,983374..983461,985151..985245,
FT                   988645..988758,992716..992806,997201..997280,
FT                   1000661..1000717,1001006..1001099,1002662..1002816,
FT                   1010399..1010521,1017609..1017668)
FT                   /codon_start=1
FT                   /gene="Anxa3"
FT                   /locus_tag="mCG_8497"
FT                   /product="annexin A3"
FT                   /note="gene_id=mCG8497.1 transcript_id=mCT7445.2
FT                   protein_id=mCP13048.2"
FT                   /protein_id="EDL20356.1"
FT   assembly_gap    975329..975373
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1006373..1007581
FT                   /estimated_length=1209
FT                   /gap_type="unknown"
FT   assembly_gap    1018835..1019145
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   gene            <1021326..1024774
FT                   /locus_tag="mCG_1030778"
FT                   /note="gene_id=mCG1030778.0"
FT   mRNA            join(<1021326..1021502,1024296..1024774)
FT                   /locus_tag="mCG_1030778"
FT                   /product="mCG1030778"
FT                   /note="gene_id=mCG1030778.0 transcript_id=mCT148482.0
FT                   created on 14-MAR-2003"
FT   CDS             join(<1021402..1021502,1024296..1024488)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030778"
FT                   /product="mCG1030778"
FT                   /note="gene_id=mCG1030778.0 transcript_id=mCT148482.0
FT                   protein_id=mCP62741.0"
FT                   /protein_id="EDL20355.1"
FT   assembly_gap    1023831..1023850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1025036..1025055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1033297..1033320
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1051821..1051840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1053075..1053094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1053639..1079029
FT                   /locus_tag="mCG_144687"
FT                   /note="gene_id=mCG144687.0"
FT   mRNA            join(<1053639..1056131,1056150..1056813,1078985..1079029)
FT                   /locus_tag="mCG_144687"
FT                   /product="mCG144687"
FT                   /note="gene_id=mCG144687.0 transcript_id=mCT184111.0
FT                   created on 05-JUN-2003"
FT   CDS             <1055708..1056037
FT                   /codon_start=1
FT                   /locus_tag="mCG_144687"
FT                   /product="mCG144687"
FT                   /note="gene_id=mCG144687.0 transcript_id=mCT184111.0
FT                   protein_id=mCP105424.0"
FT                   /protein_id="EDL20354.1"
FT                   ATRLP"
FT   assembly_gap    1069114..1069133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1077936..1078079
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            <1085149..1109129
FT                   /locus_tag="mCG_57148"
FT                   /note="gene_id=mCG57148.2"
FT   mRNA            join(<1085149..1085193,1095992..1096046)
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, transcript variant mCT181174"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT181174.0 created
FT                   on 14-MAR-2003"
FT   CDS             join(<1085151..1085193,1095992..1096038)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, isoform CRA_b"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT181174.0
FT                   protein_id=mCP104096.0 isoform=CRA_b"
FT                   /protein_id="EDL20352.1"
FT                   /translation="SGCSSSFFKPPLKPQPTRLSATPCSLSGV"
FT   assembly_gap    1089090..1089109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1093255..1093735
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   mRNA            join(<1095473..1095584,1095992..1096070,1108906..1109129)
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, transcript variant mCT57331"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT57331.2 created
FT                   on 14-MAR-2003"
FT   mRNA            join(<1095474..1095584,1095992..1096075,1108913..1109005)
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, transcript variant mCT181173"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT181173.0 created
FT                   on 14-MAR-2003"
FT   CDS             join(<1095489..1095584,1095992..1096070,1108906..1108955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, isoform CRA_c"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT57331.2
FT                   protein_id=mCP34554.1 isoform=CRA_c"
FT                   /protein_id="EDL20353.1"
FT   CDS             join(<1095489..1095584,1095992..1096075,1108913..1108930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57148"
FT                   /product="mCG57148, isoform CRA_a"
FT                   /note="gene_id=mCG57148.2 transcript_id=mCT181173.0
FT                   protein_id=mCP104095.0 isoform=CRA_a"
FT                   /protein_id="EDL20351.1"
FT   assembly_gap    1099619..1099638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1100635..1100739
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1108423..1108442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1137828..1137963
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    1138172..1138380
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    1139005..1139034
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1149769..1149788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1151327..1151346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1152417..1152436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1153637..1153656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1174885..1175120
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   gene            1175121..1268949
FT                   /locus_tag="mCG_127566"
FT                   /note="gene_id=mCG127566.1"
FT   mRNA            join(1175121..1175486,1205465..1205583,1208802..1208907,
FT                   1214607..1214749,1216134..1216255,1218386..1218467,
FT                   1222747..1222879,1230810..1230913,1232566..1232645,
FT                   1234580..1234740,1239113..1239363,1242331..1242519,
FT                   1245901..1246058,1252135..1252245,1264645..1268949)
FT                   /locus_tag="mCG_127566"
FT                   /product="mCG127566, transcript variant mCT128853"
FT                   /note="gene_id=mCG127566.1 transcript_id=mCT128853.1
FT                   created on 06-NOV-2002"
FT   mRNA            join(1175121..1175486,1205465..1205583,1208802..1208907,
FT                   1214607..1214749,1216134..1216255,1218386..1218467,
FT                   1222747..1222879,1230810..1230913,1232563..1232645,
FT                   1234580..1234740,1239113..1239363,1242330..1242519,
FT                   1245906..1246156)
FT                   /locus_tag="mCG_127566"
FT                   /product="mCG127566, transcript variant mCT175377"
FT                   /note="gene_id=mCG127566.1 transcript_id=mCT175377.0
FT                   created on 06-NOV-2002"
FT   CDS             join(1175318..1175486,1205465..1205583,1208802..1208907,
FT                   1214607..1214749,1216134..1216255,1218386..1218467,
FT                   1222747..1222879,1230810..1230913,1232563..1232645,
FT                   1234580..1234740,1239113..1239363,1242330..1242519,
FT                   1245906..1246096)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127566"
FT                   /product="mCG127566, isoform CRA_b"
FT                   /note="gene_id=mCG127566.1 transcript_id=mCT175377.0
FT                   protein_id=mCP98296.0 isoform=CRA_b"
FT                   /protein_id="EDL20350.1"
FT   CDS             join(1175318..1175486,1205465..1205583,1208802..1208907,
FT                   1214607..1214749,1216134..1216255,1218386..1218467,
FT                   1222747..1222879,1230810..1230913,1232566..1232645,
FT                   1234580..1234740,1239113..1239363,1242331..1242519,
FT                   1245901..1245912)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127566"
FT                   /product="mCG127566, isoform CRA_a"
FT                   /note="gene_id=mCG127566.1 transcript_id=mCT128853.1
FT                   protein_id=mCP62312.1 isoform=CRA_a"
FT                   /protein_id="EDL20349.1"
FT   assembly_gap    1180766..1180785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1183955..1184322
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    1197313..1197738
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    1200371..1200390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1205163..1205214
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    1210477..1210530
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1240495..1241803
FT                   /estimated_length=1309
FT                   /gap_type="unknown"
FT   assembly_gap    1254481..1254552
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(1260220..1289587)
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /note="gene_id=mCG7298.2"
FT   mRNA            complement(join(1260220..1260499,1273815..1273963,
FT                   1275380..1275470,1277447..1277644,1281352..1281507,
FT                   1286148..1286310,1289241..1289551))
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   transcript variant mCT6404"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT6404.1 created on
FT                   17-MAR-2003"
FT   mRNA            complement(join(1266051..1266066,1273815..1273963,
FT                   1275380..1275470,1277447..1277644,1281352..1281507,
FT                   1286148..1286310,1289241..1289587))
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   transcript variant mCT181390"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT181390.0 created
FT                   on 17-MAR-2003"
FT   assembly_gap    1273335..1273354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1273821..1273963,1275380..1275470,
FT                   1277447..1277644,1281352..1281507,1286148..1286310,
FT                   1289241..1289425))
FT                   /codon_start=1
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT181390.0
FT                   protein_id=mCP104312.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VAZ2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:2679683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VAZ2"
FT                   /protein_id="EDL20346.1"
FT   CDS             complement(join(1273821..1273963,1275380..1275470,
FT                   1277447..1277644,1281352..1281507,1286148..1286310,
FT                   1289241..1289425))
FT                   /codon_start=1
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT6404.1
FT                   protein_id=mCP5838.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VAZ2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:2679683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VAZ2"
FT                   /protein_id="EDL20348.1"
FT   mRNA            complement(join(<1275425..1275470,1277447..1277581,
FT                   1281352..1281507,1286148..1286310,1289241..1289426))
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   transcript variant mCT181391"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT181391.0 created
FT                   on 17-MAR-2003"
FT   CDS             complement(join(<1275425..1275470,1277447..1277581,
FT                   1281352..1281507,1286148..1286310,1289241..1289425))
FT                   /codon_start=1
FT                   /gene="Paqr3"
FT                   /locus_tag="mCG_7298"
FT                   /product="progestin and adipoQ receptor family member III,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7298.2 transcript_id=mCT181391.0
FT                   protein_id=mCP104313.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0G2JER4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:2679683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JER4"
FT                   /protein_id="EDL20347.1"
FT                   YVIALL"
FT   assembly_gap    1278314..1278628
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    1289714..1289733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1312886..1312928
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            <1321035..>1327834
FT                   /locus_tag="mCG_145309"
FT                   /note="gene_id=mCG145309.0"
FT   mRNA            join(<1321035..1321195,1325061..1325749,1326008..>1327834)
FT                   /locus_tag="mCG_145309"
FT                   /product="mCG145309"
FT                   /note="gene_id=mCG145309.0 transcript_id=mCT184733.0
FT                   created on 23-JUN-2003"
FT   CDS             <1327605..>1327834
FT                   /codon_start=1
FT                   /locus_tag="mCG_145309"
FT                   /product="mCG145309"
FT                   /note="gene_id=mCG145309.0 transcript_id=mCT184733.0
FT                   protein_id=mCP105427.0"
FT                   /protein_id="EDL20345.1"
FT   assembly_gap    1338451..1340791
FT                   /estimated_length=2341
FT                   /gap_type="unknown"
FT   assembly_gap    1348813..1348832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1373873..1386651
FT                   /locus_tag="mCG_1030770"
FT                   /note="gene_id=mCG1030770.1"
FT   mRNA            join(1373873..1373973,1385640..1386651)
FT                   /locus_tag="mCG_1030770"
FT                   /product="mCG1030770"
FT                   /note="gene_id=mCG1030770.1 transcript_id=mCT148474.1
FT                   created on 18-APR-2003"
FT   CDS             join(1373874..1373973,1385640..1385695)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030770"
FT                   /product="mCG1030770"
FT                   /note="gene_id=mCG1030770.1 transcript_id=mCT148474.1
FT                   protein_id=mCP63333.1"
FT                   /protein_id="EDL20344.1"
FT                   LTQTDA"
FT   assembly_gap    1391051..1391078
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1393647..1393700
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1419665..1419684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1442468..1442487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1459887..1460229
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    1462694..1462713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1472620..1472785
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    1560273..1561130
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   gene            1572747..1822002
FT                   /locus_tag="mCG_1030451"
FT                   /note="gene_id=mCG1030451.1"
FT   mRNA            join(1572747..1572838,1575678..1575803,1614817..1614877,
FT                   1725403..1725454,1821763..1822002)
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, transcript variant mCT181355"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT181355.0
FT                   created on 18-APR-2003"
FT   mRNA            join(1572770..1572838,1575678..1575803,1614817..1614877,
FT                   1725403..1725454,1734444..1734561,1743859..1744061,
FT                   1762176..1762245,1765810..1766835)
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, transcript variant mCT148155"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT148155.1
FT                   created on 18-APR-2003"
FT   mRNA            join(1572777..1572838,1575678..1575803,1762176..1762245,
FT                   1765810..1766835)
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, transcript variant mCT181356"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT181356.0
FT                   created on 18-APR-2003"
FT   gene            complement(1636063..1637910)
FT                   /gene="Gk2"
FT                   /locus_tag="mCG_7297"
FT                   /note="gene_id=mCG7297.0"
FT   mRNA            complement(1636063..1637910)
FT                   /gene="Gk2"
FT                   /locus_tag="mCG_7297"
FT                   /product="glycerol kinase 2"
FT                   /note="gene_id=mCG7297.0 transcript_id=mCT6399.0 created on
FT                   06-NOV-2002"
FT   CDS             complement(1636215..1637879)
FT                   /codon_start=1
FT                   /gene="Gk2"
FT                   /locus_tag="mCG_7297"
FT                   /product="glycerol kinase 2"
FT                   /note="gene_id=mCG7297.0 transcript_id=mCT6399.0
FT                   protein_id=mCP5837.1"
FT                   /protein_id="EDL20343.1"
FT   assembly_gap    1648116..1648135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1651032..1651051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1668012..1670581
FT                   /estimated_length=2570
FT                   /gap_type="unknown"
FT   assembly_gap    1671358..1673666
FT                   /estimated_length=2309
FT                   /gap_type="unknown"
FT   assembly_gap    1704566..1704585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1705652..1705671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1725434..1725454,1821763..1821990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, isoform CRA_b"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT181355.0
FT                   protein_id=mCP104278.0 isoform=CRA_b"
FT                   /protein_id="EDL20342.1"
FT   assembly_gap    1737179..1737198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1739197..1739599
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    1740448..1740749
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    1747253..1747272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1750157..1750176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             1766464..1766691
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, isoform CRA_a"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT148155.1
FT                   protein_id=mCP63247.1 isoform=CRA_a"
FT                   /protein_id="EDL20340.1"
FT   CDS             1766464..1766691
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030451"
FT                   /product="mCG1030451, isoform CRA_a"
FT                   /note="gene_id=mCG1030451.1 transcript_id=mCT181356.0
FT                   protein_id=mCP104277.0 isoform=CRA_a"
FT                   /protein_id="EDL20341.1"
FT   assembly_gap    1794901..1794920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802515..1802534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1823023..1823042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1833348..1833448
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    1855637..1855656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1859120..1859139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1901622..1901831
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    1902764..1903048
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    1932330..1934536
FT                   /estimated_length=2207
FT                   /gap_type="unknown"
FT   assembly_gap    1966625..1967821
FT                   /estimated_length=1197
FT                   /gap_type="unknown"
FT   assembly_gap    1982431..1982450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1983634..1998447
FT                   /estimated_length=14814
FT                   /gap_type="unknown"
FT   assembly_gap    1999337..1999356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2006431..2006634
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    2037940..2038202
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   gene            complement(2074153..>2178484)
FT                   /locus_tag="mCG_142649"
FT                   /note="gene_id=mCG142649.0"
FT   mRNA            complement(join(2074153..2076065,2127475..2127555,
FT                   2127791..2127955,2137609..2137704,2138533..2138574,
FT                   2149945..2150040,2155018..2155096,2164692..2164761,
FT                   2166955..2167053,2169324..2169384,2178388..>2178484))
FT                   /locus_tag="mCG_142649"
FT                   /product="mCG142649"
FT                   /note="gene_id=mCG142649.0 transcript_id=mCT181370.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(2076027..2076065,2127475..2127555,
FT                   2127791..2127955,2137609..2137704,2138533..2138574,
FT                   2149945..2150040,2155018..2155096,2164692..2164761,
FT                   2166955..2167053,2169324..>2169384))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142649"
FT                   /product="mCG142649"
FT                   /note="gene_id=mCG142649.0 transcript_id=mCT181370.0
FT                   protein_id=mCP104292.1"
FT                   /protein_id="EDL20339.1"
FT   assembly_gap    2079764..2079877
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    2156253..2156367
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   gene            complement(2169325..2205879)
FT                   /locus_tag="mCG_126758"
FT                   /note="gene_id=mCG126758.1"
FT   mRNA            complement(join(2169325..2169377,2185604..2185690,
FT                   2186439..2186507,2186648..2186755,2187242..2187323,
FT                   2202544..2202615,2204657..2204728,2205493..2205879))
FT                   /locus_tag="mCG_126758"
FT                   /product="mCG126758"
FT                   /note="gene_id=mCG126758.1 transcript_id=mCT128033.1
FT                   created on 17-MAR-2003"
FT   CDS             complement(join(2169348..2169377,2185604..2185690,
FT                   2186439..2186507,2186648..2186755,2187242..2187323,
FT                   2202544..2202615,2204657..2204728,2205493..2205644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126758"
FT                   /product="mCG126758"
FT                   /note="gene_id=mCG126758.1 transcript_id=mCT128033.1
FT                   protein_id=mCP62907.1"
FT                   /protein_id="EDL20338.1"
FT                   N"
FT   assembly_gap    2177642..2177661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2192701..2192954
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    2204861..2204880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2220343..2221081
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    2245443..2245462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2257572..2257591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2274180..2274234
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2285333..2298912
FT                   /estimated_length=13580
FT                   /gap_type="unknown"
FT   assembly_gap    2299916..2300544
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    2310738..2310765
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            2325939..2326934
FT                   /pseudo
FT                   /locus_tag="mCG_16635"
FT                   /note="gene_id=mCG16635.2"
FT   mRNA            2325939..2326934
FT                   /pseudo
FT                   /locus_tag="mCG_16635"
FT                   /note="gene_id=mCG16635.2 transcript_id=mCT13861.2 created
FT                   on 17-MAR-2003"
FT   assembly_gap    2336271..2336503
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            2353643..2361537
FT                   /gene="Prdm8"
FT                   /locus_tag="mCG_16632"
FT                   /note="gene_id=mCG16632.2"
FT   mRNA            join(2353643..2353866,2356051..2356271,2357223..2357451,
FT                   2358545..2360620,2360725..2361537)
FT                   /gene="Prdm8"
FT                   /locus_tag="mCG_16632"
FT                   /product="PR domain containing 8"
FT                   /note="gene_id=mCG16632.2 transcript_id=mCT13857.2 created
FT                   on 17-MAR-2003"
FT   CDS             join(2356053..2356271,2357223..2357451,2358545..2359221)
FT                   /codon_start=1
FT                   /gene="Prdm8"
FT                   /locus_tag="mCG_16632"
FT                   /product="PR domain containing 8"
FT                   /note="gene_id=mCG16632.2 transcript_id=mCT13857.2
FT                   protein_id=mCP5849.2"
FT                   /protein_id="EDL20337.1"
FT   assembly_gap    2357741..2358544
FT                   /estimated_length=804
FT                   /gap_type="unknown"
FT   assembly_gap    2360621..2360724
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2376509..2377057
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    2402268..2403473
FT                   /estimated_length=1206
FT                   /gap_type="unknown"
FT   assembly_gap    2412732..2412788
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            2419454..2442254
FT                   /gene="Fgf5"
FT                   /locus_tag="mCG_16638"
FT                   /note="gene_id=mCG16638.2"
FT   mRNA            join(2419454..2419965,2427163..2427266,2440442..2442254)
FT                   /gene="Fgf5"
FT                   /locus_tag="mCG_16638"
FT                   /product="fibroblast growth factor 5, transcript variant
FT                   mCT13864"
FT                   /note="gene_id=mCG16638.2 transcript_id=mCT13864.2 created
FT                   on 07-APR-2003"
FT   CDS             join(2419617..2419965,2427163..2427266,2440442..2440783)
FT                   /codon_start=1
FT                   /gene="Fgf5"
FT                   /locus_tag="mCG_16638"
FT                   /product="fibroblast growth factor 5, isoform CRA_a"
FT                   /note="gene_id=mCG16638.2 transcript_id=mCT13864.2
FT                   protein_id=mCP5847.2 isoform=CRA_a"
FT                   /protein_id="EDL20335.1"
FT   mRNA            join(<2419617..2419965,2440442..2440692)
FT                   /gene="Fgf5"
FT                   /locus_tag="mCG_16638"
FT                   /product="fibroblast growth factor 5, transcript variant
FT                   mCT191422"
FT                   /note="gene_id=mCG16638.2 transcript_id=mCT191422.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2419617..2419965,2440442..2440458)
FT                   /codon_start=1
FT                   /gene="Fgf5"
FT                   /locus_tag="mCG_16638"
FT                   /product="fibroblast growth factor 5, isoform CRA_b"
FT                   /note="gene_id=mCG16638.2 transcript_id=mCT191422.0
FT                   protein_id=mCP112384.0 isoform=CRA_b"
FT                   /protein_id="EDL20336.1"
FT                   GKVNGSHEASVLSQIYG"
FT   gene            2494353..2967391
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /note="gene_id=mCG142652.0"
FT   mRNA            join(2494353..2494473,2511238..2511368,2663580..2663670,
FT                   2864586..2864784,2903736..2903878,2949882..2950011,
FT                   2967156..2967391)
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, transcript variant
FT                   mCT181380"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181380.0
FT                   created on 17-MAR-2003"
FT   mRNA            join(2494353..2494473,2511238..2511368,2663580..2663674,
FT                   2903740..>2903810)
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, transcript variant
FT                   mCT181381"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181381.0
FT                   created on 17-MAR-2003"
FT   mRNA            join(2494353..2494473,2511238..2512036)
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, transcript variant
FT                   mCT181382"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181382.0
FT                   created on 17-MAR-2003"
FT   CDS             join(2494363..2494473,2511238..2511368,2663580..2663674,
FT                   2903740..>2903810)
FT                   /codon_start=1
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, isoform CRA_b"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181381.0
FT                   protein_id=mCP104304.0 isoform=CRA_b"
FT                   /protein_id="EDL20331.1"
FT   CDS             join(2494363..2494473,2511238..2511368,2663580..2663670,
FT                   2864586..2864606)
FT                   /codon_start=1
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, isoform CRA_a"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181380.0
FT                   protein_id=mCP104302.0 isoform=CRA_a"
FT                   /protein_id="EDL20330.1"
FT                   NRAGKLSTEENLC"
FT   CDS             join(2494363..2494473,2511238..2511372)
FT                   /codon_start=1
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, isoform CRA_c"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT181382.0
FT                   protein_id=mCP104303.0 isoform=CRA_c"
FT                   /protein_id="EDL20332.1"
FT   mRNA            join(<2494379..2494473,2511238..2511368,2663580..2663670,
FT                   2864590..2864784,2903736..2903878,2949882..2950011,
FT                   2967156..2967388)
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, transcript variant
FT                   mCT191375"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT191375.0
FT                   created on 09-MAR-2004"
FT   assembly_gap    2537321..2537426
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2543635..2543654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2565840..2565859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2582771..2582790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2611084..2611103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2649573..2649673
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2667752..2667779
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            complement(2718889..2732325)
FT                   /gene="1700010H22Rik"
FT                   /locus_tag="mCG_55069"
FT                   /note="gene_id=mCG55069.2"
FT   mRNA            complement(join(2718889..2719240,2729493..2729558,
FT                   2731751..2732325))
FT                   /gene="1700010H22Rik"
FT                   /locus_tag="mCG_55069"
FT                   /product="RIKEN cDNA 1700010H22"
FT                   /note="gene_id=mCG55069.2 transcript_id=mCT55252.2 created
FT                   on 09-DEC-2002"
FT   assembly_gap    2726116..2726135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2729343..2729362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(2729513..2729558,2731751..2732082))
FT                   /codon_start=1
FT                   /gene="1700010H22Rik"
FT                   /locus_tag="mCG_55069"
FT                   /product="RIKEN cDNA 1700010H22"
FT                   /note="gene_id=mCG55069.2 transcript_id=mCT55252.2
FT                   protein_id=mCP28543.2"
FT                   /db_xref="GOA:Q9DAH8"
FT                   /db_xref="MGI:MGI:1922750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAH8"
FT                   /protein_id="EDL20334.1"
FT   assembly_gap    2746052..2746475
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    2755260..2755279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2762889..2763034
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2779303..2779516
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    2791350..2791369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2799021..2799432
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    2820093..2820112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2861969..2862083
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   CDS             join(<2864779..2864784,2903736..2903878,2949882..2950011,
FT                   2967156..2967251)
FT                   /codon_start=1
FT                   /gene="1700007G11Rik"
FT                   /locus_tag="mCG_142652"
FT                   /product="RIKEN cDNA 1700007G11, isoform CRA_d"
FT                   /note="gene_id=mCG142652.0 transcript_id=mCT191375.0
FT                   protein_id=mCP112320.0 isoform=CRA_d"
FT                   /protein_id="EDL20333.1"
FT   assembly_gap    2882995..2883014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2895037..2895056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2923122..2923141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2962976..2963051
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    2991324..2991343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2994349..2994749
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    2996062..2996141
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3004697..3004765
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            3018127..3043918
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /note="gene_id=mCG49584.2"
FT   mRNA            join(3018127..3019141,3035749..3037479)
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, transcript variant
FT                   mCT181384"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT181384.0 created
FT                   on 19-MAR-2003"
FT   mRNA            join(3018153..3019141,3035749..3036653,3043463..3043918)
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, transcript variant
FT                   mCT49767"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT49767.2 created
FT                   on 19-MAR-2003"
FT   mRNA            join(3018165..3019141,3035749..3036726,3043463..3043918)
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, transcript variant
FT                   mCT181385"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT181385.0 created
FT                   on 19-MAR-2003"
FT   CDS             join(3018832..3019141,3035749..3036653,3043463..3043654)
FT                   /codon_start=1
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT49767.2
FT                   protein_id=mCP28522.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q149J9"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017197"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88179"
FT                   /db_xref="UniProtKB/TrEMBL:Q149J9"
FT                   /protein_id="EDL20329.1"
FT                   NMTVDSCACR"
FT   CDS             join(3018832..3019141,3035749..3036726,3043463..3043587)
FT                   /codon_start=1
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT181385.0
FT                   protein_id=mCP104307.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0G2JEU2"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEU2"
FT                   /protein_id="EDL20328.1"
FT                   AGKDVLTQHLVL"
FT   CDS             join(3018832..3019141,3035749..3036770)
FT                   /codon_start=1
FT                   /gene="Bmp3"
FT                   /locus_tag="mCG_49584"
FT                   /product="bone morphogenetic protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG49584.2 transcript_id=mCT181384.0
FT                   protein_id=mCP104306.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0G2JE75"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JE75"
FT                   /protein_id="EDL20327.1"
FT   assembly_gap    3054319..3054338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3073226..3075971
FT                   /estimated_length=2746
FT                   /gap_type="unknown"
FT   gene            complement(3095108..3202171)
FT                   /gene="Prkg2"
FT                   /locus_tag="mCG_16631"
FT                   /note="gene_id=mCG16631.2"
FT   mRNA            complement(join(3095108..3095991,3106612..3106674,
FT                   3107872..3107994,3111817..3111980,3130969..3131110,
FT                   3132184..3132273,3134394..3134530,3136309..3136462,
FT                   3137565..3137663,3140893..3140961,3144671..3144765,
FT                   3145991..3146068,3153120..3153183,3157151..3157256,
FT                   3159366..3159479,3162180..3162346,3189238..3189711,
FT                   3201743..3202171))
FT                   /gene="Prkg2"
FT                   /locus_tag="mCG_16631"
FT                   /product="protein kinase, cGMP-dependent, type II"
FT                   /note="gene_id=mCG16631.2 transcript_id=mCT13858.2 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(3095976..3095991,3106612..3106674,
FT                   3107872..3107994,3111817..3111980,3130969..3131110,
FT                   3132184..3132273,3134394..3134530,3136309..3136462,
FT                   3137565..3137663,3140893..3140961,3144671..3144765,
FT                   3145991..3146068,3153120..3153183,3157151..3157256,
FT                   3159366..3159479,3162180..3162346,3189238..3189698))
FT                   /codon_start=1
FT                   /gene="Prkg2"
FT                   /locus_tag="mCG_16631"
FT                   /product="protein kinase, cGMP-dependent, type II"
FT                   /note="gene_id=mCG16631.2 transcript_id=mCT13858.2
FT                   protein_id=mCP5848.2"
FT                   /protein_id="EDL20326.1"
FT   assembly_gap    3097760..3099088
FT                   /estimated_length=1329
FT                   /gap_type="unknown"
FT   assembly_gap    3141583..3141798
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    3143626..3144033
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    3150771..3150790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3194033..3194146
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3203589..3203881
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   gene            complement(3203941..>3336174)
FT                   /locus_tag="mCG_145973"
FT                   /note="gene_id=mCG145973.0"
FT   mRNA            complement(join(3203941..3205423,3225486..3225683,
FT                   3255098..3255216,3274630..3274731,3283813..3283945,
FT                   3288520..3288711,3333088..3333263,3334984..3335152,
FT                   3336034..>3336174))
FT                   /locus_tag="mCG_145973"
FT                   /product="mCG145973"
FT                   /note="gene_id=mCG145973.0 transcript_id=mCT186081.0
FT                   created on 04-JUL-2003"
FT   gene            3205407..3207786
FT                   /locus_tag="mCG_1030758"
FT                   /note="gene_id=mCG1030758.0"
FT   mRNA            join(3205407..3205426,3207461..3207786)
FT                   /locus_tag="mCG_1030758"
FT                   /product="mCG1030758"
FT                   /note="gene_id=mCG1030758.0 transcript_id=mCT148462.0
FT                   created on 19-MAR-2003"
FT   CDS             3207640..3207762
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030758"
FT                   /product="mCG1030758"
FT                   /note="gene_id=mCG1030758.0 transcript_id=mCT148462.0
FT                   protein_id=mCP62743.1"
FT                   /protein_id="EDL20325.1"
FT   gene            complement(3273296..3273880)
FT                   /pseudo
FT                   /locus_tag="mCG_59450"
FT                   /note="gene_id=mCG59450.2"
FT   mRNA            complement(3273296..3273880)
FT                   /pseudo
FT                   /locus_tag="mCG_59450"
FT                   /note="gene_id=mCG59450.2 transcript_id=mCT59633.2 created
FT                   on 19-MAR-2003"
FT   assembly_gap    3277388..3278131
FT                   /estimated_length=744
FT                   /gap_type="unknown"
FT   CDS             complement(join(3283835..3283945,3288520..3288711,
FT                   3333088..>3333108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145973"
FT                   /product="mCG145973"
FT                   /note="gene_id=mCG145973.0 transcript_id=mCT186081.0
FT                   protein_id=mCP107399.0"
FT                   /protein_id="EDL20324.1"
FT                   NHL"
FT   assembly_gap    3312136..3312155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3315479..3315829
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    3328516..3328535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3329929..3329948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3361895..3361914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3370291..3370380
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    3379943..3379962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3382136..3417848)
FT                   /gene="Rasgef1b"
FT                   /locus_tag="mCG_15539"
FT                   /note="gene_id=mCG15539.2"
FT   mRNA            complement(join(3382136..3383522,3386085..3386157,
FT                   3387042..3387165,3387664..3387759,3392898..3392993,
FT                   3394231..3394310,3397005..3397107,3397216..3397311,
FT                   3398829..3398903,3399390..3399605,3405742..3405879,
FT                   3406328..3406450,3407983..3408165,3417633..3417848))
FT                   /gene="Rasgef1b"
FT                   /locus_tag="mCG_15539"
FT                   /product="RasGEF domain family, member 1B, transcript
FT                   variant mCT18072"
FT                   /note="gene_id=mCG15539.2 transcript_id=mCT18072.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(3382136..3383522,3386085..3386157,
FT                   3387042..3387165,3387664..3387759,3392898..3392993,
FT                   3394231..3394310,3397005..3397107,3397216..3397311,
FT                   3398829..3398903,3399390..3399602,3405742..3405879,
FT                   3406328..3406450,3407983..3408165,3417633..3417845))
FT                   /gene="Rasgef1b"
FT                   /locus_tag="mCG_15539"
FT                   /product="RasGEF domain family, member 1B, transcript
FT                   variant mCT185353"
FT                   /note="gene_id=mCG15539.2 transcript_id=mCT185353.0 created
FT                   on 13-JUN-2003"
FT   assembly_gap    3383029..3383077
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   CDS             complement(join(3383498..3383522,3386085..3386157,
FT                   3387042..3387165,3387664..3387759,3392898..3392993,
FT                   3394231..3394310,3397005..3397107,3397216..3397311,
FT                   3398829..3398903,3399390..3399602,3405742..3405879,
FT                   3406328..3406450,3407983..3408159))
FT                   /codon_start=1
FT                   /gene="Rasgef1b"
FT                   /locus_tag="mCG_15539"
FT                   /product="RasGEF domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG15539.2 transcript_id=mCT185353.0
FT                   protein_id=mCP106611.0 isoform=CRA_a partial"
FT                   /protein_id="EDL20322.1"
FT                   DRWKSLRSSLLGRV"
FT   CDS             complement(join(3383498..3383522,3386085..3386157,
FT                   3387042..3387165,3387664..3387759,3392898..3392993,
FT                   3394231..3394310,3397005..3397107,3397216..3397311,
FT                   3398829..3398903,3399390..3399605,3405742..3405879,
FT                   3406328..3406450,3407983..3408159))
FT                   /codon_start=1
FT                   /gene="Rasgef1b"
FT                   /locus_tag="mCG_15539"
FT                   /product="RasGEF domain family, member 1B, isoform CRA_b"
FT                   /note="gene_id=mCG15539.2 transcript_id=mCT18072.3
FT                   protein_id=mCP5852.2 isoform=CRA_b partial"
FT                   /protein_id="EDL20323.1"
FT                   KDRWKSLRSSLLGRV"
FT   assembly_gap    3392549..3392568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3426884..3426903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3438858..3441615
FT                   /locus_tag="mCG_1030447"
FT                   /note="gene_id=mCG1030447.1"
FT   mRNA            join(3438858..3438931,3439446..3439658,3440062..3440172,
FT                   3441200..3441615)
FT                   /locus_tag="mCG_1030447"
FT                   /product="mCG1030447"
FT                   /note="gene_id=mCG1030447.1 transcript_id=mCT148151.1
FT                   created on 18-APR-2003"
FT   CDS             3441458..3441595
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030447"
FT                   /product="mCG1030447"
FT                   /note="gene_id=mCG1030447.1 transcript_id=mCT148151.1
FT                   protein_id=mCP62736.1"
FT                   /protein_id="EDL20321.1"
FT                   "
FT   assembly_gap    3441621..3441640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3458267..3458286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3462209..>3890138)
FT                   /locus_tag="mCG_144685"
FT                   /note="gene_id=mCG144685.0"
FT   mRNA            complement(join(3462209..3462822,3462843..3465134,
FT                   3541506..3541586,3725029..3725082,3889835..>3890138))
FT                   /locus_tag="mCG_144685"
FT                   /product="mCG144685"
FT                   /note="gene_id=mCG144685.0 transcript_id=mCT184109.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3464988..3465134,3541506..3541586,
FT                   3725029..3725082,3889835..>3890137))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144685"
FT                   /product="mCG144685"
FT                   /note="gene_id=mCG144685.0 transcript_id=mCT184109.0
FT                   protein_id=mCP105422.0"
FT                   /protein_id="EDL20316.1"
FT   assembly_gap    3481152..3481432
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    3499560..3499667
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    3505764..3505837
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    3509174..3509335
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3524110..3524129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3526853..3527179
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    3528578..3528793
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    3530386..3530456
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    3534278..3534374
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3597388..3597407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3632415..3632448
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3634734..3635005
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    3654452..3654740
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    3680747..3681084
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    3690142..3690448
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    3694271..3694349
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    3702475..3702539
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    3707225..3707244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3711553..3711601
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3720064..3720083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3725553..3725614
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    3729453..3729485
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    3736445..3737402
FT                   /estimated_length=958
FT                   /gap_type="unknown"
FT   assembly_gap    3738417..3739081
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    3765602..3766356
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    3774736..3774755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3777157..3777930)
FT                   /pseudo
FT                   /locus_tag="mCG_49102"
FT                   /note="gene_id=mCG49102.1"
FT   mRNA            complement(3777157..3777930)
FT                   /pseudo
FT                   /locus_tag="mCG_49102"
FT                   /note="gene_id=mCG49102.1 transcript_id=mCT49285.1 created
FT                   on 18-MAR-2003"
FT   assembly_gap    3784684..3784788
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            3792368..3793595
FT                   /locus_tag="mCG_147664"
FT                   /note="gene_id=mCG147664.0"
FT   mRNA            join(3792368..3792804,3793241..3793595)
FT                   /locus_tag="mCG_147664"
FT                   /product="mCG147664"
FT                   /note="gene_id=mCG147664.0 transcript_id=mCT187927.0
FT                   created on 13-JAN-2004"
FT   CDS             3792492..3792800
FT                   /codon_start=1
FT                   /locus_tag="mCG_147664"
FT                   /product="mCG147664"
FT                   /note="gene_id=mCG147664.0 transcript_id=mCT187927.0
FT                   protein_id=mCP109057.0"
FT                   /protein_id="EDL20320.1"
FT   assembly_gap    3797556..3797575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3801462..3805652
FT                   /estimated_length=4191
FT                   /gap_type="unknown"
FT   assembly_gap    3807608..3807627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3808808..3808827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3815500..3816464
FT                   /estimated_length=965
FT                   /gap_type="unknown"
FT   assembly_gap    3820447..3820660
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3829004..3830279
FT                   /estimated_length=1276
FT                   /gap_type="unknown"
FT   assembly_gap    3837617..3837863
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    3840348..3840367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3843710..3876857
FT                   /locus_tag="mCG_142648"
FT                   /note="gene_id=mCG142648.0"
FT   mRNA            join(3843710..3843821,3864676..3864747,3876649..3876857)
FT                   /locus_tag="mCG_142648"
FT                   /product="mCG142648, transcript variant mCT181359"
FT                   /note="gene_id=mCG142648.0 transcript_id=mCT181359.0
FT                   created on 18-MAR-2003"
FT   mRNA            join(3843716..3843821,3851009..3851623)
FT                   /locus_tag="mCG_142648"
FT                   /product="mCG142648, transcript variant mCT181358"
FT                   /note="gene_id=mCG142648.0 transcript_id=mCT181358.0
FT                   created on 18-MAR-2003"
FT   assembly_gap    3843914..3843969
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            3844301..3846336
FT                   /locus_tag="mCG_1030755"
FT                   /note="gene_id=mCG1030755.1"
FT   mRNA            join(3844301..3845005,3846126..3846336)
FT                   /locus_tag="mCG_1030755"
FT                   /product="mCG1030755"
FT                   /note="gene_id=mCG1030755.1 transcript_id=mCT148459.1
FT                   created on 18-MAR-2003"
FT   CDS             join(3844619..3845005,3846126..3846209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030755"
FT                   /product="mCG1030755"
FT                   /note="gene_id=mCG1030755.1 transcript_id=mCT148459.1
FT                   protein_id=mCP62704.1"
FT                   /db_xref="GOA:Q9D526"
FT                   /db_xref="MGI:MGI:1922344"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D526"
FT                   /protein_id="EDL20319.1"
FT   CDS             3851349..3851567
FT                   /codon_start=1
FT                   /locus_tag="mCG_142648"
FT                   /product="mCG142648, isoform CRA_a"
FT                   /note="gene_id=mCG142648.0 transcript_id=mCT181358.0
FT                   protein_id=mCP104281.0 isoform=CRA_a"
FT                   /protein_id="EDL20317.1"
FT   assembly_gap    3852378..3852535
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3857936..3857966
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    3864202..3864256
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3872442..3872461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             3876655..3876816
FT                   /codon_start=1
FT                   /locus_tag="mCG_142648"
FT                   /product="mCG142648, isoform CRA_b"
FT                   /note="gene_id=mCG142648.0 transcript_id=mCT181359.0
FT                   protein_id=mCP104280.0 isoform=CRA_b"
FT                   /protein_id="EDL20318.1"
FT                   WSCVHKQT"
FT   assembly_gap    3890241..3890350
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            complement(3891888..>3915007)
FT                   /locus_tag="mCG_144686"
FT                   /note="gene_id=mCG144686.0"
FT   mRNA            complement(join(3891888..3892065,3892711..3892783,
FT                   3893234..3893326,3895975..3896503,3896921..3897037,
FT                   3897803..3897904,3898061..3898104,3903361..3903581,
FT                   3911375..3911585,3912289..3912416,3913764..3913856,
FT                   3914448..>3915007))
FT                   /locus_tag="mCG_144686"
FT                   /product="mCG144686"
FT                   /note="gene_id=mCG144686.0 transcript_id=mCT184110.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3912320..3912416,3913764..3913856,
FT                   3914448..>3914488))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144686"
FT                   /product="mCG144686"
FT                   /note="gene_id=mCG144686.0 transcript_id=mCT184110.0
FT                   protein_id=mCP105423.0"
FT                   /protein_id="EDL20315.1"
FT   assembly_gap    3929803..3929822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3966334..3966353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3994965..3995096
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            complement(4000974..4001431)
FT                   /pseudo
FT                   /locus_tag="mCG_1453"
FT                   /note="gene_id=mCG1453.2"
FT   mRNA            complement(4000974..4001431)
FT                   /pseudo
FT                   /locus_tag="mCG_1453"
FT                   /note="gene_id=mCG1453.2 transcript_id=mCT7997.2 created on
FT                   18-MAR-2003"
FT   assembly_gap    4014840..4014999
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    4015207..4015226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4052575..4052814
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    4059379..4059398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4090043..4090937
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    4092596..4092615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4098130..4098149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4115539..4133913)
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /note="gene_id=mCG15538.2"
FT   mRNA            complement(join(4115539..4116273,4117455..4117552,
FT                   4118924..4119023,4119610..4119741,4120962..4121123,
FT                   4122159..4122327,4133326..4133913))
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   transcript variant mCT175394"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175394.0 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(4115539..4116273,4117455..4117552,
FT                   4118924..4119023,4119610..4119741,4120962..4121123,
FT                   4122159..4122327,4131468..4131524,4133326..4133913))
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   transcript variant mCT18071"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT18071.2 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(4115539..4116273,4117455..4117552,
FT                   4118671..4118817,4118924..4119023,4119610..4119741,
FT                   4120962..4121123,4122159..4122327,4131468..4131524,
FT                   4133326..4133862))
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   transcript variant mCT175395"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175395.0 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(4115539..4116273,4117455..4117552,
FT                   4118671..4118817,4118924..4119023,4119610..4119741,
FT                   4120962..4121123,4122159..4122327,4133326..>4133558))
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   transcript variant mCT175393"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175393.0 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(4117485..4117552,4118924..4119023,
FT                   4119610..4119741,4120962..4121123,4122159..4122327,
FT                   4133326..4133558))
FT                   /codon_start=1
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175394.0
FT                   protein_id=mCP98314.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8G0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012956"
FT                   /db_xref="MGI:MGI:101947"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8G0"
FT                   /protein_id="EDL20312.1"
FT                   NSYKPY"
FT   CDS             complement(join(4117485..4117552,4118671..4118817,
FT                   4118924..4119023,4119610..4119741,4120962..4121123,
FT                   4122159..4122327,4133326..4133558))
FT                   /codon_start=1
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175393.0
FT                   protein_id=mCP98312.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9W0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012956"
FT                   /db_xref="MGI:MGI:101947"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9W0"
FT                   /protein_id="EDL20311.1"
FT   CDS             complement(join(4117485..4117552,4118924..4119023,
FT                   4119610..4119741,4120962..4121123,4122159..4122327,
FT                   4131468..4131524,4133326..4133558))
FT                   /codon_start=1
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT18071.2
FT                   protein_id=mCP5850.2 isoform=CRA_c"
FT                   /protein_id="EDL20313.1"
FT   CDS             complement(join(4117485..4117552,4118671..4118817,
FT                   4118924..4119023,4119610..4119741,4120962..4121123,
FT                   4122159..4122327,4131468..4131524,4133326..4133558))
FT                   /codon_start=1
FT                   /gene="Hnrpd"
FT                   /locus_tag="mCG_15538"
FT                   /product="heterogeneous nuclear ribonucleoprotein D,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG15538.2 transcript_id=mCT175395.0
FT                   protein_id=mCP98313.0 isoform=CRA_d"
FT                   /protein_id="EDL20314.1"
FT                   KVSRRGGHQNSYKPY"
FT   gene            4133994..4134597
FT                   /locus_tag="mCG_147677"
FT                   /note="gene_id=mCG147677.0"
FT   mRNA            4133994..4134597
FT                   /locus_tag="mCG_147677"
FT                   /product="mCG147677"
FT                   /note="gene_id=mCG147677.0 transcript_id=mCT187940.0
FT                   created on 13-JAN-2004"
FT   CDS             4134394..4134486
FT                   /codon_start=1
FT                   /locus_tag="mCG_147677"
FT                   /product="mCG147677"
FT                   /note="gene_id=mCG147677.0 transcript_id=mCT187940.0
FT                   protein_id=mCP109069.0"
FT                   /protein_id="EDL20310.1"
FT                   /translation="MVEAASSQSCFPSLKLCLRYYKSLTPATIL"
FT   assembly_gap    4140567..4140586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4142172..4142406
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    4155560..4155695
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    4177865..4178284
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    4183993..4184012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4188466..4193815)
FT                   /gene="Hnrpdl"
FT                   /locus_tag="mCG_7542"
FT                   /note="gene_id=mCG7542.2"
FT   mRNA            complement(join(4188466..4189869,4190989..4191080,
FT                   4191366..4191536,4191747..4191861,4191970..4192101,
FT                   4192453..4192614,4192698..4192866,4193606..4193815))
FT                   /gene="Hnrpdl"
FT                   /locus_tag="mCG_7542"
FT                   /product="heterogeneous nuclear ribonucleoprotein D-like,
FT                   transcript variant mCT6503"
FT                   /note="gene_id=mCG7542.2 transcript_id=mCT6503.1 created on
FT                   06-NOV-2002"
FT   mRNA            complement(join(4188466..4189869,4190520..4190624,
FT                   4190989..4191080,4191366..4191536,4192761..4192866,
FT                   4193606..4193771))
FT                   /gene="Hnrpdl"
FT                   /locus_tag="mCG_7542"
FT                   /product="heterogeneous nuclear ribonucleoprotein D-like,
FT                   transcript variant mCT175397"
FT                   /note="gene_id=mCG7542.2 transcript_id=mCT175397.0 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(4190591..4190624,4190989..4191080,
FT                   4191366..4191536,4192761..4192866,4193606..4193691))
FT                   /codon_start=1
FT                   /gene="Hnrpdl"
FT                   /locus_tag="mCG_7542"
FT                   /product="heterogeneous nuclear ribonucleoprotein D-like,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7542.2 transcript_id=mCT175397.0
FT                   protein_id=mCP98316.0 isoform=CRA_a"
FT                   /protein_id="EDL20308.1"
FT   CDS             complement(join(4191010..4191080,4191366..4191536,
FT                   4191747..4191861,4191970..4192101,4192453..4192614,
FT                   4192698..4192866,4193606..4193691))
FT                   /codon_start=1
FT                   /gene="Hnrpdl"
FT                   /locus_tag="mCG_7542"
FT                   /product="heterogeneous nuclear ribonucleoprotein D-like,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7542.2 transcript_id=mCT6503.1
FT                   protein_id=mCP5853.1 isoform=CRA_b"
FT                   /protein_id="EDL20309.1"
FT   gene            4194705..4224965
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /note="gene_id=mCG7544.2"
FT   mRNA            join(4194705..4195158,4215311..4215412,4217148..4217341,
FT                   4218317..4218449,4219956..4220079,4223997..4224960)
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, transcript variant
FT                   mCT177258"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT177258.0 created
FT                   on 09-DEC-2002"
FT   mRNA            join(4194897..4195187,4215311..4215412,4217148..4217341,
FT                   4218317..4218449,4219956..4220079,4223997..4224965)
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, transcript variant
FT                   mCT6488"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT6488.2 created on
FT                   09-DEC-2002"
FT   mRNA            join(<4194927..4195187,4215311..4215412,4217148..4217341,
FT                   4218317..4218449,4219956..4220079,4223997..4224139,
FT                   4224494..4224958)
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, transcript variant
FT                   mCT191358"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT191358.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4194933..4195187,4215311..4215412,4217148..4217341,
FT                   4218317..4218449,4219956..4220079,4223997..4224133)
FT                   /codon_start=1
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, isoform CRA_b"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT191358.0
FT                   protein_id=mCP112349.0 isoform=CRA_b"
FT                   /protein_id="EDL20306.1"
FT   CDS             join(4195104..4195187,4215311..4215412,4217148..4217341,
FT                   4218317..4218449,4219956..4220079,4223997..4224133)
FT                   /codon_start=1
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, isoform CRA_c"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT6488.2
FT                   protein_id=mCP5842.2 isoform=CRA_c"
FT                   /protein_id="EDL20307.1"
FT   assembly_gap    4206235..4206254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4207394..4207605
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   CDS             join(4217217..4217341,4218317..4218449,4219956..4220079,
FT                   4223997..4224133)
FT                   /codon_start=1
FT                   /gene="2310057D15Rik"
FT                   /locus_tag="mCG_7544"
FT                   /product="RIKEN cDNA 2310057D15, isoform CRA_a"
FT                   /note="gene_id=mCG7544.2 transcript_id=mCT177258.0
FT                   protein_id=mCP100180.0 isoform=CRA_a"
FT                   /protein_id="EDL20305.1"
FT                   FSELYLPST"
FT   assembly_gap    4225256..4225404
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(4234250..>4320440)
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /note="gene_id=mCG66352.3"
FT   mRNA            complement(join(4234250..4236435,4239948..4240125,
FT                   4242501..4242628,4249146..4249213,4249314..4249346,
FT                   4249438..4249491,4251983..4252072,4320318..4320421))
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, transcript variant
FT                   mCT66535"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT66535.2 created
FT                   on 18-MAR-2003"
FT   gene            <4234335..4251525
FT                   /locus_tag="mCG_145977"
FT                   /note="gene_id=mCG145977.0"
FT   mRNA            join(<4234335..4234515,4248492..4248595,4248689..4248768,
FT                   4249293..4249390,4250771..4251525)
FT                   /locus_tag="mCG_145977"
FT                   /product="mCG145977"
FT                   /note="gene_id=mCG145977.0 transcript_id=mCT186085.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(4236227..4236435,4239948..4240125,
FT                   4242501..4242628,4249146..4249213,4249314..4249346,
FT                   4249438..4249491,4251983..4252062))
FT                   /codon_start=1
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, isoform CRA_c"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT66535.2
FT                   protein_id=mCP28542.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8C8S3"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="MGI:MGI:3041258"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C8S3"
FT                   /protein_id="EDL20303.1"
FT   mRNA            complement(join(<4236399..4236435,4239950..4240125,
FT                   4242501..4242628,4249146..4249213,4249314..4249346,
FT                   4249438..4249491,4251983..4252072,4320318..>4320440))
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, transcript variant
FT                   mCT191391"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT191391.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<4236399..4236435,4239950..4240125,
FT                   4242501..4242628,4249146..4249213,4249314..4249346,
FT                   4249438..4249491,4251983..4252072,4320318..>4320319))
FT                   /codon_start=1
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, isoform CRA_b"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT191391.0
FT                   protein_id=mCP112342.0 isoform=CRA_b"
FT                   /protein_id="EDL20302.1"
FT   mRNA            complement(join(4240320..4242628,4249314..4249346,
FT                   4249438..4249491,4251983..4252072,4320220..4320285))
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, transcript variant
FT                   mCT181389"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT181389.0 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(4242508..4242628,4249314..4249346,
FT                   4249438..4249491,4251983..4252062))
FT                   /codon_start=1
FT                   /gene="BC062109"
FT                   /locus_tag="mCG_66352"
FT                   /product="cDNA sequence BC062109, isoform CRA_a"
FT                   /note="gene_id=mCG66352.3 transcript_id=mCT181389.0
FT                   protein_id=mCP104311.0 isoform=CRA_a"
FT                   /protein_id="EDL20301.1"
FT   CDS             join(<4248535..4248595,4248689..4248768,4249293..4249390,
FT                   4250771)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145977"
FT                   /product="mCG145977"
FT                   /note="gene_id=mCG145977.0 transcript_id=mCT186085.0
FT                   protein_id=mCP107402.0"
FT                   /protein_id="EDL20304.1"
FT   assembly_gap    4256999..4257115
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    4264527..4264556
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    4273951..4273970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4287788..4288628
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    4301411..4301430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4305027..4305046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4305894..4305913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4319574..4319593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4338507..4342899
FT                   /estimated_length=4393
FT                   /gap_type="unknown"
FT   assembly_gap    4356038..4356057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4357710..4361825
FT                   /locus_tag="mCG_1030748"
FT                   /note="gene_id=mCG1030748.1"
FT   mRNA            join(4357710..4357816,4359816..4361825)
FT                   /locus_tag="mCG_1030748"
FT                   /product="mCG1030748"
FT                   /note="gene_id=mCG1030748.1 transcript_id=mCT148452.1
FT                   created on 18-MAR-2003"
FT   CDS             4360047..4360376
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030748"
FT                   /product="mCG1030748"
FT                   /note="gene_id=mCG1030748.1 transcript_id=mCT148452.1
FT                   protein_id=mCP62579.1"
FT                   /protein_id="EDL20300.1"
FT                   GLRVL"
FT   assembly_gap    4364036..4364106
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            4371828..4379186
FT                   /locus_tag="mCG_147648"
FT                   /note="gene_id=mCG147648.0"
FT   mRNA            join(4371828..4372163,4376943..4377002,4377751..4377858,
FT                   4378584..4379186)
FT                   /locus_tag="mCG_147648"
FT                   /product="mCG147648"
FT                   /note="gene_id=mCG147648.0 transcript_id=mCT187911.0
FT                   created on 13-JAN-2004"
FT   CDS             4378652..4378774
FT                   /codon_start=1
FT                   /locus_tag="mCG_147648"
FT                   /product="mCG147648"
FT                   /note="gene_id=mCG147648.0 transcript_id=mCT187911.0
FT                   protein_id=mCP109041.0"
FT                   /protein_id="EDL20299.1"
FT   gene            complement(4381567..4522270)
FT                   /pseudo
FT                   /locus_tag="mCG_7543"
FT                   /note="gene_id=mCG7543.2"
FT   mRNA            complement(join(4381567..4381751,4388288..4388530,
FT                   4421204..4421400,4456340..4456479,4522055..4522270))
FT                   /pseudo
FT                   /locus_tag="mCG_7543"
FT                   /note="gene_id=mCG7543.2 transcript_id=mCT6492.2 created on
FT                   18-MAR-2003"
FT   assembly_gap    4384076..4386001
FT                   /estimated_length=1926
FT                   /gap_type="unknown"
FT   assembly_gap    4406504..4406567
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4413580..4413742
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    4415136..4415313
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    4429449..4429468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4440502..4440521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4442207..4442226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4463177..4467784
FT                   /estimated_length=4608
FT                   /gap_type="unknown"
FT   gene            4469176..4475497
FT                   /locus_tag="mCG_147665"
FT                   /note="gene_id=mCG147665.0"
FT   mRNA            join(4469176..4469513,4473458..4475497)
FT                   /locus_tag="mCG_147665"
FT                   /product="mCG147665"
FT                   /note="gene_id=mCG147665.0 transcript_id=mCT187928.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4471774..4473178
FT                   /estimated_length=1405
FT                   /gap_type="unknown"
FT   CDS             4475034..4475342
FT                   /codon_start=1
FT                   /locus_tag="mCG_147665"
FT                   /product="mCG147665"
FT                   /note="gene_id=mCG147665.0 transcript_id=mCT187928.0
FT                   protein_id=mCP109058.0"
FT                   /protein_id="EDL20298.1"
FT   assembly_gap    4476585..4477616
FT                   /estimated_length=1032
FT                   /gap_type="unknown"
FT   assembly_gap    4479076..4479095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4489765..4489784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4494540..4494737
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    4513915..4513934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4515136..4515208
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   gene            complement(4528803..>4575270)
FT                   /locus_tag="mCG_128474"
FT                   /note="gene_id=mCG128474.1"
FT   mRNA            complement(join(4528803..4529383,4530530..4530601,
FT                   4530981..4531100,4532884..4533147,4535449..4535507,
FT                   4540536..4540871,4542364..4542487,4545984..4546157,
FT                   4548316..4548489,4549918..4550063,4550953..4551079,
FT                   4552280..4552458,4553284..4553359,4556224..4556262,
FT                   4557917..4557991,4559553..4559771,4560021..4560173,
FT                   4560361..4560522,4562960..4563059,4566505..4566647,
FT                   4569373..4569513,4571173..4571268,4572602..4572800,
FT                   4574315..4574438,4575192..>4575270))
FT                   /locus_tag="mCG_128474"
FT                   /product="mCG128474, transcript variant mCT181377"
FT                   /note="gene_id=mCG128474.1 transcript_id=mCT181377.0
FT                   created on 18-MAR-2003"
FT   mRNA            complement(join(4528804..4529383,4530530..4530601,
FT                   4530981..4531100,4532884..4533147,4535449..4535507,
FT                   4536751..4536789,4540536..4540871,4542364..4542487,
FT                   4545984..4546157,4548316..4548489,4549918..4550063,
FT                   4550953..4551079,4552280..4552458,4553284..4553359,
FT                   4555690..4555767,4556224..4556262,4557917..4557991,
FT                   4559553..4559786,4560021..4560173,4560361..4560522,
FT                   4562960..4563059,4566505..4566647,4569373..4569513,
FT                   4571173..4571268,4572602..4572800,4574315..4574438,
FT                   4575192..>4575270))
FT                   /locus_tag="mCG_128474"
FT                   /product="mCG128474, transcript variant mCT129771"
FT                   /note="gene_id=mCG128474.1 transcript_id=mCT129771.1
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4529204..4529383,4530530..4530601,
FT                   4530981..4531100,4532884..4533147,4535449..4535507,
FT                   4540536..4540871,4542364..4542487,4545984..4546157,
FT                   4548316..4548489,4549918..4550063,4550953..4551079,
FT                   4552280..4552458,4553284..4553359,4556224..4556262,
FT                   4557917..4557991,4559553..4559771,4560021..4560173,
FT                   4560361..4560522,4562960..4563059,4566505..4566647,
FT                   4569373..4569513,4571173..4571268,4572602..4572800,
FT                   4574315..4574438,4575192..4575270))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128474"
FT                   /product="mCG128474, isoform CRA_b"
FT                   /note="gene_id=mCG128474.1 transcript_id=mCT181377.0
FT                   protein_id=mCP104299.0 isoform=CRA_b"
FT                   /protein_id="EDL20297.1"
FT   CDS             complement(join(4529204..4529383,4530530..4530601,
FT                   4530981..4531100,4532884..4533147,4535449..4535507,
FT                   4536751..4536789,4540536..4540871,4542364..4542487,
FT                   4545984..4546157,4548316..4548489,4549918..4550063,
FT                   4550953..4551079,4552280..4552458,4553284..4553359,
FT                   4555690..4555767,4556224..4556262,4557917..4557991,
FT                   4559553..4559786,4560021..4560173,4560361..4560522,
FT                   4562960..4563059,4566505..4566647,4569373..4569513,
FT                   4571173..4571268,4572602..4572800,4574315..4574438,
FT                   4575192..4575270))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128474"
FT                   /product="mCG128474, isoform CRA_a"
FT                   /note="gene_id=mCG128474.1 transcript_id=mCT129771.1
FT                   protein_id=mCP62617.1 isoform=CRA_a"
FT                   /protein_id="EDL20296.1"
FT                   SKLGV"
FT   gene            complement(4588009..4596700)
FT                   /locus_tag="mCG_1030747"
FT                   /note="gene_id=mCG1030747.0"
FT   mRNA            complement(join(4588009..4588134,4589130..4589203,
FT                   4593896..4593964,4596257..4596398,4596486..4596700))
FT                   /locus_tag="mCG_1030747"
FT                   /product="mCG1030747, transcript variant mCT148451"
FT                   /note="gene_id=mCG1030747.0 transcript_id=mCT148451.0
FT                   created on 18-MAR-2003"
FT   mRNA            complement(join(4590812..4593964,4596257..4596398,
FT                   4596486..4596677))
FT                   /locus_tag="mCG_1030747"
FT                   /product="mCG1030747, transcript variant mCT181357"
FT                   /note="gene_id=mCG1030747.0 transcript_id=mCT181357.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4596283..4596398,4596486..4596489))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030747"
FT                   /product="mCG1030747, isoform CRA_a"
FT                   /note="gene_id=mCG1030747.0 transcript_id=mCT148451.0
FT                   protein_id=mCP63298.1 isoform=CRA_a"
FT                   /protein_id="EDL20294.1"
FT   CDS             complement(join(4596283..4596398,4596486..4596489))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030747"
FT                   /product="mCG1030747, isoform CRA_a"
FT                   /note="gene_id=mCG1030747.0 transcript_id=mCT181357.0
FT                   protein_id=mCP104279.0 isoform=CRA_a"
FT                   /protein_id="EDL20295.1"
FT   assembly_gap    4608459..4608478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4609220..4668032)
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /note="gene_id=mCG128470.1"
FT   mRNA            complement(join(4609220..4611455,4613851..4614053,
FT                   4617947..4618084,4618233..4618335,4619646..4619717,
FT                   4620375..4620466,4621314..4621511,4621809..4621882,
FT                   4626986..4627202,4643139..4643281,4647647..4647770,
FT                   4652593..4653308,4665814..4666085))
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, transcript variant
FT                   mCT129768"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT129768.1
FT                   created on 18-MAR-2003"
FT   mRNA            complement(join(4609378..4611455,4613851..4614053,
FT                   4617947..4618084,4618233..4618335,4619646..4619717,
FT                   4620375..4620466,4621314..4621511,4621809..4621882,
FT                   4626986..4627202,4637243..4637341,4643139..4643281,
FT                   4647647..4647770,4653256..4653308,4667884..4668032))
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, transcript variant
FT                   mCT181375"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT181375.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4611254..4611455,4613851..4614053,
FT                   4617947..4618084,4618233..4618335,4619646..4619717,
FT                   4620375..4620466,4621314..4621511,4621809..4621882,
FT                   4626986..4627202,4643139..4643281,4647647..4647770,
FT                   4652593..4653276))
FT                   /codon_start=1
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, isoform CRA_a"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT129768.1
FT                   protein_id=mCP62541.1 isoform=CRA_a"
FT                   /protein_id="EDL20291.1"
FT   CDS             complement(join(4611254..4611455,4613851..4614053,
FT                   4617947..4618084,4618233..4618335,4619646..4619717,
FT                   4620375..4620466,4621314..4621511,4621809..4621882,
FT                   4626986..4627163))
FT                   /codon_start=1
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, isoform CRA_b"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT181375.0
FT                   protein_id=mCP104298.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR005172"
FT                   /db_xref="InterPro:IPR028307"
FT                   /db_xref="InterPro:IPR033467"
FT                   /db_xref="MGI:MGI:2140902"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN58"
FT                   /protein_id="EDL20292.1"
FT   assembly_gap    4612424..4613707
FT                   /estimated_length=1284
FT                   /gap_type="unknown"
FT   assembly_gap    4619438..4619457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4623050..4623172
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    4628772..4628945
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    4640914..4641023
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4651782..4653308,4665814..4666090))
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, transcript variant
FT                   mCT181376"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT181376.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(4652563..4653276)
FT                   /codon_start=1
FT                   /gene="AI461788"
FT                   /locus_tag="mCG_128470"
FT                   /product="expressed sequence AI461788, isoform CRA_c"
FT                   /note="gene_id=mCG128470.1 transcript_id=mCT181376.0
FT                   protein_id=mCP104297.0 isoform=CRA_c"
FT                   /protein_id="EDL20293.1"
FT                   QLKTVQVKTKKGHIT"
FT   assembly_gap    4667801..4667853
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    4674244..4674263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4684608..4684682
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            4685941..4715091
FT                   /gene="Cops4"
FT                   /locus_tag="mCG_1088"
FT                   /note="gene_id=mCG1088.2"
FT   mRNA            join(4685941..4686037,4695463..4695542,4696028..4696179,
FT                   4697536..4697639,4700807..4700960,4701077..4701227,
FT                   4704865..4705035,4708876..4708991,4711183..4711267,
FT                   4714618..4715091)
FT                   /gene="Cops4"
FT                   /locus_tag="mCG_1088"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 4 (Arabidopsis thaliana), transcript variant
FT                   mCT8757"
FT                   /note="gene_id=mCG1088.2 transcript_id=mCT8757.2 created on
FT                   05-NOV-2002"
FT   CDS             join(4685964..4686037,4695463..4695542,4696028..4696179,
FT                   4697536..4697639,4700807..4700960,4701077..4701227,
FT                   4704865..4705035,4708876..4708991,4711183..4711267,
FT                   4714618..4714751)
FT                   /codon_start=1
FT                   /gene="Cops4"
FT                   /locus_tag="mCG_1088"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 4 (Arabidopsis thaliana), isoform CRA_b"
FT                   /note="gene_id=mCG1088.2 transcript_id=mCT8757.2
FT                   protein_id=mCP12426.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q14AI7"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:1349414"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AI7"
FT                   /protein_id="EDL20290.1"
FT                   MEAQMAQ"
FT   mRNA            join(4685968..4686037,4695463..4695542,4696028..4696179,
FT                   4714740..4714796)
FT                   /gene="Cops4"
FT                   /locus_tag="mCG_1088"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 4 (Arabidopsis thaliana), transcript variant
FT                   mCT175374"
FT                   /note="gene_id=mCG1088.2 transcript_id=mCT175374.0 created
FT                   on 05-NOV-2002"
FT   CDS             join(4686000..4686037,4695463..4695542,4696028..4696179,
FT                   4714740..4714751)
FT                   /codon_start=1
FT                   /gene="Cops4"
FT                   /locus_tag="mCG_1088"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 4 (Arabidopsis thaliana), isoform CRA_a"
FT                   /note="gene_id=mCG1088.2 transcript_id=mCT175374.0
FT                   protein_id=mCP98293.0 isoform=CRA_a"
FT                   /protein_id="EDL20289.1"
FT   assembly_gap    4698429..4698879
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    4710619..4710638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4721052..4740193)
FT                   /gene="Plac8"
FT                   /locus_tag="mCG_1085"
FT                   /note="gene_id=mCG1085.1"
FT   mRNA            complement(join(4721052..4721314,4724018..4724133,
FT                   4727757..4727881,4730686..4730823,4740112..4740193))
FT                   /gene="Plac8"
FT                   /locus_tag="mCG_1085"
FT                   /product="placenta-specific 8"
FT                   /note="gene_id=mCG1085.1 transcript_id=mCT8754.1 created on
FT                   09-DEC-2002"
FT   CDS             complement(join(4724029..4724133,4727757..4727881,
FT                   4730686..4730794))
FT                   /codon_start=1
FT                   /gene="Plac8"
FT                   /locus_tag="mCG_1085"
FT                   /product="placenta-specific 8"
FT                   /note="gene_id=mCG1085.1 transcript_id=mCT8754.1
FT                   protein_id=mCP12449.2"
FT                   /protein_id="EDL20288.1"
FT                   RRRAMNAF"
FT   assembly_gap    4725223..4725242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4728742..4728761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4735650..4735669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4745010..4745744
FT                   /estimated_length=735
FT                   /gap_type="unknown"
FT   assembly_gap    4748306..4748364
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    4751516..4751608
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4758057..4758287
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    4771187..4772214
FT                   /estimated_length=1028
FT                   /gap_type="unknown"
FT   assembly_gap    4780611..4781848
FT                   /estimated_length=1238
FT                   /gap_type="unknown"
FT   assembly_gap    4789085..4789434
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4805457..4805476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4813245..4813447
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    4817434..4817549
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(4823434..4843863)
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /note="gene_id=mCG1093.2"
FT   mRNA            complement(join(4823434..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830632,4832290..4832411,
FT                   4836601..4836767,4842704..4842961))
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   transcript variant mCT8762"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT8762.2 created on
FT                   18-MAR-2003"
FT   mRNA            complement(join(4823862..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830632,4832290..4832411,
FT                   4843701..4843863))
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   transcript variant mCT181364"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181364.0 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(4823862..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830645,4832290..4832411,
FT                   4836601..4836708))
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   transcript variant mCT181365"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181365.0 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(4824005..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830632,4832290..4832411,
FT                   4836601..4836767,4842704..4842956))
FT                   /codon_start=1
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT8762.2
FT                   protein_id=mCP12443.2 isoform=CRA_c"
FT                   /protein_id="EDL20287.1"
FT   CDS             complement(join(4824005..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830625))
FT                   /codon_start=1
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181364.0
FT                   protein_id=mCP104287.0 isoform=CRA_b"
FT                   /protein_id="EDL20285.1"
FT   CDS             complement(join(4824005..4824178,4826519..4826707,
FT                   4828873..4829006,4830547..4830625))
FT                   /codon_start=1
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181365.0
FT                   protein_id=mCP104286.0 isoform=CRA_b"
FT                   /protein_id="EDL20286.1"
FT   mRNA            complement(join(4828872..4829006,4830547..4830632,
FT                   4832290..4832411,4842704..4842969))
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   transcript variant mCT181363"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181363.0 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(4828994..4829006,4830547..4830632,
FT                   4832290..4832411,4842704..4842956))
FT                   /codon_start=1
FT                   /gene="Coq2"
FT                   /locus_tag="mCG_1093"
FT                   /product="coenzyme Q2 homolog, prenyltransferase (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1093.2 transcript_id=mCT181363.0
FT                   protein_id=mCP104285.0 isoform=CRA_a"
FT                   /db_xref="GOA:D6RGA8"
FT                   /db_xref="MGI:MGI:1919133"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGA8"
FT                   /protein_id="EDL20284.1"
FT   assembly_gap    4830322..4830466
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            complement(4849158..>4888434)
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /note="gene_id=mCG1092.2"
FT   mRNA            complement(join(4849158..4849787,4860086..4860200,
FT                   4860969..4861075,4861671..4861764,4864251..4864419,
FT                   4867685..4867858,4877408..4877533,4880080..4880225,
FT                   4888121..4888410))
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, transcript variant mCT8761"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT8761.1 created on
FT                   10-DEC-2002"
FT   mRNA            complement(join(4849599..4849787,4853768..4853914,
FT                   4857612..4857730,4860086..4860200,4860969..4861075,
FT                   4861671..4861764,4862938..4862985,4864251..4864419,
FT                   4867685..4867858,4877408..4877533,4880080..4880225,
FT                   4888121..>4888404))
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, transcript variant mCT191401"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT191401.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4849628..4849787,4853768..4853914,
FT                   4857612..4857730,4860086..4860200,4860969..4861075,
FT                   4861671..4861764,4862938..4862985,4864251..4864419,
FT                   4867685..4867858,4877408..4877533,4880080..4880225,
FT                   4888121..>4888404))
FT                   /codon_start=1
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, isoform CRA_a"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT191401.0
FT                   protein_id=mCP112356.0 isoform=CRA_a"
FT                   /protein_id="EDL20281.1"
FT   CDS             complement(join(4849746..4849787,4860086..4860200,
FT                   4860969..4861075,4861671..4861764,4864251..4864419,
FT                   4867685..4867858,4877408..4877533,4880080..4880225,
FT                   4888121..4888323))
FT                   /codon_start=1
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, isoform CRA_c"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT8761.1
FT                   protein_id=mCP12433.2 isoform=CRA_c"
FT                   /protein_id="EDL20283.1"
FT   mRNA            complement(join(4853369..4853914,4857612..4857730,
FT                   4860086..4860200,4860969..4861075,4861671..4861764,
FT                   4862938..4862985,4864251..4864419,4867685..4867858,
FT                   4877408..4877533,4880080..4880225,4888121..>4888434))
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, transcript variant mCT191402"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT191402.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4853764..4853914,4857612..4857730,
FT                   4860086..4860200,4860969..4861075,4861671..4861764,
FT                   4862938..4862985,4864251..4864419,4867685..4867858,
FT                   4877408..4877533,4880080..4880225,4888121..>4888434))
FT                   /codon_start=1
FT                   /gene="Hpse"
FT                   /locus_tag="mCG_1092"
FT                   /product="heparanase, isoform CRA_b"
FT                   /note="gene_id=mCG1092.2 transcript_id=mCT191402.0
FT                   protein_id=mCP112357.0 isoform=CRA_b"
FT                   /protein_id="EDL20282.1"
FT                   LSK"
FT   assembly_gap    4864117..4864150
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    4869859..4869927
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    4871362..4871381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4889191..4889473
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    4910421..4914920
FT                   /estimated_length=4500
FT                   /gap_type="unknown"
FT   assembly_gap    4917712..4917731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4921657..4922150
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    4925476..4925495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4928127..4928245
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            complement(4931604..4968042)
FT                   /locus_tag="mCG_128467"
FT                   /note="gene_id=mCG128467.1"
FT   mRNA            complement(join(4931604..4932082,4934387..4934521,
FT                   4936134..4936247,4937728..4937901,4939843..4939941,
FT                   4941179..4941336,4943390..4943609,4948177..4948281,
FT                   4948597..4948738,4952406..4952645,4954730..4954875,
FT                   4956443..4956541,4959596..4959693,4960794..4960866,
FT                   4961234..4961434,4965811..4966519,4967751..4968042))
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, transcript variant mCT129765"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT129765.1
FT                   created on 18-MAR-2003"
FT   mRNA            complement(join(4931604..4932082,4934387..4934521,
FT                   4936134..4936247,4937728..4937901,4939852..4939941,
FT                   4941179..4941336,4943390..4943609,4948177..4948281,
FT                   4948597..4948738,4952406..4952645,4954730..4954875,
FT                   4956443..4956541,4959596..4959693,4960794..4960866,
FT                   4961234..4961434,4962121..4962299,4965811..4966519,
FT                   4967751..4968017))
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, transcript variant mCT181372"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181372.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4931945..4932082,4934387..4934521,
FT                   4936134..4936247,4937728..4937901,4939852..4939941,
FT                   4941179..4941336,4943390..4943609,4948177..4948281,
FT                   4948597..4948738,4952406..4952645,4954730..4954875,
FT                   4956443..4956541,4959596..4959693,4960794..4960866,
FT                   4961234..4961434,4962121..4962299,4965811..4966519,
FT                   4967751..4967930))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, isoform CRA_b"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181372.0
FT                   protein_id=mCP104295.0 isoform=CRA_b"
FT                   /protein_id="EDL20278.1"
FT                   GGPSSERAGSHAGDVTLS"
FT   mRNA            complement(join(4940993..4941336,4943390..4943482,
FT                   4948177..4948281,4948597..4948738,4952406..4952645,
FT                   4954730..4954875,4956443..4956541,4959596..4959693,
FT                   4960794..4960866,4961234..4961434,4962121..4962297))
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, transcript variant mCT181373"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181373.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4943435..4943482,4948177..4948281,
FT                   4948597..4948738,4952406..4952645,4954730..4954875,
FT                   4956443..4956541,4959596..4959693,4960794..4960866,
FT                   4961234..4961434,4962121..4962195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, isoform CRA_c"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181373.0
FT                   protein_id=mCP104294.0 isoform=CRA_c"
FT                   /protein_id="EDL20279.1"
FT                   KTAVATMRG"
FT   mRNA            complement(join(4947829..4948281,4948597..4948738,
FT                   4952406..4952645,4954730..4954875,4956443..4956541,
FT                   4959596..4959693,4960794..4960866,4961234..4961434,
FT                   4962121..4962297))
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, transcript variant mCT181374"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181374.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4948138..4948281,4948597..4948738,
FT                   4952406..4952645,4954730..4954875,4956443..4956541,
FT                   4959596..4959693,4960794..4960866,4961234..4961434,
FT                   4962121..4962195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, isoform CRA_d"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT181374.0
FT                   protein_id=mCP104296.0 isoform=CRA_d"
FT                   /protein_id="EDL20280.1"
FT                   LMMSIT"
FT   CDS             complement(join(4961388..4961434,4965811..4966519,
FT                   4967751..4967930))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128467"
FT                   /product="mCG128467, isoform CRA_a"
FT                   /note="gene_id=mCG128467.1 transcript_id=mCT129765.1
FT                   protein_id=mCP62455.1 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:2176740"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKT5"
FT                   /protein_id="EDL20277.1"
FT   gene            4968197..4973981
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /note="gene_id=mCG1083.2"
FT   mRNA            join(4968197..4968317,4971365..4971448,4972510..4972567,
FT                   4973426..4973485,4973788..4973921)
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, transcript
FT                   variant mCT181361"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181361.0 created
FT                   on 18-MAR-2003"
FT   mRNA            join(4968197..4968317,4969009..4969070,4971369..4971448,
FT                   4972510..4972567,4973426..4973485,4973788..4973867)
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, transcript
FT                   variant mCT181362"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181362.0 created
FT                   on 18-MAR-2003"
FT   mRNA            join(4968203..4968317,4969009..4969070,4971365..4971448,
FT                   4972510..4972567,4973426..4973925)
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, transcript
FT                   variant mCT181360"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181360.0 created
FT                   on 18-MAR-2003"
FT   mRNA            join(4968207..4968317,4969009..4969070,4971365..4971448,
FT                   4972510..4972567,4973426..4973485,4973788..4973981)
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, transcript
FT                   variant mCT8752"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT8752.2 created on
FT                   18-MAR-2003"
FT   CDS             join(4968227..4968317,4969009..4969070,4971365..4971448,
FT                   4972510..4972567,4973426..4973485,4973788..4973864)
FT                   /codon_start=1
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT8752.2
FT                   protein_id=mCP12446.2 isoform=CRA_c"
FT                   /protein_id="EDL20276.1"
FT   CDS             join(4968227..4968317,4969009..4969070,4971365..4971448,
FT                   4972510..4972567,4973426..4973517)
FT                   /codon_start=1
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181360.0
FT                   protein_id=mCP104282.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTZ9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="MGI:MGI:1915985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTZ9"
FT                   /protein_id="EDL20273.1"
FT   CDS             join(4971374..4971448,4972510..4972567,4973426..4973485,
FT                   4973788..4973864)
FT                   /codon_start=1
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181361.0
FT                   protein_id=mCP104283.0 isoform=CRA_b"
FT                   /protein_id="EDL20274.1"
FT   CDS             join(4971374..4971448,4972510..4972567,4973426..4973485,
FT                   4973788..4973864)
FT                   /codon_start=1
FT                   /gene="Mrps18c"
FT                   /locus_tag="mCG_1083"
FT                   /product="mitochondrial ribosomal protein S18C, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1083.2 transcript_id=mCT181362.0
FT                   protein_id=mCP104284.0 isoform=CRA_b"
FT                   /protein_id="EDL20275.1"
FT   gene            complement(4974258..4990392)
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /note="gene_id=mCG1091.2"
FT   mRNA            complement(join(4974258..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979291,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..>4990391))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT8760"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT8760.2 created on
FT                   12-FEB-2003"
FT   mRNA            complement(join(4974258..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979303,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..>4990366))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT191400"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT191400.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4974258..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979303,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4990260..4990361))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT180569"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180569.0 created
FT                   on 12-FEB-2003"
FT   mRNA            complement(join(4974651..4974907,4975354..4975945,
FT                   4976235..4976346,4978982..4979071,4979184..4979303,
FT                   4981437..4981630,4984590..4984656,4987390..4987426,
FT                   4990260..>4990369))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT191399"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT191399.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4974659..4974907,4975354..4975945,
FT                   4976235..4976346,4978987..4979071,4979184..4979303,
FT                   4981437..4981630,4984590..4984656,4987390..4987426,
FT                   4987946..4988036,4990260..4990369))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT180567"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180567.0 created
FT                   on 12-FEB-2003"
FT   mRNA            complement(join(4975241..4975945,4976235..4976346,
FT                   4977331..4977395,4978987..4979071,4979184..4979303,
FT                   4981437..4981630,4984590..4984656,4987390..4987426,
FT                   4987946..4988036,4990260..4990392))
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, transcript
FT                   variant mCT180568"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180568.0 created
FT                   on 12-FEB-2003"
FT   CDS             complement(join(4975515..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979291,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..4990391))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_f"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT8760.2
FT                   protein_id=mCP12435.2 isoform=CRA_f"
FT                   /protein_id="EDL20272.1"
FT   CDS             complement(join(4975515..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979303,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..>4990364))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_e"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT191400.0
FT                   protein_id=mCP112355.0 isoform=CRA_e"
FT                   /protein_id="EDL20271.1"
FT                   SPEDDADYPRSPTF"
FT   CDS             complement(join(4975515..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979303,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..4990346))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_a"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180567.0
FT                   protein_id=mCP103491.0 isoform=CRA_a"
FT                   /protein_id="EDL20267.1"
FT                   DYPRSPTF"
FT   CDS             complement(join(4975515..4975945,4976235..4976346,
FT                   4978987..4979071,4979184..4979303,4981437..4981585))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_c"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180569.0
FT                   protein_id=mCP103489.0 isoform=CRA_c"
FT                   /protein_id="EDL20269.1"
FT                   EMGSPEDDADYPRSPTF"
FT   CDS             complement(join(4976307..4976346,4977331..4977395,
FT                   4978987..4979071,4979184..4979303,4981437..4981630,
FT                   4984590..4984656,4987390..4987426,4987946..4988036,
FT                   4990260..4990391))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_b"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT180568.0
FT                   protein_id=mCP103490.0 isoform=CRA_b"
FT                   /protein_id="EDL20268.1"
FT   CDS             complement(join(4976307..4976346,4978982..4979071,
FT                   4979184..4979303,4981437..4981630,4984590..4984656,
FT                   4987390..4987426,4990260..>4990368))
FT                   /codon_start=1
FT                   /gene="Ccdc98"
FT                   /locus_tag="mCG_1091"
FT                   /product="coiled-coil domain containing 98, isoform CRA_d"
FT                   /note="gene_id=mCG1091.2 transcript_id=mCT191399.0
FT                   protein_id=mCP112354.0 isoform=CRA_d"
FT                   /protein_id="EDL20270.1"
FT   assembly_gap    4978148..4978167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5009880..>5015249)
FT                   /locus_tag="mCG_142645"
FT                   /note="gene_id=mCG142645.0"
FT   mRNA            complement(join(5009880..5010925,5014257..>5015249))
FT                   /locus_tag="mCG_142645"
FT                   /product="mCG142645"
FT                   /note="gene_id=mCG142645.0 transcript_id=mCT181346.0
FT                   created on 17-MAR-2003"
FT   CDS             complement(5010341..>5010628)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142645"
FT                   /product="mCG142645"
FT                   /note="gene_id=mCG142645.0 transcript_id=mCT181346.0
FT                   protein_id=mCP104268.0"
FT                   /protein_id="EDL20266.1"
FT   gene            5015267..5062145
FT                   /gene="A230097K15Rik"
FT                   /locus_tag="mCG_53027"
FT                   /note="gene_id=mCG53027.2"
FT   mRNA            join(5015267..5015498,5015609..5015694,5015792..5016085,
FT                   5026290..5026334,5045949..5046219,5047046..5047120,
FT                   5047688..5047777,5048653..5048746,5052934..5053049,
FT                   5054474..5054529,5055132..5055217,5055898..5056026,
FT                   5056259..5056338,5060766..5062145)
FT                   /gene="A230097K15Rik"
FT                   /locus_tag="mCG_53027"
FT                   /product="RIKEN cDNA A230097K15"
FT                   /note="gene_id=mCG53027.2 transcript_id=mCT53210.2 created
FT                   on 17-MAR-2003"
FT   assembly_gap    5018164..5020639
FT                   /estimated_length=2476
FT                   /gap_type="unknown"
FT   assembly_gap    5026335..5026524
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    5027583..5027602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5029646..5029665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5035094..5035113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5036549..5041476
FT                   /estimated_length=4928
FT                   /gap_type="unknown"
FT   assembly_gap    5044409..5044428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5045975..5046219,5047046..5047120,5047688..5047777,
FT                   5048653..5048746,5052934..5053049,5054474..5054529,
FT                   5055132..5055217,5055898..5056026,5056259..5056338,
FT                   5060766..5060877)
FT                   /codon_start=1
FT                   /gene="A230097K15Rik"
FT                   /locus_tag="mCG_53027"
FT                   /product="RIKEN cDNA A230097K15"
FT                   /note="gene_id=mCG53027.2 transcript_id=mCT53210.2
FT                   protein_id=mCP34062.2"
FT                   /protein_id="EDL20265.1"
FT   gene            complement(5073045..5076748)
FT                   /locus_tag="mCG_1030744"
FT                   /note="gene_id=mCG1030744.1"
FT   mRNA            complement(join(5073045..5073432,5074652..5075087,
FT                   5076653..5076748))
FT                   /locus_tag="mCG_1030744"
FT                   /product="mCG1030744"
FT                   /note="gene_id=mCG1030744.1 transcript_id=mCT148448.1
FT                   created on 17-MAR-2003"
FT   CDS             complement(join(5073377..5073432,5074652..5074739))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030744"
FT                   /product="mCG1030744"
FT                   /note="gene_id=mCG1030744.1 transcript_id=mCT148448.1
FT                   protein_id=mCP63275.1"
FT                   /protein_id="EDL20264.1"
FT                   QR"
FT   assembly_gap    5078942..5079557
FT                   /estimated_length=616
FT                   /gap_type="unknown"
FT   assembly_gap    5088629..5088648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5097431..5097450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5099197..5099368
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    5126917..5126936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5149888..5149907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5198512..5198605
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    5202039..5202058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5213661..5214284
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    5237031..5237721
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    5258022..5258062
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    5269491..5269510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5323486..5323505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5340072..5340091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5342319..5342338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5352395..5352426
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    5359634..5359653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5378056..5378239
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    5380448..5380532
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            complement(5392369..>5402833)
FT                   /locus_tag="mCG_145329"
FT                   /note="gene_id=mCG145329.0"
FT   mRNA            complement(join(5392369..5393207,5397284..5397514,
FT                   5399290..5401691,5402732..>5402833))
FT                   /locus_tag="mCG_145329"
FT                   /product="mCG145329"
FT                   /note="gene_id=mCG145329.0 transcript_id=mCT184753.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(5400466..>5400903)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145329"
FT                   /product="mCG145329"
FT                   /note="gene_id=mCG145329.0 transcript_id=mCT184753.0
FT                   protein_id=mCP105447.0"
FT                   /protein_id="EDL20263.1"
FT   gene            5427680..5431567
FT                   /locus_tag="mCG_1030738"
FT                   /note="gene_id=mCG1030738.1"
FT   mRNA            join(5427680..5428311,5429134..5429226,5431001..5431567)
FT                   /locus_tag="mCG_1030738"
FT                   /product="mCG1030738"
FT                   /note="gene_id=mCG1030738.1 transcript_id=mCT148442.1
FT                   created on 21-MAR-2003"
FT   CDS             join(5428116..5428311,5429134..5429156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030738"
FT                   /product="mCG1030738"
FT                   /note="gene_id=mCG1030738.1 transcript_id=mCT148442.1
FT                   protein_id=mCP63172.1"
FT                   /protein_id="EDL20262.1"
FT   assembly_gap    5432265..5432771
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    5439342..5442432
FT                   /estimated_length=3091
FT                   /gap_type="unknown"
FT   assembly_gap    5462038..5462057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5463633..5463652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5469437..5469735
FT                   /pseudo
FT                   /locus_tag="mCG_1021"
FT                   /note="gene_id=mCG1021.2"
FT   mRNA            5469437..5469735
FT                   /pseudo
FT                   /locus_tag="mCG_1021"
FT                   /note="gene_id=mCG1021.2 transcript_id=mCT8648.2 created on
FT                   21-MAR-2003"
FT   assembly_gap    5476486..5481113
FT                   /estimated_length=4628
FT                   /gap_type="unknown"
FT   assembly_gap    5506478..5507733
FT                   /estimated_length=1256
FT                   /gap_type="unknown"
FT   assembly_gap    5526245..5526472
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    5541090..5541310
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    5542531..5542550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5559059..5559569
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    5565349..5566091
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    5595301..5595320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5605500..5605570
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5614116..5614298
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    5617273..5617565
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    5625924..5627344
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   assembly_gap    5639278..5639345
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    5664052..5664094
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    5676360..5676696
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    5681174..5681468
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    5683491..5683610
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5685562..5685975
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5714248..5714701
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    5717620..5717639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5718787..5718806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5726170..5726197
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    5747940..5748050
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    5754167..5754308
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    5760614..5760675
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    5777641..5777775
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    5798542..5798634
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(5825034..>5829784)
FT                   /gene="Nkx6-1"
FT                   /locus_tag="mCG_1016"
FT                   /note="gene_id=mCG1016.2"
FT   mRNA            complement(join(5825034..5825487,5827692..5827864,
FT                   5829420..>5829784))
FT                   /gene="Nkx6-1"
FT                   /locus_tag="mCG_1016"
FT                   /product="NK6 transcription factor related, locus 1
FT                   (Drosophila)"
FT                   /note="gene_id=mCG1016.2 transcript_id=mCT8643.2 created on
FT                   10-DEC-2002"
FT   CDS             complement(join(5825236..5825487,5827692..5827864,
FT                   5829420..>5829783))
FT                   /codon_start=1
FT                   /gene="Nkx6-1"
FT                   /locus_tag="mCG_1016"
FT                   /product="NK6 transcription factor related, locus 1
FT                   (Drosophila)"
FT                   /note="gene_id=mCG1016.2 transcript_id=mCT8643.2
FT                   protein_id=mCP12451.2"
FT                   /protein_id="EDL20261.1"
FT   assembly_gap    5826876..5827233
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    5829785..5840274
FT                   /estimated_length=10490
FT                   /gap_type="unknown"
FT   assembly_gap    5842777..5842796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5854917..5855607
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    5861911..5861948
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    5862628..5863490
FT                   /estimated_length=863
FT                   /gap_type="unknown"
FT   assembly_gap    5865575..5865623
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    5867632..5867651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5868803..5869004
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            <5869136..5871384
FT                   /locus_tag="mCG_1030734"
FT                   /note="gene_id=mCG1030734.0"
FT   mRNA            join(<5869136..5869644,5870732..5871384)
FT                   /locus_tag="mCG_1030734"
FT                   /product="mCG1030734"
FT                   /note="gene_id=mCG1030734.0 transcript_id=mCT148438.0
FT                   created on 21-MAR-2003"
FT   CDS             <5870942..5871217
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030734"
FT                   /product="mCG1030734"
FT                   /note="gene_id=mCG1030734.0 transcript_id=mCT148438.0
FT                   protein_id=mCP63114.0"
FT                   /protein_id="EDL20260.1"
FT   assembly_gap    5876546..5876565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5886371..5886561
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    5900369..5900423
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5904747..5904766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5906064..5906189
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            5930417..5989561
FT                   /gene="Cds1"
FT                   /locus_tag="mCG_1014"
FT                   /note="gene_id=mCG1014.2"
FT   mRNA            join(5930417..5930774,5946675..5946802,5957179..5957275,
FT                   5962708..5962805,5964081..5964220,5972267..5972325,
FT                   5974370..5974452,5975590..5975677,5978199..5978267,
FT                   5980104..5980256,5981553..5981672,5983557..5983660,
FT                   5987138..5989561)
FT                   /gene="Cds1"
FT                   /locus_tag="mCG_1014"
FT                   /product="CDP-diacylglycerol synthase 1"
FT                   /note="gene_id=mCG1014.2 transcript_id=mCT8641.2 created on
FT                   21-MAR-2003"
FT   CDS             join(5930658..5930774,5946675..5946802,5957179..5957275,
FT                   5962708..5962805,5964081..5964220,5972267..5972325,
FT                   5974370..5974452,5975590..5975677,5978199..5978267,
FT                   5980104..5980256,5981553..5981672,5983557..5983660,
FT                   5987138..5987267)
FT                   /codon_start=1
FT                   /gene="Cds1"
FT                   /locus_tag="mCG_1014"
FT                   /product="CDP-diacylglycerol synthase 1"
FT                   /note="gene_id=mCG1014.2 transcript_id=mCT8641.2
FT                   protein_id=mCP12441.2"
FT                   /protein_id="EDL20259.1"
FT                   LKV"
FT   assembly_gap    5934357..5934382
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5947519..5947538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5994146..5994995
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   gene            complement(5998652..>6092170)
FT                   /locus_tag="mCG_126751"
FT                   /note="gene_id=mCG126751.1"
FT   mRNA            complement(join(5998652..6001973,6009709..6009906,
FT                   6010240..6010351,6010613..6010936,6012795..6012891,
FT                   6014015..6014197,6014961..6015140,6016932..6017090,
FT                   6017916..6018070,6018201..6018348,6021082..6021294,
FT                   6021498..6021589,6024158..6024311,6026159..6026265,
FT                   6027102..6027219,6029515..6029634,6029815..6029869,
FT                   6031935..6032015,6033232..6033317,6033771..6033891,
FT                   6035669..6035817,6038540..6038703,6041549..6041717,
FT                   6043714..6043767,6048131..6048358,6049751..6049908,
FT                   6050839..6051021,6052669..6052778,6053795..6054024,
FT                   6054894..6055054,6056458..6056557,6060620..6060853,
FT                   6062108..6062287,6064136..6064270,6065723..6065958,
FT                   6067480..6067697,6068149..6068269,6071813..6071907,
FT                   6073158..6073319,6073395..6073468,6076636..6076788,
FT                   6077747..6077937,6078882..6078993,6081048..6081208,
FT                   6083033..6083264,6085030..6085211,6088048..6088266,
FT                   6088389..6088489,6089490..6089721,6092058..>6092170))
FT                   /locus_tag="mCG_126751"
FT                   /product="mCG126751"
FT                   /note="gene_id=mCG126751.1 transcript_id=mCT128029.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(6001850..6001973,6009709..6009906,
FT                   6010240..6010351,6010613..6010936,6012795..6012891,
FT                   6014015..6014197,6014961..6015140,6016932..6017090,
FT                   6017916..6018070,6018201..6018348,6021082..6021294,
FT                   6021498..6021589,6024158..6024311,6026159..6026265,
FT                   6027102..6027219,6029515..6029634,6029815..6029869,
FT                   6031935..6032015,6033232..6033317,6033771..6033891,
FT                   6035669..6035817,6038540..6038703,6041549..6041717,
FT                   6043714..6043767,6048131..6048358,6049751..6049908,
FT                   6050839..6051021,6052669..6052778,6053795..6054024,
FT                   6054894..6055054,6056458..6056557,6060620..6060853,
FT                   6062108..6062287,6064136..6064270,6065723..6065958,
FT                   6067480..6067697,6068149..6068269,6071813..6071907,
FT                   6073158..6073319,6073395..6073468,6076636..6076788,
FT                   6077747..6077937,6078882..6078993,6081048..6081208,
FT                   6083033..6083264,6085030..6085211,6088048..6088266,
FT                   6088389..6088489,6089490..6089721,6092058..>6092169))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126751"
FT                   /product="mCG126751"
FT                   /note="gene_id=mCG126751.1 transcript_id=mCT128029.1
FT                   protein_id=mCP63225.1"
FT                   /protein_id="EDL20258.1"
FT   assembly_gap    6025904..6025923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6034948..6034967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6094941..6207040)
FT                   /locus_tag="mCG_142647"
FT                   /note="gene_id=mCG142647.0"
FT   mRNA            complement(join(6094941..6095729,6096462..6096639,
FT                   6102916..6103373,6107074..6107267,6108654..6108755,
FT                   6109515..6109982,6114442..6114608,6116859..6117045,
FT                   6118615..6118807,6123018..6123179,6126750..6126859,
FT                   6134501..6134624,6147032..6147242,6175438..6175536,
FT                   6206951..6207040))
FT                   /locus_tag="mCG_142647"
FT                   /product="mCG142647"
FT                   /note="gene_id=mCG142647.0 transcript_id=mCT181354.0
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(6095511..6095729,6096462..6096639,
FT                   6102916..6103373,6107074..6107267,6108654..6108755,
FT                   6109515..6109982,6114442..6114608,6116859..6117045,
FT                   6118615..6118807,6123018..6123179,6126750..6126859,
FT                   6134501..6134624,6147032..6147211))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142647"
FT                   /product="mCG142647"
FT                   /note="gene_id=mCG142647.0 transcript_id=mCT181354.0
FT                   protein_id=mCP104276.0"
FT                   /protein_id="EDL20257.1"
FT   assembly_gap    6143254..6143273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6174814..6174833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6178323..6178555
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    6205232..6205357
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    6215595..6215622
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    6234627..6235316
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    6282444..6282505
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    6316430..6316449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6318580..6318672
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6335586..6335732
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    6336613..6336978
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    6357574..6357593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6366283..6366772
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    6373406..6373425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6381984..6382113
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    6385193..6385962
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   assembly_gap    6388903..6388922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6403704..6403760
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    6409642..6409661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6432733..6432752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6473233..6474141
FT                   /estimated_length=909
FT                   /gap_type="unknown"
FT   assembly_gap    6502415..6503361
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   assembly_gap    6510384..6510403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6512333..6512537
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    6548668..6548861
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    6554334..6554353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6571822..6578712
FT                   /estimated_length=6891
FT                   /gap_type="unknown"
FT   assembly_gap    6579777..6579796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6581114..6581165
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    6595251..6595333
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    6603381..6604982
FT                   /estimated_length=1602
FT                   /gap_type="unknown"
FT   assembly_gap    6639325..6639344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6641001..6641051
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            6644015..7053253
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /note="gene_id=mCG141814.0"
FT   mRNA            join(6644015..6644389,6822724..6822811,6996746..6996868,
FT                   7015782..7015989,7031147..7031279,7033893..7033966,
FT                   7036068..7036189,7047157..7048234,7052399..7053253)
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, transcript
FT                   variant mCT176834"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176834.0
FT                   created on 06-DEC-2002"
FT   mRNA            join(6644061..6644389,6715500..6715693,6822724..6822811,
FT                   6996746..6996868,7015782..7015989,7031147..7031279,
FT                   7033893..7033966,7036068..7036189,7047157..7048234,
FT                   7052399..7053139)
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, transcript
FT                   variant mCT176835"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176835.0
FT                   created on 06-DEC-2002"
FT   assembly_gap    6647502..6647521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6655278..6656331
FT                   /estimated_length=1054
FT                   /gap_type="unknown"
FT   assembly_gap    6664198..6665211
FT                   /estimated_length=1014
FT                   /gap_type="unknown"
FT   assembly_gap    6667139..6667171
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    6672177..6672196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6695274..6695338
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    6705593..6705612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6710793..6710986
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   CDS             join(6715520..6715693,6822724..6822811,6996746..6996868,
FT                   7015782..7015989,7031147..7031279,7033893..7033966,
FT                   7036068..7036189,7047157..7048234,7052399..7052642)
FT                   /codon_start=1
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, isoform CRA_b"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176835.0
FT                   protein_id=mCP99755.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9N1"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1922647"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9N1"
FT                   /protein_id="EDL20255.1"
FT   assembly_gap    6730413..6730432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6766928..6768693
FT                   /estimated_length=1766
FT                   /gap_type="unknown"
FT   assembly_gap    6777243..6777502
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    6799348..6799809
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    6803504..6803523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6804546..6804565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6811579..6811671
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6813782..6814456
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    6818795..6818814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6869282..6869301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6882240..6882259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6904180..6904199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(6924097..6924287,6996746..6996868,7015782..7015989,
FT                   7031147..7031279,7033893..7033966,7036068..7036189,
FT                   7047157..7048234,7052399..7053139)
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, transcript
FT                   variant mCT176833"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176833.0
FT                   created on 06-DEC-2002"
FT   mRNA            join(6964357..6964499,6996746..6996868,7015782..7015989,
FT                   7031147..7031279,7033893..7033966,7036068..7036189,
FT                   7047157..7048234,7052399..7053139)
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, transcript
FT                   variant mCT176836"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176836.0
FT                   created on 06-DEC-2002"
FT   assembly_gap    6972160..6972245
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    6989505..6989524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6994578..6994851
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   CDS             join(6996763..6996868,7015782..7015989,7031147..7031279,
FT                   7033893..7033966,7036068..7036189,7047157..7048234,
FT                   7052399..7052642)
FT                   /codon_start=1
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, isoform CRA_a"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176833.0
FT                   protein_id=mCP99756.0 isoform=CRA_a"
FT                   /protein_id="EDL20253.1"
FT   CDS             join(6996763..6996868,7015782..7015989,7031147..7031279,
FT                   7033893..7033966,7036068..7036189,7047157..7048234,
FT                   7052399..7052642)
FT                   /codon_start=1
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, isoform CRA_a"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176834.0
FT                   protein_id=mCP99757.0 isoform=CRA_a"
FT                   /protein_id="EDL20254.1"
FT   CDS             join(6996763..6996868,7015782..7015989,7031147..7031279,
FT                   7033893..7033966,7036068..7036189,7047157..7048234,
FT                   7052399..7052642)
FT                   /codon_start=1
FT                   /gene="Arhgap24"
FT                   /locus_tag="mCG_141814"
FT                   /product="Rho GTPase activating protein 24, isoform CRA_a"
FT                   /note="gene_id=mCG141814.0 transcript_id=mCT176836.0
FT                   protein_id=mCP99758.0 isoform=CRA_a"
FT                   /protein_id="EDL20256.1"
FT   assembly_gap    7035287..7035621
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    7036662..7036681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7067684..>7365191)
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /note="gene_id=mCG127089.2"
FT   mRNA            complement(join(7067684..7068642,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212667..7212738,7359744..7359858,7364808..>7365191))
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, transcript
FT                   variant mCT191322"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT191322.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(7067684..7068642,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212640..7212738,7359744..7359858,7364808..>7365178))
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, transcript
FT                   variant mCT191323"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT191323.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(7067684..7068647,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212667..7212738,7359744..7359858,7364808..7364995))
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, transcript
FT                   variant mCT128370"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT128370.1
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(7068500..7068642,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212667..7212738,7359744..>7359761))
FT                   /codon_start=1
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT191322.0
FT                   protein_id=mCP112265.0 isoform=CRA_a"
FT                   /protein_id="EDL20250.1"
FT                   SSLEASAGPLGCCR"
FT   CDS             complement(join(7068500..7068642,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212640..>7212645))
FT                   /codon_start=1
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT191323.0
FT                   protein_id=mCP112266.0 isoform=CRA_b"
FT                   /protein_id="EDL20251.1"
FT   CDS             complement(join(7068631..7068647,7081387..7081464,
FT                   7083538..7083601,7117983..7118107,7120962..7121144,
FT                   7141702..7141773,7144119..7144284,7144993..7145131,
FT                   7146358..7146416,7151073..7151202,7192862..7193031,
FT                   7212667..7212732))
FT                   /codon_start=1
FT                   /gene="Mapk10"
FT                   /locus_tag="mCG_127089"
FT                   /product="mitogen activated protein kinase 10, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG127089.2 transcript_id=mCT128370.1
FT                   protein_id=mCP62300.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q80W82"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008351"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346863"
FT                   /db_xref="UniProtKB/TrEMBL:Q80W82"
FT                   /protein_id="EDL20252.1"
FT   assembly_gap    7092046..7092755
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    7105783..7106227
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    7131107..7131178
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    7158825..7158844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7214268..7214287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7229970..7229989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7237205..7237224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7238541..7238567
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    7275443..7282254
FT                   /estimated_length=6812
FT                   /gap_type="unknown"
FT   assembly_gap    7296797..7296816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7332263..7332702
FT                   /pseudo
FT                   /locus_tag="mCG_50992"
FT                   /note="gene_id=mCG50992.2"
FT   mRNA            7332263..7332702
FT                   /pseudo
FT                   /locus_tag="mCG_50992"
FT                   /note="gene_id=mCG50992.2 transcript_id=mCT51175.2 created
FT                   on 21-MAR-2003"
FT   assembly_gap    7369282..7369301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7372443..7372510
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    7374004..7374036
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(7384230..>7451830)
FT                   /locus_tag="mCG_145310"
FT                   /note="gene_id=mCG145310.0"
FT   mRNA            complement(join(7384230..7385288,7394574..7394653,
FT                   7408238..7408280,7435283..7435383,7439825..7439964,
FT                   7440970..7441098,7451758..>7451830))
FT                   /locus_tag="mCG_145310"
FT                   /product="mCG145310"
FT                   /note="gene_id=mCG145310.0 transcript_id=mCT184734.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(7385249..7385288,7394574..7394653,
FT                   7408238..7408280,7435283..7435383,7439825..>7439863))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145310"
FT                   /product="mCG145310"
FT                   /note="gene_id=mCG145310.0 transcript_id=mCT184734.0
FT                   protein_id=mCP105428.0"
FT                   /protein_id="EDL20249.1"
FT   assembly_gap    7408510..7408892
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    7410932..7410951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7412220..7412291
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    7430264..7430283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7442798..7442817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7452794..7452813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7468952..7469106
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    7472158..7472187
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7493689..7493885
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    7495191..7495522
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            7499455..7501159
FT                   /locus_tag="mCG_147652"
FT                   /note="gene_id=mCG147652.0"
FT   mRNA            join(7499455..7499598,7500954..7501159)
FT                   /locus_tag="mCG_147652"
FT                   /product="mCG147652"
FT                   /note="gene_id=mCG147652.0 transcript_id=mCT187915.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7499535..7499598,7500954..7501048)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147652"
FT                   /product="mCG147652"
FT                   /note="gene_id=mCG147652.0 transcript_id=mCT187915.0
FT                   protein_id=mCP109045.0"
FT                   /protein_id="EDL20248.1"
FT                   LWTDWKS"
FT   assembly_gap    7506927..7506953
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    7516507..7516655
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7517485..7517514
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7554110..7554351
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    7560428..7560447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7577888..7751072
FT                   /gene="Ptpn13"
FT                   /locus_tag="mCG_8763"
FT                   /note="gene_id=mCG8763.2"
FT   mRNA            join(7577888..7578199,7614861..7614980,7629380..7629558,
FT                   7639066..7639131,7641971..7642156,7644586..7644673,
FT                   7653728..7654273,7668715..7668810,7669876..7669957,
FT                   7676084..7676306,7678271..7678345,7678451..7678631,
FT                   7679513..7679666,7681281..7681419,7682165..7682317,
FT                   7685841..7686023,7689495..7689657,7693753..7694167,
FT                   7694303..7694397,7696189..7696245,7703006..7703095,
FT                   7703530..7703637,7703828..7703959,7707477..7707934,
FT                   7708808..7708939,7710599..7710692,7711857..7711942,
FT                   7712591..7712753,7714652..7714866,7714995..7715093,
FT                   7716731..7717059,7717835..7718009,7720746..7720904,
FT                   7722150..7722321,7722418..7722628,7725810..7725877,
FT                   7727799..7727860,7731592..7731685,7732417..7732554,
FT                   7733390..7733472,7735459..7735496,7739426..7739529,
FT                   7740763..7740911,7742578..7742668,7743736..7744073,
FT                   7746227..7746442,7747337..7747399,7750413..7751072)
FT                   /gene="Ptpn13"
FT                   /locus_tag="mCG_8763"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   13"
FT                   /note="gene_id=mCG8763.2 transcript_id=mCT8827.2 created on
FT                   05-NOV-2002"
FT   assembly_gap    7583674..7583693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7598060..7598975
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   CDS             join(7614866..7614980,7629380..7629558,7639066..7639131,
FT                   7641971..7642156,7644586..7644673,7653728..7654273,
FT                   7668715..7668810,7669876..7669957,7676084..7676306,
FT                   7678271..7678345,7678451..7678631,7679513..7679666,
FT                   7681281..7681419,7682165..7682317,7685841..7686023,
FT                   7689495..7689657,7693753..7694167,7694303..7694397,
FT                   7696189..7696245,7703006..7703095,7703530..7703637,
FT                   7703828..7703959,7707477..7707934,7708808..7708939,
FT                   7710599..7710692,7711857..7711942,7712591..7712753,
FT                   7714652..7714866,7714995..7715093,7716731..7717059,
FT                   7717835..7718009,7720746..7720904,7722150..7722321,
FT                   7722418..7722628,7725810..7725877,7727799..7727860,
FT                   7731592..7731685,7732417..7732554,7733390..7733472,
FT                   7735459..7735496,7739426..7739529,7740763..7740911,
FT                   7742578..7742668,7743736..7744073,7746227..7746442,
FT                   7747337..7747399,7750413..7750505)
FT                   /codon_start=1
FT                   /gene="Ptpn13"
FT                   /locus_tag="mCG_8763"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   13"
FT                   /note="gene_id=mCG8763.2 transcript_id=mCT8827.2
FT                   protein_id=mCP12440.2"
FT                   /db_xref="GOA:G5E8B1"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR011019"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012153"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:103293"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8B1"
FT                   /protein_id="EDL20246.1"
FT   assembly_gap    7631296..7631561
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            complement(7663802..>7685646)
FT                   /locus_tag="mCG_145981"
FT                   /note="gene_id=mCG145981.0"
FT   mRNA            complement(join(7663802..7665887,7668741..7668840,
FT                   7682896..7683225,7685500..>7685646))
FT                   /locus_tag="mCG_145981"
FT                   /product="mCG145981"
FT                   /note="gene_id=mCG145981.0 transcript_id=mCT186089.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(7664188..>7664529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145981"
FT                   /product="mCG145981"
FT                   /note="gene_id=mCG145981.0 transcript_id=mCT186089.0
FT                   protein_id=mCP107406.0"
FT                   /protein_id="EDL20247.1"
FT                   YHVLLLFGF"
FT   assembly_gap    7671966..7671985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7674268..7674287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7675327..7675346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7685022..7685282
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    7688452..7688654
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    7708384..7708403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7753694..7753713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7757550..7757569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7759247..7782145)
FT                   /gene="Slc10a6"
FT                   /locus_tag="mCG_1162"
FT                   /note="gene_id=mCG1162.1"
FT   mRNA            complement(join(7759247..7760282,7762516..7762673,
FT                   7770425..7770513,7771104..7771268,7781596..7782145))
FT                   /gene="Slc10a6"
FT                   /locus_tag="mCG_1162"
FT                   /product="solute carrier family 10 (sodium/bile acid
FT                   cotransporter family), member 6"
FT                   /note="gene_id=mCG1162.1 transcript_id=mCT8815.2 created on
FT                   06-DEC-2002"
FT   assembly_gap    7766082..7768449
FT                   /estimated_length=2368
FT                   /gap_type="unknown"
FT   CDS             complement(join(7770456..7770513,7771104..7771268,
FT                   7781596..7781972))
FT                   /codon_start=1
FT                   /gene="Slc10a6"
FT                   /locus_tag="mCG_1162"
FT                   /product="solute carrier family 10 (sodium/bile acid
FT                   cotransporter family), member 6"
FT                   /note="gene_id=mCG1162.1 transcript_id=mCT8815.2
FT                   protein_id=mCP12459.2"
FT                   /protein_id="EDL20245.1"
FT   assembly_gap    7784113..7784132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7794188..>7801286)
FT                   /locus_tag="mCG_145320"
FT                   /note="gene_id=mCG145320.0"
FT   mRNA            complement(join(7794188..7794549,7795015..7795169,
FT                   7800499..7800633,7801006..>7801286))
FT                   /locus_tag="mCG_145320"
FT                   /product="mCG145320"
FT                   /note="gene_id=mCG145320.0 transcript_id=mCT184744.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(7794416..7794549,7795015..7795169,
FT                   7800499..>7800572))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145320"
FT                   /product="mCG145320"
FT                   /note="gene_id=mCG145320.0 transcript_id=mCT184744.0
FT                   protein_id=mCP105438.0"
FT                   /protein_id="EDL20244.1"
FT                   SLREKKVGLRRPLQPK"
FT   assembly_gap    7800870..7800889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7807534..7807553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7809065..7809730
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    7842429..7842448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7845985..7846079
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    7852568..7853060
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    7859663..7860745
FT                   /estimated_length=1083
FT                   /gap_type="unknown"
FT   assembly_gap    7862578..7862597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7867040..7867059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7868312..7868331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7874148..7874167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7876423..7876442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7901405..7999062
FT                   /gene="Aff1"
FT                   /locus_tag="mCG_128201"
FT                   /note="gene_id=mCG128201.0"
FT   mRNA            join(<7901405..7901421,7930398..7930518,7930930..7931787,
FT                   7958262..7958306,7962181..7962267,7963412..7963448,
FT                   7966141..7966192,7973147..7973201,7973310..7973347,
FT                   7975749..7975911,7980871..7981860,7988496..7988593,
FT                   7989667..7989907,7990428..7990528,7990648..7990708,
FT                   7993674..7993807,7994476..7994547,7995154..7995297,
FT                   7996793..7997016,7998142..7999062)
FT                   /gene="Aff1"
FT                   /locus_tag="mCG_128201"
FT                   /product="AF4/FMR2 family, member 1, transcript variant
FT                   mCT129495"
FT                   /note="gene_id=mCG128201.0 transcript_id=mCT129495.1
FT                   created on 21-MAR-2003"
FT   CDS             join(7901405..7901421,7930398..7930518,7930930..7931787,
FT                   7958262..7958306,7962181..7962267,7963412..7963448,
FT                   7966141..7966192,7973147..7973201,7973310..7973347,
FT                   7975749..7975911,7980871..7981860,7988496..7988593,
FT                   7989667..7989907,7990428..7990528,7990648..7990708,
FT                   7993674..7993807,7994476..7994547,7995154..7995297,
FT                   7996793..7997016,7998142..7998263)
FT                   /codon_start=1
FT                   /gene="Aff1"
FT                   /locus_tag="mCG_128201"
FT                   /product="AF4/FMR2 family, member 1, isoform CRA_a"
FT                   /note="gene_id=mCG128201.0 transcript_id=mCT129495.1
FT                   protein_id=mCP63445.1 isoform=CRA_a"
FT                   /protein_id="EDL20242.1"
FT   mRNA            join(7901649..7901821,7930398..7930518,7930930..7931787,
FT                   7958262..7958306,7962181..7962267,7963412..7963448,
FT                   7966141..7966192,7973147..7973201,7973310..7973347,
FT                   7975749..7975911,7980871..7981860,7988496..7988593,
FT                   7989667..7989907,7990428..7990528,7990648..7990708,
FT                   7993674..7993807,7994476..7994547,7995154..7995297,
FT                   7996793..7997016,7998142..7998564)
FT                   /gene="Aff1"
FT                   /locus_tag="mCG_128201"
FT                   /product="AF4/FMR2 family, member 1, transcript variant
FT                   mCT181371"
FT                   /note="gene_id=mCG128201.0 transcript_id=mCT181371.0
FT                   created on 21-MAR-2003"
FT   CDS             join(7901781..7901821,7930398..7930518,7930930..7931787,
FT                   7958262..7958306,7962181..7962267,7963412..7963448,
FT                   7966141..7966192,7973147..7973201,7973310..7973347,
FT                   7975749..7975911,7980871..7981860,7988496..7988593,
FT                   7989667..7989907,7990428..7990528,7990648..7990708,
FT                   7993674..7993807,7994476..7994547,7995154..7995297,
FT                   7996793..7997016,7998142..7998263)
FT                   /codon_start=1
FT                   /gene="Aff1"
FT                   /locus_tag="mCG_128201"
FT                   /product="AF4/FMR2 family, member 1, isoform CRA_b"
FT                   /note="gene_id=mCG128201.0 transcript_id=mCT181371.0
FT                   protein_id=mCP104293.0 isoform=CRA_b"
FT                   /protein_id="EDL20243.1"
FT                   GP"
FT   assembly_gap    7914417..7914506
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    7938341..7938360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7938903..7938922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7964329..7964348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7969453..7969472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7973815..7974041
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    7983605..7983651
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    8004796..8004815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8009504..8058545)
FT                   /gene="Klhl8"
FT                   /locus_tag="mCG_1165"
FT                   /note="gene_id=mCG1165.2"
FT   mRNA            complement(join(8009504..8010645,8011656..8011857,
FT                   8014947..8015106,8015299..8015467,8017983..8018095,
FT                   8019486..8019629,8021658..8021844,8023196..8023744,
FT                   8033362..8033745,8058413..8058493))
FT                   /gene="Klhl8"
FT                   /locus_tag="mCG_1165"
FT                   /product="kelch-like 8 (Drosophila), transcript variant
FT                   mCT8818"
FT                   /note="gene_id=mCG1165.2 transcript_id=mCT8818.2 created on
FT                   21-MAR-2003"
FT   mRNA            complement(join(8009532..8010645,8011656..8011857,
FT                   8014947..8015106,8015299..8015467,8017983..8018095,
FT                   8019486..8019629,8021658..8021844,8023196..8023744,
FT                   8033362..8033745,8038175..8038241,8058507..8058545))
FT                   /gene="Klhl8"
FT                   /locus_tag="mCG_1165"
FT                   /product="kelch-like 8 (Drosophila), transcript variant
FT                   mCT181366"
FT                   /note="gene_id=mCG1165.2 transcript_id=mCT181366.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(8018067..8018095,8019486..8019629,
FT                   8021658..8021844,8023196..8023744,8033362..8033604))
FT                   /codon_start=1
FT                   /gene="Klhl8"
FT                   /locus_tag="mCG_1165"
FT                   /product="kelch-like 8 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG1165.2 transcript_id=mCT181366.0
FT                   protein_id=mCP104288.0 isoform=CRA_a"
FT                   /protein_id="EDL20240.1"
FT   CDS             complement(join(8018067..8018095,8019486..8019629,
FT                   8021658..8021844,8023196..8023744,8033362..8033604))
FT                   /codon_start=1
FT                   /gene="Klhl8"
FT                   /locus_tag="mCG_1165"
FT                   /product="kelch-like 8 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG1165.2 transcript_id=mCT8818.2
FT                   protein_id=mCP12428.2 isoform=CRA_a"
FT                   /protein_id="EDL20241.1"
FT   assembly_gap    8061240..8061438
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    8063316..8063335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8087747..8087924
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            complement(8101791..8127570)
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /note="gene_id=mCG1167.2"
FT   mRNA            complement(join(8101791..8102000,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125506))
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   transcript variant mCT181367"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181367.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(8101955..8102000,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125457))
FT                   /codon_start=1
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181367.0
FT                   protein_id=mCP104291.0 isoform=CRA_a"
FT                   /protein_id="EDL20236.1"
FT                   WHAR"
FT   mRNA            complement(join(8103447..8104289,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125506))
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   transcript variant mCT181368"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181368.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(8104187..8104289,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125457))
FT                   /codon_start=1
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181368.0
FT                   protein_id=mCP104289.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VCR2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:2140804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VCR2"
FT                   /protein_id="EDL20237.1"
FT   assembly_gap    8106957..8107035
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8111491..8111893,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125531))
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   transcript variant mCT8820"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT8820.2 created on
FT                   21-MAR-2003"
FT   mRNA            complement(join(8111494..8111893,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8122025..8122199,8127531..8127570))
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   transcript variant mCT181369"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181369.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(8111803..8111893,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8125248..8125457))
FT                   /codon_start=1
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT8820.2
FT                   protein_id=mCP12448.2 isoform=CRA_d"
FT                   /protein_id="EDL20239.1"
FT   CDS             complement(join(8111803..8111893,8113812..8113928,
FT                   8115008..8115145,8116732..8116838,8118796..8118927,
FT                   8120704..8120811,8122025..8122186))
FT                   /codon_start=1
FT                   /gene="Hsd17b13"
FT                   /locus_tag="mCG_1167"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 13,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1167.2 transcript_id=mCT181369.0
FT                   protein_id=mCP104290.0 isoform=CRA_c"
FT                   /protein_id="EDL20238.1"
FT                   KMK"
FT   assembly_gap    8113416..8113435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8119903..8120264
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    8132274..8132994
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    8135423..8135765
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    8138303..8138322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8138465..8171427)
FT                   /gene="Dhrs8"
FT                   /locus_tag="mCG_1164"
FT                   /note="gene_id=mCG1164.2"
FT   mRNA            complement(join(8138465..8138776,8141005..8141121,
FT                   8151372..8151509,8156734..8156840,8157950..8158081,
FT                   8166012..8166119,8169211..8169517,8171407..8171427))
FT                   /gene="Dhrs8"
FT                   /locus_tag="mCG_1164"
FT                   /product="dehydrogenase/reductase (SDR family) member 8,
FT                   transcript variant mCT8817"
FT                   /note="gene_id=mCG1164.2 transcript_id=mCT8817.2 created on
FT                   16-JUN-2003"
FT   CDS             complement(join(8138692..8138776,8141005..8141121,
FT                   8151372..8151509,8156734..8156840,8157950..8158081,
FT                   8166012..8166119,8169211..8169420))
FT                   /codon_start=1
FT                   /gene="Dhrs8"
FT                   /locus_tag="mCG_1164"
FT                   /product="dehydrogenase/reductase (SDR family) member 8,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1164.2 transcript_id=mCT8817.2
FT                   protein_id=mCP12423.2 isoform=CRA_b"
FT                   /protein_id="EDL20235.1"
FT                   KHRINVKFDAVVGYKDK"
FT   mRNA            complement(join(8149930..8151509,8156734..8156840,
FT                   8157950..8158081,8166012..8166119,8169211..8169517,
FT                   8171407..8171427))
FT                   /gene="Dhrs8"
FT                   /locus_tag="mCG_1164"
FT                   /product="dehydrogenase/reductase (SDR family) member 8,
FT                   transcript variant mCT185835"
FT                   /note="gene_id=mCG1164.2 transcript_id=mCT185835.0 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(8151368..8151509,8156734..8156840,
FT                   8157950..8158081,8166012..8166119,8169211..8169420))
FT                   /codon_start=1
FT                   /gene="Dhrs8"
FT                   /locus_tag="mCG_1164"
FT                   /product="dehydrogenase/reductase (SDR family) member 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1164.2 transcript_id=mCT185835.0
FT                   protein_id=mCP107093.0 isoform=CRA_a"
FT                   /protein_id="EDL20234.1"
FT                   TGFIKNPSTK"
FT   assembly_gap    8155883..8155902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8165653..8165672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8167121..8167239
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    8173955..8174099
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            8194369..8213552
FT                   /locus_tag="mCG_1163"
FT                   /note="gene_id=mCG1163.2"
FT   mRNA            join(8194369..8194616,8198750..8199000,8202455..8202550,
FT                   8203673..8203759,8206290..8206401,8207819..8207965,
FT                   8209857..8209941,8213120..8213552)
FT                   /locus_tag="mCG_1163"
FT                   /product="mCG1163"
FT                   /note="gene_id=mCG1163.2 transcript_id=mCT8816.2 created on
FT                   06-DEC-2002"
FT   assembly_gap    8194618..8197566
FT                   /estimated_length=2949
FT                   /gap_type="unknown"
FT   CDS             join(8198804..8199000,8202455..8202550,8203673..8203759,
FT                   8206290..8206401,8207819..8207965,8209857..8209941,
FT                   8213120..8213298)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1163"
FT                   /product="mCG1163"
FT                   /note="gene_id=mCG1163.2 transcript_id=mCT8816.2
FT                   protein_id=mCP12425.2"
FT                   /protein_id="EDL20233.1"
FT   assembly_gap    8219600..8219619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8224854..8224903
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(8227203..8261645)
FT                   /gene="Sparcl1"
FT                   /locus_tag="mCG_1172"
FT                   /note="gene_id=mCG1172.2"
FT   mRNA            complement(join(8227203..8227672,8233109..8233257,
FT                   8233806..8233954,8235121..8235257,8236496..8236616,
FT                   8237677..8237795,8238469..8238538,8240460..8241455,
FT                   8242698..8242826,8245769..8245833,8250057..8250114))
FT                   /gene="Sparcl1"
FT                   /locus_tag="mCG_1172"
FT                   /product="SPARC-like 1 (mast9, hevin), transcript variant
FT                   mCT175376"
FT                   /note="gene_id=mCG1172.2 transcript_id=mCT175376.0 created
FT                   on 05-NOV-2002"
FT   mRNA            complement(join(8227206..8227672,8233109..8233257,
FT                   8233806..8233954,8235121..8235257,8236496..8236616,
FT                   8237677..8237795,8238469..8238538,8240460..8241455,
FT                   8242698..8242826,8245769..8245833,8261336..8261645))
FT                   /gene="Sparcl1"
FT                   /locus_tag="mCG_1172"
FT                   /product="SPARC-like 1 (mast9, hevin), transcript variant
FT                   mCT8825"
FT                   /note="gene_id=mCG1172.2 transcript_id=mCT8825.0 created on
FT                   05-NOV-2002"
FT   CDS             complement(join(8227644..8227672,8233109..8233257,
FT                   8233806..8233954,8235121..8235257,8236496..8236616,
FT                   8237677..8237795,8238469..8238538,8240460..8241455,
FT                   8242698..8242826,8245769..8245822))
FT                   /codon_start=1
FT                   /gene="Sparcl1"
FT                   /locus_tag="mCG_1172"
FT                   /product="SPARC-like 1 (mast9, hevin), isoform CRA_a"
FT                   /note="gene_id=mCG1172.2 transcript_id=mCT175376.0
FT                   protein_id=mCP98295.0 isoform=CRA_a"
FT                   /protein_id="EDL20231.1"
FT                   CFGIKEEDIDENLLF"
FT   CDS             complement(join(8227644..8227672,8233109..8233257,
FT                   8233806..8233954,8235121..8235257,8236496..8236616,
FT                   8237677..8237795,8238469..8238538,8240460..8241455,
FT                   8242698..8242826,8245769..8245822))
FT                   /codon_start=1
FT                   /gene="Sparcl1"
FT                   /locus_tag="mCG_1172"
FT                   /product="SPARC-like 1 (mast9, hevin), isoform CRA_a"
FT                   /note="gene_id=mCG1172.2 transcript_id=mCT8825.0
FT                   protein_id=mCP12429.1 isoform=CRA_a"
FT                   /protein_id="EDL20232.1"
FT                   CFGIKEEDIDENLLF"
FT   assembly_gap    8250361..8250619
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    8251398..8251569
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    8252373..8252456
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            <8257162..8263981
FT                   /locus_tag="mCG_145307"
FT                   /note="gene_id=mCG145307.0"
FT   mRNA            join(<8257162..8257297,8257959..8258595,8261887..8263981)
FT                   /locus_tag="mCG_145307"
FT                   /product="mCG145307"
FT                   /note="gene_id=mCG145307.0 transcript_id=mCT184731.0
FT                   created on 05-JUN-2003"
FT   CDS             <8262683..8263012
FT                   /codon_start=1
FT                   /locus_tag="mCG_145307"
FT                   /product="mCG145307"
FT                   /note="gene_id=mCG145307.0 transcript_id=mCT184731.0
FT                   protein_id=mCP105425.0"
FT                   /protein_id="EDL20230.1"
FT                   LFNVI"
FT   assembly_gap    8278273..8278292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8315725..8315892
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            8317827..8336111
FT                   /gene="Dspp"
FT                   /locus_tag="mCG_141432"
FT                   /note="gene_id=mCG141432.0"
FT   mRNA            join(8317827..8317894,8321163..8321238,8322051..8322137,
FT                   8322292..8323227,8324014..8324494,8324520..8324593,
FT                   8324652..8324671,8324832..8324851,8325054..8325109,
FT                   8325156..8325181,8325282..8325313,8325415..8325524,
FT                   8333545..8333660,8333743..8333822,8333920..8336111)
FT                   /gene="Dspp"
FT                   /locus_tag="mCG_141432"
FT                   /product="dentin sialophosphoprotein"
FT                   /note="gene_id=mCG141432.0 transcript_id=mCT175398.0
FT                   created on 05-NOV-2002"
FT   CDS             join(8321182..8321238,8322051..8322137,8322292..8323227,
FT                   8324014..8324494,8324520..8324593,8324652..8324657)
FT                   /codon_start=1
FT                   /gene="Dspp"
FT                   /locus_tag="mCG_141432"
FT                   /product="dentin sialophosphoprotein"
FT                   /note="gene_id=mCG141432.0 transcript_id=mCT175398.0
FT                   protein_id=mCP98317.0"
FT                   /protein_id="EDL20229.1"
FT   assembly_gap    8325563..8332652
FT                   /estimated_length=7090
FT                   /gap_type="unknown"
FT   assembly_gap    8344168..8344258
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            8358656..8370135
FT                   /gene="Dmp1"
FT                   /locus_tag="mCG_1161"
FT                   /note="gene_id=mCG1161.2"
FT   mRNA            join(8358656..8358751,8363109..8363183,8363623..8363670,
FT                   8365932..8365964,8366136..8366180,8367670..8370135)
FT                   /gene="Dmp1"
FT                   /locus_tag="mCG_1161"
FT                   /product="dentin matrix protein 1"
FT                   /note="gene_id=mCG1161.2 transcript_id=mCT8814.2 created on
FT                   20-MAR-2003"
FT   CDS             join(8363130..8363183,8363623..8363670,8365932..8365964,
FT                   8366136..8366180,8367670..8369001)
FT                   /codon_start=1
FT                   /gene="Dmp1"
FT                   /locus_tag="mCG_1161"
FT                   /product="dentin matrix protein 1"
FT                   /note="gene_id=mCG1161.2 transcript_id=mCT8814.2
FT                   protein_id=mCP12422.2"
FT                   /db_xref="GOA:O55188"
FT                   /db_xref="InterPro:IPR009889"
FT                   /db_xref="MGI:MGI:94910"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55188"
FT                   /protein_id="EDL20228.1"
FT   assembly_gap    8371172..8371191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8375194..8375213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<8395727..>8403122)
FT                   /locus_tag="mCG_145326"
FT                   /note="gene_id=mCG145326.0"
FT   mRNA            complement(join(<8395727..8396339,8399765..8400105,
FT                   8403015..>8403122))
FT                   /locus_tag="mCG_145326"
FT                   /product="mCG145326"
FT                   /note="gene_id=mCG145326.0 transcript_id=mCT184750.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<8395727..>8395989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145326"
FT                   /product="mCG145326"
FT                   /note="gene_id=mCG145326.0 transcript_id=mCT184750.0
FT                   protein_id=mCP105445.0"
FT                   /protein_id="EDL20227.1"
FT   assembly_gap    8434548..8434567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8449661..8461860
FT                   /gene="Ibsp"
FT                   /locus_tag="mCG_1168"
FT                   /note="gene_id=mCG1168.2"
FT   mRNA            join(8449661..8449846,8452614..8452680,8452772..8452822,
FT                   8452913..8452990,8456474..8456539,8459810..8459983,
FT                   8460556..8461369,8461694..8461860)
FT                   /gene="Ibsp"
FT                   /locus_tag="mCG_1168"
FT                   /product="integrin binding sialoprotein"
FT                   /note="gene_id=mCG1168.2 transcript_id=mCT8821.2 created on
FT                   06-NOV-2002"
FT   CDS             join(8452627..8452680,8452772..8452822,8452913..8452990,
FT                   8456474..8456539,8459810..8459983,8460556..8461107)
FT                   /codon_start=1
FT                   /gene="Ibsp"
FT                   /locus_tag="mCG_1168"
FT                   /product="integrin binding sialoprotein"
FT                   /note="gene_id=mCG1168.2 transcript_id=mCT8821.2
FT                   protein_id=mCP12461.2"
FT                   /db_xref="GOA:Q61711"
FT                   /db_xref="InterPro:IPR008412"
FT                   /db_xref="MGI:MGI:96389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61711"
FT                   /protein_id="EDL20226.1"
FT   assembly_gap    8461370..8461678
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    8466408..8472476
FT                   /estimated_length=6069
FT                   /gap_type="unknown"
FT   assembly_gap    8474324..8474343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8481204..8481223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8483035..8483054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8484550..8487473
FT                   /estimated_length=2924
FT                   /gap_type="unknown"
FT   assembly_gap    8488268..8489993
FT                   /estimated_length=1726
FT                   /gap_type="unknown"
FT   assembly_gap    8492446..8492465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8503429..8503448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8504571..8504590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8507080..8507099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8508542..8508561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8517192..8517727
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    8524130..8524149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8532286..8533045
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    8534168..8534187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8544677..8545095
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    8552610..8553908
FT                   /estimated_length=1299
FT                   /gap_type="unknown"
FT   assembly_gap    8562497..8562516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8575898..8575917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8581395..8581414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8582707..8582726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8585667..8592139
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /note="gene_id=mCG14598.3"
FT   mRNA            join(8585667..8585797,8586922..8586989,8587632..8587667,
FT                   8588746..8588826,8589317..8589358,8590356..8590637,
FT                   8591320..8592139)
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, transcript variant
FT                   mCT185295"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT185295.1 created
FT                   on 10-JUN-2004"
FT   mRNA            join(8585667..8585745,8586922..8586989,8587632..8587667,
FT                   8588746..8588826,8589317..8589358,8590356..8590637,
FT                   8591320..8592139)
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, transcript variant
FT                   mCT175391"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175391.2 created
FT                   on 10-JUN-2004"
FT   mRNA            join(8585667..8585745,8587466..8587533,8587632..8587667,
FT                   8588746..8588826,8589317..8589358,8590356..8590637,
FT                   8591320..8592139)
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, transcript variant
FT                   mCT175390"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175390.2 created
FT                   on 10-JUN-2004"
FT   CDS             join(8585764..8585797,8586922..8586989,8587632..8587667,
FT                   8588746..8588826,8589317..8589358,8590356..8590637,
FT                   8591320..8591709)
FT                   /codon_start=1
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, isoform CRA_d"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT185295.1
FT                   protein_id=mCP106553.1 isoform=CRA_d"
FT                   /protein_id="EDL20224.1"
FT   CDS             join(8586936..8586989,8587632..8587667,8588746..8588826,
FT                   8589317..8589358,8590356..8590637,8591320..8591709)
FT                   /codon_start=1
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, isoform CRA_b"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175391.2
FT                   protein_id=mCP98310.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q547B5"
FT                   /db_xref="InterPro:IPR002038"
FT                   /db_xref="InterPro:IPR019841"
FT                   /db_xref="MGI:MGI:98389"
FT                   /db_xref="UniProtKB/TrEMBL:Q547B5"
FT                   /protein_id="EDL20222.1"
FT                   ISHELESSSSEVN"
FT   assembly_gap    8587072..8587091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(8587283..8587533,8587632..8587667,8588746..8588826,
FT                   8589317..8589358,8590356..8590637,8591320..8592139)
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, transcript variant
FT                   mCT18680"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT18680.2 created
FT                   on 10-JUN-2004"
FT   mRNA            join(8587283..8587533,8588746..8588826,8589317..8589358,
FT                   8590356..8590637,8591320..8592139)
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, transcript variant
FT                   mCT175392"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175392.2 created
FT                   on 10-JUN-2004"
FT   CDS             join(8587480..8587533,8587632..8587667,8588746..8588826,
FT                   8589317..8589358,8590356..8590637,8591320..8591709)
FT                   /codon_start=1
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, isoform CRA_a"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175390.2
FT                   protein_id=mCP98309.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q547B5"
FT                   /db_xref="InterPro:IPR002038"
FT                   /db_xref="InterPro:IPR019841"
FT                   /db_xref="MGI:MGI:98389"
FT                   /db_xref="UniProtKB/TrEMBL:Q547B5"
FT                   /protein_id="EDL20221.1"
FT                   ISHELESSSSEVN"
FT   CDS             join(8587480..8587533,8587632..8587667,8588746..8588826,
FT                   8589317..8589358,8590356..8590637,8591320..8591709)
FT                   /codon_start=1
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, isoform CRA_a"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT18680.2
FT                   protein_id=mCP13057.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q547B5"
FT                   /db_xref="InterPro:IPR002038"
FT                   /db_xref="InterPro:IPR019841"
FT                   /db_xref="MGI:MGI:98389"
FT                   /db_xref="UniProtKB/TrEMBL:Q547B5"
FT                   /protein_id="EDL20225.1"
FT                   ISHELESSSSEVN"
FT   CDS             join(8587480..8587533,8588746..8588826,8589317..8589358,
FT                   8590356..8590637,8591320..8591709)
FT                   /codon_start=1
FT                   /gene="Spp1"
FT                   /locus_tag="mCG_14598"
FT                   /product="secreted phosphoprotein 1, isoform CRA_c"
FT                   /note="gene_id=mCG14598.3 transcript_id=mCT175392.2
FT                   protein_id=mCP98311.1 isoform=CRA_c"
FT                   /protein_id="EDL20223.1"
FT                   N"
FT   assembly_gap    8600745..8600764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8603956..8603975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8610414..8659218
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /note="gene_id=mCG133602.2"
FT   mRNA            join(<8610414..8611245,8617870..8617983,8624821..8624954,
FT                   8626495..8626745,8627854..8628078,8630712..8630940,
FT                   8634362..8634529,8636995..8637176,8638404..8638524,
FT                   8642555..8642653,8651824..8651945,8652141..8652258,
FT                   8652552..8652715,8655672..8655819,8656832..8659216)
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, transcript variant
FT                   mCT134971"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT134971.1
FT                   created on 06-NOV-2002"
FT   mRNA            join(<8610466..8611245,8617870..8617983,8624821..8624954,
FT                   8626495..8626745,8627854..8628078,8630712..8630940,
FT                   8634362..8634529,8636995..8637176,8638404..8638524,
FT                   8642555..8642653,8651824..8651945,8652141..8652258,
FT                   8652552..8652715,8655672..8655819,8656832..8657675,
FT                   8659017..8659218)
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, transcript variant
FT                   mCT191303"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT191303.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<8610591..8611000,8611109..8611245,8617870..8617983,
FT                   8624821..8624954,8626495..8626745,8627854..8628078,
FT                   8630712..8630940,8634362..8634529,8636995..8637176,
FT                   8638404..8638524,8642555..8642653,8651824..8651945,
FT                   8652141..8652258,8652552..8652715,8655672..8655819,
FT                   8656832..8657848)
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, transcript variant
FT                   mCT191302"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT191302.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<8610810..8611245,8617870..8617983,8624821..8624954,
FT                   8626495..8626745,8627854..8628078,8630712..8630940,
FT                   8634362..8634529,8636995..8637176,8638404..8638524,
FT                   8642555..8642653,8651824..8651945,8652141..8652258,
FT                   8652552..8652715,8655672..8655819,8656832..8657068)
FT                   /codon_start=1
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, isoform CRA_b"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT191303.0
FT                   protein_id=mCP112273.0 isoform=CRA_b"
FT                   /protein_id="EDL20219.1"
FT   CDS             join(<8610810..8611245,8617870..8617983,8624821..8624954,
FT                   8626495..8626745,8627854..8628078,8630712..8630940,
FT                   8634362..8634529,8636995..8637176,8638404..8638524,
FT                   8642555..8642653,8651824..8651945,8652141..8652258,
FT                   8652552..8652715,8655672..8655819,8656832..8657068)
FT                   /codon_start=1
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, isoform CRA_b"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT134971.1
FT                   protein_id=mCP62951.1 isoform=CRA_b"
FT                   /protein_id="EDL20220.1"
FT   CDS             join(<8610810..8611000,8611109..8611245,8617870..8617983,
FT                   8624821..8624954,8626495..8626745,8627854..8628078,
FT                   8630712..8630940,8634362..8634529,8636995..8637176,
FT                   8638404..8638524,8642555..8642653,8651824..8651945,
FT                   8652141..8652258,8652552..8652715,8655672..8655819,
FT                   8656832..8657068)
FT                   /codon_start=1
FT                   /gene="Pkd2"
FT                   /locus_tag="mCG_133602"
FT                   /product="polycystic kidney disease 2, isoform CRA_a"
FT                   /note="gene_id=mCG133602.2 transcript_id=mCT191302.0
FT                   protein_id=mCP112272.0 isoform=CRA_a"
FT                   /protein_id="EDL20218.1"
FT                   NGSANVHA"
FT   assembly_gap    8611340..8611388
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    8635705..8635845
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    8641719..8641738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8644775..8648476
FT                   /estimated_length=3702
FT                   /gap_type="unknown"
FT   assembly_gap    8661658..8662137
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    8678413..8678432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8679441..8680307
FT                   /estimated_length=867
FT                   /gap_type="unknown"
FT   assembly_gap    8681424..8681443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8682515..8682534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8695443..8707183
FT                   /locus_tag="mCG_145327"
FT                   /note="gene_id=mCG145327.0"
FT   mRNA            join(<8695443..8695581,8695763..8696355,8704689..8704793,
FT                   8705994..8707183)
FT                   /locus_tag="mCG_145327"
FT                   /product="mCG145327"
FT                   /note="gene_id=mCG145327.0 transcript_id=mCT184751.0
FT                   created on 05-JUN-2003"
FT   CDS             <8706079..8706300
FT                   /codon_start=1
FT                   /locus_tag="mCG_145327"
FT                   /product="mCG145327"
FT                   /note="gene_id=mCG145327.0 transcript_id=mCT184751.0
FT                   protein_id=mCP105446.0"
FT                   /protein_id="EDL20217.1"
FT   assembly_gap    8715569..8715588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8721772..8722346
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    8726716..8726735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8729476..8730719
FT                   /estimated_length=1244
FT                   /gap_type="unknown"
FT   assembly_gap    8734139..8734794
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    8737454..8737718
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    8740547..8740608
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    8747612..8747631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8751881..8751965
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    8755091..8755998
FT                   /estimated_length=908
FT                   /gap_type="unknown"
FT   assembly_gap    8759460..8759479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8763007..8764233
FT                   /estimated_length=1227
FT                   /gap_type="unknown"
FT   assembly_gap    8769083..8769119
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    8773337..8773494
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    8778791..8778939
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    8782546..8782633
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    8791297..8791480
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    8794330..8794446
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    8808763..8810634
FT                   /estimated_length=1872
FT                   /gap_type="unknown"
FT   assembly_gap    8815211..8822532
FT                   /estimated_length=7322
FT                   /gap_type="unknown"
FT   assembly_gap    8827592..8828244
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   gene            complement(8834968..8839033)
FT                   /pseudo
FT                   /locus_tag="mCG_142650"
FT                   /note="gene_id=mCG142650.0"
FT   mRNA            complement(join(8834968..8835174,8835472..8835591,
FT                   8835943..8837331,8838603..8838663,8838907..8839033))
FT                   /pseudo
FT                   /locus_tag="mCG_142650"
FT                   /note="gene_id=mCG142650.0 transcript_id=mCT181378.0
FT                   created on 20-MAR-2003"
FT   assembly_gap    8835697..8835917
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    8845296..8845315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8848677..8848699
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8853396..8853415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8861098..8869516)
FT                   /pseudo
FT                   /locus_tag="mCG_142651"
FT                   /note="gene_id=mCG142651.0"
FT   mRNA            complement(join(8861098..8861204,8863468..8863653,
FT                   8866534..8866835,8867023..8867891,8869381..8869516))
FT                   /pseudo
FT                   /locus_tag="mCG_142651"
FT                   /note="gene_id=mCG142651.0 transcript_id=mCT181379.0
FT                   created on 20-MAR-2003"
FT   assembly_gap    8865182..8865689
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    8868682..8868701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8869776..8870638
FT                   /estimated_length=863
FT                   /gap_type="unknown"
FT   assembly_gap    8873808..8875494
FT                   /estimated_length=1687
FT                   /gap_type="unknown"
FT   assembly_gap    8883239..8883745
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    8886817..8887201
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   gene            complement(8888167..8936168)
FT                   /locus_tag="mCG_54146"
FT                   /note="gene_id=mCG54146.2"
FT   mRNA            complement(join(8888167..8889963,8936059..8936168))
FT                   /locus_tag="mCG_54146"
FT                   /product="mCG54146"
FT                   /note="gene_id=mCG54146.2 transcript_id=mCT54329.2 created
FT                   on 20-MAR-2003"
FT   CDS             complement(join(8889742..8889963,8936059..8936088))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54146"
FT                   /product="mCG54146"
FT                   /note="gene_id=mCG54146.2 transcript_id=mCT54329.2
FT                   protein_id=mCP35815.2"
FT                   /protein_id="EDL20216.1"
FT   assembly_gap    8890680..8890878
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    8891782..8894992
FT                   /estimated_length=3211
FT                   /gap_type="unknown"
FT   assembly_gap    8896607..8896626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8898080..8898099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8903570..8903662
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    8907223..8907428
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    8912406..8912742
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    8920638..8920911
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    8924694..8924789
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    8925855..8927078
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   assembly_gap    8928896..8930158
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   gene            complement(8931552..8932063)
FT                   /pseudo
FT                   /locus_tag="mCG_133604"
FT                   /note="gene_id=mCG133604.0"
FT   mRNA            complement(8931552..8932063)
FT                   /pseudo
FT                   /locus_tag="mCG_133604"
FT                   /note="gene_id=mCG133604.0 transcript_id=mCT134973.0
FT                   created on 20-MAR-2003"
FT   assembly_gap    8932064..8932489
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    8933695..8934819
FT                   /estimated_length=1125
FT                   /gap_type="unknown"
FT   assembly_gap    8936492..8936758
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    8940125..8940144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8941929..8941978
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    8944672..8944691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8947446..8994284)
FT                   /gene="Abcg3"
FT                   /locus_tag="mCG_133600"
FT                   /note="gene_id=mCG133600.0"
FT   mRNA            complement(join(8947446..8947783,8949862..8949947,
FT                   8950821..8950910,8960013..8960167,8963150..8963274,
FT                   8964732..8964821,8972559..8972641,8974812..8975059,
FT                   8978502..8978603,8979766..8979917,8981011..8981147,
FT                   8985586..8985738,8986255..8986369,8986970..8987029,
FT                   8989220..8989441,8994164..8994284))
FT                   /gene="Abcg3"
FT                   /locus_tag="mCG_133600"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 3"
FT                   /note="gene_id=mCG133600.0 transcript_id=mCT134969.0
FT                   created on 06-NOV-2002"
FT   CDS             complement(join(8947630..8947783,8949862..8949947,
FT                   8950821..8950910,8960013..8960167,8963150..8963274,
FT                   8964732..8964821,8972559..8972641,8974812..8975059,
FT                   8978502..8978603,8979766..8979917,8981011..8981147,
FT                   8985586..8985738,8986255..8986369,8986970..8987029,
FT                   8989220..8989422))
FT                   /codon_start=1
FT                   /gene="Abcg3"
FT                   /locus_tag="mCG_133600"
FT                   /product="ATP-binding cassette, sub-family G (WHITE),
FT                   member 3"
FT                   /note="gene_id=mCG133600.0 transcript_id=mCT134969.0
FT                   protein_id=mCP62422.1"
FT                   /db_xref="GOA:Q99P81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1351624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99P81"
FT                   /protein_id="EDL20215.1"
FT                   ITYVQLLQVKNIRNF"
FT   assembly_gap    8961050..8961069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8963895..8964546
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    8967706..8967725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8998903..8999370)
FT                   /pseudo
FT                   /locus_tag="mCG_1030441"
FT                   /note="gene_id=mCG1030441.1"
FT   mRNA            complement(8998903..8999370)
FT                   /pseudo
FT                   /locus_tag="mCG_1030441"
FT                   /note="gene_id=mCG1030441.1 transcript_id=mCT148145.1
FT                   created on 20-MAR-2003"
FT   gene            complement(9000540..9001056)
FT                   /locus_tag="mCG_20327"
FT                   /note="gene_id=mCG20327.1"
FT   mRNA            complement(9000540..9001056)
FT                   /locus_tag="mCG_20327"
FT                   /product="mCG20327"
FT                   /note="gene_id=mCG20327.1 transcript_id=mCT20003.1 created
FT                   on 20-MAR-2003"
FT   CDS             complement(9000713..9000997)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20327"
FT                   /product="mCG20327"
FT                   /note="gene_id=mCG20327.1 transcript_id=mCT20003.1
FT                   protein_id=mCP4973.2"
FT                   /protein_id="EDL20214.1"
FT   assembly_gap    9007939..9008276
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    9011569..9012256
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   gene            complement(9026056..9324126)
FT                   /locus_tag="mCG_20328"
FT                   /note="gene_id=mCG20328.2"
FT   mRNA            complement(join(9026056..9027024,9027929..9028122,
FT                   9028448..9028550,9029581..9030744,9039743..9039988,
FT                   9042740..9042936,9043121..9043230,9053731..9053858,
FT                   9055930..9056137,9324071..9324126))
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, transcript variant mCT181383"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT181383.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(9026059..9027024,9027929..9028122,
FT                   9028448..9028550,9029581..9029787,9030464..9030744,
FT                   9039743..9039988,9042740..9042936,9043121..9043230,
FT                   9053731..9053858,9055930..9056137,9110795..9110854))
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, transcript variant mCT20004"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT20004.2 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(9026059..9027024,9027929..9028122,
FT                   9028448..9028550,9029581..9029787,9030464..9030744,
FT                   9042740..9042936,9043121..9043230,9055930..9056119,
FT                   9110795..9110833))
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, transcript variant mCT175396"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT175396.1 created
FT                   on 20-MAR-2003"
FT   CDS             complement(join(9026851..9027024,9027929..9028122,
FT                   9028448..9028550,9029581..9029787,9030464..9030744,
FT                   9039743..9039988,9042740..9042936,9043121..9043230,
FT                   9053731..9053858,9055930..9056113))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, isoform CRA_c"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT20004.2
FT                   protein_id=mCP4974.1 isoform=CRA_c"
FT                   /protein_id="EDL20205.1"
FT   CDS             complement(join(9026851..9027024,9027929..9028122,
FT                   9028448..9028550,9029581..9029787,9030464..9030744,
FT                   9042740..9042936,9043121..9043158))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, isoform CRA_a"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT175396.1
FT                   protein_id=mCP98315.0 isoform=CRA_a"
FT                   /protein_id="EDL20203.1"
FT   CDS             complement(join(9030452..9030744,9039743..9039988,
FT                   9042740..9042936,9043121..9043230,9053731..9053858,
FT                   9055930..9056113))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20328"
FT                   /product="mCG20328, isoform CRA_b"
FT                   /note="gene_id=mCG20328.2 transcript_id=mCT181383.0
FT                   protein_id=mCP104305.0 isoform=CRA_b"
FT                   /protein_id="EDL20204.1"
FT   assembly_gap    9030928..9030947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9033968..9033987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9037951..9039430
FT                   /estimated_length=1480
FT                   /gap_type="unknown"
FT   assembly_gap    9040503..9040522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9050405..9050464
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9055141..9055160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9057973..9059542
FT                   /estimated_length=1570
FT                   /gap_type="unknown"
FT   assembly_gap    9060704..9060723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9062536..9062555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9068038..9070342
FT                   /estimated_length=2305
FT                   /gap_type="unknown"
FT   assembly_gap    9078030..9079239
FT                   /estimated_length=1210
FT                   /gap_type="unknown"
FT   gene            complement(9084354..9110868)
FT                   /locus_tag="mCG_142489"
FT                   /note="gene_id=mCG142489.0"
FT   mRNA            complement(join(9084354..9085320,9086186..9086379,
FT                   9086707..9086809,9087760..9087966,9088629..9088909,
FT                   9089976..9090221,9094622..9094818,9095001..9095110,
FT                   9104357..9104484,9106254..9106461,9110795..9110868))
FT                   /locus_tag="mCG_142489"
FT                   /product="mCG142489, transcript variant mCT180531"
FT                   /note="gene_id=mCG142489.0 transcript_id=mCT180531.0
FT                   created on 12-FEB-2003"
FT   mRNA            complement(join(9084354..9085320,9086186..9086379,
FT                   9086707..9086809,9087760..9087966,9088629..9088909,
FT                   9089976..9090221,9094622..9094818,9095001..9095110,
FT                   9104357..9104484,9106254..9106443,9110795..9110867))
FT                   /locus_tag="mCG_142489"
FT                   /product="mCG142489, transcript variant mCT180532"
FT                   /note="gene_id=mCG142489.0 transcript_id=mCT180532.0
FT                   created on 12-FEB-2003"
FT   CDS             complement(join(9085111..9085320,9086186..9086379,
FT                   9086707..9086809,9087760..9087966,9088629..9088909,
FT                   9089976..9090221,9094622..9094818,9095001..9095110,
FT                   9104357..9104484,9106254..9106437))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142489"
FT                   /product="mCG142489, isoform CRA_a"
FT                   /note="gene_id=mCG142489.0 transcript_id=mCT180531.0
FT                   protein_id=mCP103453.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTS3"
FT                   /db_xref="InterPro:IPR003191"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030386"
FT                   /db_xref="MGI:MGI:3605620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTS3"
FT                   /protein_id="EDL20212.1"
FT   CDS             complement(join(9085111..9085320,9086186..9086379,
FT                   9086707..9086809,9087760..9087966,9088629..9088909,
FT                   9089976..9090221,9094622..9094818,9095001..9095110,
FT                   9104357..9104484,9106254..9106437))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142489"
FT                   /product="mCG142489, isoform CRA_a"
FT                   /note="gene_id=mCG142489.0 transcript_id=mCT180532.0
FT                   protein_id=mCP103454.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTS3"
FT                   /db_xref="InterPro:IPR003191"
FT                   /db_xref="InterPro:IPR015894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030386"
FT                   /db_xref="MGI:MGI:3605620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTS3"
FT                   /protein_id="EDL20213.1"
FT   assembly_gap    9093593..9093612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9101361..9101541
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   gene            complement(9118149..9140072)
FT                   /locus_tag="mCG_14319"
FT                   /note="gene_id=mCG14319.2"
FT   mRNA            complement(join(9118149..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137534,9138729..9138818,
FT                   9139221..9139319,9139982..9140072))
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, transcript variant mCT175388"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175388.0 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(9118149..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137534,9139982..9140049))
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, transcript variant mCT16140"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT16140.2 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(9118149..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9139982..9140046))
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, transcript variant mCT175386"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175386.0 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(9118149..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137534,9139221..9139319,
FT                   9139982..9140045))
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, transcript variant mCT175389"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175389.0 created
FT                   on 06-NOV-2002"
FT   mRNA            complement(join(9118149..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126333,
FT                   9135625..9135748,9137299..9137516,9139982..9140031))
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, transcript variant mCT175387"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175387.0 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(9118860..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137534,9139221..9139235))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, isoform CRA_c"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175389.0
FT                   protein_id=mCP98307.0 isoform=CRA_c"
FT                   /protein_id="EDL20210.1"
FT                   SLLRKKDRL"
FT   CDS             complement(join(9118860..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137510))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, isoform CRA_d"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175388.0
FT                   protein_id=mCP98308.0 isoform=CRA_d"
FT                   /protein_id="EDL20211.1"
FT   CDS             complement(join(9118860..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126209,
FT                   9135625..9135748,9137299..9137495))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, isoform CRA_b"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT16140.2
FT                   protein_id=mCP1127.2 isoform=CRA_b"
FT                   /protein_id="EDL20209.1"
FT   CDS             complement(join(9118860..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126137))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, isoform CRA_a"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175386.0
FT                   protein_id=mCP98305.0 isoform=CRA_a"
FT                   /protein_id="EDL20207.1"
FT   CDS             complement(join(9118860..9119081,9119960..9120153,
FT                   9120481..9120583,9121491..9121697,9122373..9122653,
FT                   9123457..9123702,9125718..9125914,9126100..9126137))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14319"
FT                   /product="mCG14319, isoform CRA_a"
FT                   /note="gene_id=mCG14319.2 transcript_id=mCT175387.0
FT                   protein_id=mCP98306.0 isoform=CRA_a"
FT                   /protein_id="EDL20208.1"
FT   assembly_gap    9131730..9132012
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    9136744..9136825
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            complement(9158395..>9187685)
FT                   /locus_tag="mCG_142653"
FT                   /note="gene_id=mCG142653.0"
FT   mRNA            complement(join(9158395..9158532,9159418..9159611,
FT                   9159940..9160042,9161002..9161208,9161868..9162148,
FT                   9163139..9163384,9172139..9172335,9172519..9172628,
FT                   9182658..9182785,9187541..>9187685))
FT                   /locus_tag="mCG_142653"
FT                   /product="mCG142653"
FT                   /note="gene_id=mCG142653.0 transcript_id=mCT181392.0
FT                   created on 20-MAR-2003"
FT   CDS             complement(join(9161095..9161208,9161868..9162148,
FT                   9163139..9163384,9172139..9172335,9172519..9172628,
FT                   9182658..9182785,9187541..9187685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142653"
FT                   /product="mCG142653"
FT                   /note="gene_id=mCG142653.0 transcript_id=mCT181392.0
FT                   protein_id=mCP104314.0"
FT                   /protein_id="EDL20206.1"
FT                   KDFMENI"
FT   assembly_gap    9187302..9187321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9194320..9236872
FT                   /estimated_length=42553
FT                   /gap_type="unknown"
FT   assembly_gap    9245166..9245404
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    9248842..9249301
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    9250444..9250463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9258736..9263402
FT                   /estimated_length=4667
FT                   /gap_type="unknown"
FT   assembly_gap    9264974..9268099
FT                   /estimated_length=3126
FT                   /gap_type="unknown"
FT   assembly_gap    9269416..9269627
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    9278923..9278942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9301555..9324864)
FT                   /locus_tag="mCG_3631"
FT                   /note="gene_id=mCG3631.2"
FT   mRNA            complement(join(9301555..9302528,9303435..9303628,
FT                   9303958..9304060,9304984..9305190,9305863..9306143,
FT                   9306905..9307150,9309472..9309668,9309854..9309963,
FT                   9319663..9319790,9321399..9321606,9324071..9324125))
FT                   /locus_tag="mCG_3631"
FT                   /product="mCG3631, transcript variant mCT3208"
FT                   /note="gene_id=mCG3631.2 transcript_id=mCT3208.2 created on
FT                   18-APR-2003"
FT   mRNA            complement(join(9302151..9302528,9303435..9303628,
FT                   9303958..9304060,9304984..9305190,9305863..9306143,
FT                   9306905..9307150,9309472..9309668,9309854..9309963,
FT                   9319663..9319790,9321399..9321588,9324756..9324864))
FT                   /locus_tag="mCG_3631"
FT                   /product="mCG3631, transcript variant mCT182031"
FT                   /note="gene_id=mCG3631.2 transcript_id=mCT182031.0 created
FT                   on 18-APR-2003"
FT   CDS             complement(join(9302319..9302528,9303435..9303628,
FT                   9303958..9304060,9304984..9305190,9305863..9306143,
FT                   9306905..9307150,9309472..9309668,9309854..9309963,
FT                   9319663..9319790,9321399..9321582))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3631"
FT                   /product="mCG3631, isoform CRA_a"
FT                   /note="gene_id=mCG3631.2 transcript_id=mCT182031.0
FT                   protein_id=mCP104953.0 isoform=CRA_a"
FT                   /protein_id="EDL20201.1"
FT   CDS             complement(join(9302319..9302528,9303435..9303628,
FT                   9303958..9304060,9304984..9305190,9305863..9306143,
FT                   9306905..9307150,9309472..9309668,9309854..9309963,
FT                   9319663..9319790,9321399..9321582))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3631"
FT                   /product="mCG3631, isoform CRA_a"
FT                   /note="gene_id=mCG3631.2 transcript_id=mCT3208.2
FT                   protein_id=mCP13937.2 isoform=CRA_a"
FT                   /protein_id="EDL20202.1"
FT   assembly_gap    9315859..9315878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9320347..9320548
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    9324257..9324276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9344044..9347027
FT                   /estimated_length=2984
FT                   /gap_type="unknown"
FT   assembly_gap    9363041..9363060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9374030..9443722
FT                   /gene="Lrrc8b"
FT                   /locus_tag="mCG_52435"
FT                   /note="gene_id=mCG52435.3"
FT   mRNA            join(9374030..9374168,9423455..9423509,9430846..9430944,
FT                   9434828..9436989,9442050..9443722)
FT                   /gene="Lrrc8b"
FT                   /locus_tag="mCG_52435"
FT                   /product="leucine rich repeat containing 8 family, member
FT                   B"
FT                   /note="gene_id=mCG52435.3 transcript_id=mCT52618.3 created
FT                   on 11-JUN-2003"
FT   gene            9374032..>9408736
FT                   /locus_tag="mCG_145728"
FT                   /note="gene_id=mCG145728.0"
FT   mRNA            join(9374032..9374168,9407734..>9408736)
FT                   /locus_tag="mCG_145728"
FT                   /product="mCG145728"
FT                   /note="gene_id=mCG145728.0 transcript_id=mCT181386.0
FT                   created on 11-JUN-2003"
FT   assembly_gap    9379078..9379097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9390004..9390584
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    9406932..9406951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             9407771..9408736
FT                   /codon_start=1
FT                   /locus_tag="mCG_145728"
FT                   /product="mCG145728"
FT                   /note="gene_id=mCG145728.0 transcript_id=mCT181386.0
FT                   protein_id=mCP104308.0"
FT                   /protein_id="EDL20200.1"
FT   assembly_gap    9432538..9432557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9434851..9436989,9442050..9442322)
FT                   /codon_start=1
FT                   /gene="Lrrc8b"
FT                   /locus_tag="mCG_52435"
FT                   /product="leucine rich repeat containing 8 family, member
FT                   B"
FT                   /note="gene_id=mCG52435.3 transcript_id=mCT52618.3
FT                   protein_id=mCP40076.2"
FT                   /db_xref="GOA:Q5DU41"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR021040"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2141353"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5DU41"
FT                   /protein_id="EDL20199.1"
FT   assembly_gap    9438849..9438868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9451172..9451308
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    9464480..9464499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9465579..9465598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9470764..9470783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9472278..9472297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9473053..9570636
FT                   /gene="Lrrc8c"
FT                   /locus_tag="mCG_7570"
FT                   /note="gene_id=mCG7570.2"
FT   mRNA            join(9473053..9473266,9505109..9505179,9540556..9540697,
FT                   9568153..9570636)
FT                   /gene="Lrrc8c"
FT                   /locus_tag="mCG_7570"
FT                   /product="leucine rich repeat containing 8 family, member
FT                   C"
FT                   /note="gene_id=mCG7570.2 transcript_id=mCT6469.2 created on
FT                   06-DEC-2002"
FT   assembly_gap    9473753..9473772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9474799..9475171
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    9479915..9480497
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    9492470..9492926
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    9516310..9516329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9524578..9524597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9535722..9535785
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             join(9540560..9540697,9568153..9570426)
FT                   /codon_start=1
FT                   /gene="Lrrc8c"
FT                   /locus_tag="mCG_7570"
FT                   /product="leucine rich repeat containing 8 family, member
FT                   C"
FT                   /note="gene_id=mCG7570.2 transcript_id=mCT6469.2
FT                   protein_id=mCP19941.1"
FT                   /protein_id="EDL20198.1"
FT   assembly_gap    9562369..9563452
FT                   /estimated_length=1084
FT                   /gap_type="unknown"
FT   assembly_gap    9588666..9588685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9589815..9589834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9607767..9608260
FT                   /pseudo
FT                   /locus_tag="mCG_7569"
FT                   /note="gene_id=mCG7569.1"
FT   mRNA            9607767..9608260
FT                   /pseudo
FT                   /locus_tag="mCG_7569"
FT                   /note="gene_id=mCG7569.1 transcript_id=mCT6468.1 created on
FT                   19-MAR-2003"
FT   assembly_gap    9616473..9622083
FT                   /estimated_length=5611
FT                   /gap_type="unknown"
FT   assembly_gap    9628174..9628203
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    9641866..9643611
FT                   /estimated_length=1746
FT                   /gap_type="unknown"
FT   assembly_gap    9646936..9646995
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9652337..9653413
FT                   /estimated_length=1077
FT                   /gap_type="unknown"
FT   assembly_gap    9657129..9657611
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   gene            9657929..9788320
FT                   /locus_tag="mCG_54218"
FT                   /note="gene_id=mCG54218.1"
FT   mRNA            join(9657929..9658174,9687316..9687460,9767369..9770852)
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, transcript variant mCT54401"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT54401.1 created
FT                   on 18-APR-2003"
FT   assembly_gap    9678270..9678289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9679947..9679966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9681590..9681609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9685058..9685077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(9686791..9686812,9687316..9687460,9767369..9767388,
FT                   9768972..9770852)
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, transcript variant mCT182032"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT182032.0 created
FT                   on 18-APR-2003"
FT   assembly_gap    9687063..9687082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(9687315..9687454,9786252..9786348,9788071..9788298)
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, transcript variant mCT181388"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT181388.0 created
FT                   on 18-APR-2003"
FT   mRNA            join(9687384..9687460,9786252..9786348,9788071..9788320)
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, transcript variant mCT181387"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT181387.0 created
FT                   on 18-APR-2003"
FT   assembly_gap    9701176..9701479
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    9705076..9705095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9706680..9706699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9710848..9710867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9714558..9714577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9717607..9717653
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    9718892..9719006
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    9721671..9721690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9759680..9759757
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   CDS             9767371..9769950
FT                   /codon_start=1
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, isoform CRA_d"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT54401.1
FT                   protein_id=mCP40092.0 isoform=CRA_d"
FT                   /protein_id="EDL20196.1"
FT   CDS             9769105..9769950
FT                   /codon_start=1
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, isoform CRA_b"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT182032.0
FT                   protein_id=mCP104955.0 isoform=CRA_b"
FT                   /protein_id="EDL20194.1"
FT                   "
FT   mRNA            join(9780146..9780414,9782343..9784501,9784888..9785029,
FT                   9785176..9785240,9786252..9786348,9788071..9788318)
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, transcript variant mCT182033"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT182033.0 created
FT                   on 18-APR-2003"
FT   CDS             9782367..9782711
FT                   /codon_start=1
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, isoform CRA_c"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT182033.0
FT                   protein_id=mCP104954.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8C3I2"
FT                   /db_xref="MGI:MGI:2444658"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C3I2"
FT                   /protein_id="EDL20195.1"
FT                   TLQKAPQTFL"
FT   assembly_gap    9785523..9785871
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   CDS             9788168..9788224
FT                   /codon_start=1
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, isoform CRA_a"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT181388.0
FT                   protein_id=mCP104310.0 isoform=CRA_a"
FT                   /protein_id="EDL20193.1"
FT                   /translation="MLTVLSSQPAFPLSVVFP"
FT   CDS             9788168..9788224
FT                   /codon_start=1
FT                   /locus_tag="mCG_54218"
FT                   /product="mCG54218, isoform CRA_a"
FT                   /note="gene_id=mCG54218.1 transcript_id=mCT181387.0
FT                   protein_id=mCP104309.0 isoform=CRA_a"
FT                   /protein_id="EDL20197.1"
FT                   /translation="MLTVLSSQPAFPLSVVFP"
FT   assembly_gap    9792829..9793003
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            complement(9817292..9818598)
FT                   /pseudo
FT                   /locus_tag="mCG_19420"
FT                   /note="gene_id=mCG19420.2"
FT   mRNA            complement(join(9817292..9817656,9818055..9818598))
FT                   /pseudo
FT                   /locus_tag="mCG_19420"
FT                   /note="gene_id=mCG19420.2 transcript_id=mCT19004.2 created
FT                   on 26-JUN-2003"
FT   assembly_gap    9817657..9818054
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    9819185..9819530
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    9822040..9822142
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    9828087..9828292
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    9831204..9831271
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            <9831272..9870409
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /note="gene_id=mCG2589.1"
FT   mRNA            join(9831272..9831307,9833359..9833403,9840796..9840831,
FT                   9840926..9841037,9843043..9843448,9845734..9845932,
FT                   9851088..9851199,9860509..9860656,9861633..9861732,
FT                   9864767..9864897,9866009..9866104,9869264..9870409)
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, transcript variant
FT                   mCT1940"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT1940.1 created on
FT                   06-DEC-2002"
FT   mRNA            join(<9831272..9831307,9833359..9833403,9840796..9840831,
FT                   9840926..9843448,9845734..9845932,9851088..9851199,
FT                   9860509..9860656,9861633..9861732,9864767..9864897,
FT                   9866009..9866104,9869264..9870407)
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, transcript variant
FT                   mCT191431"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT191431.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<9831272..9831307,9833359..9833403,9840796..9840885,
FT                   9845734..9845932,9851088..9851199,9860509..9860656,
FT                   9861633..9861732,9864767..9864897,9866009..9866104,
FT                   9869264..9869772)
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, transcript variant
FT                   mCT191430"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT191430.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(9831292..9831307,9833359..9833403,9840796..9840831,
FT                   9840926..9841037,9843043..9843448,9845734..9845932,
FT                   9851088..9851199,9860509..9860656,9861633..9861732,
FT                   9864767..9864897,9866009..9866104,9869264..9869605)
FT                   /codon_start=1
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, isoform CRA_c"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT1940.1
FT                   protein_id=mCP19967.2 isoform=CRA_c"
FT                   /protein_id="EDL20192.1"
FT                   HRQM"
FT   CDS             join(<9840874..9840885,9845734..9845932,9851088..9851199,
FT                   9860509..9860656,9861633..9861732,9864767..9864897,
FT                   9866009..9866104,9869264..9869605)
FT                   /codon_start=1
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, isoform CRA_a"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT191430.0
FT                   protein_id=mCP112401.0 isoform=CRA_a"
FT                   /protein_id="EDL20190.1"
FT   CDS             join(<9842945..9843448,9845734..9845932,9851088..9851199,
FT                   9860509..9860656,9861633..9861732,9864767..9864897,
FT                   9866009..9866104,9869264..9869605)
FT                   /codon_start=1
FT                   /gene="Zfp326"
FT                   /locus_tag="mCG_2589"
FT                   /product="zinc finger protein 326, isoform CRA_b"
FT                   /note="gene_id=mCG2589.1 transcript_id=mCT191431.0
FT                   protein_id=mCP112402.0 isoform=CRA_b"
FT                   /protein_id="EDL20191.1"
FT   assembly_gap    9874337..9874356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9877612..9877631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9885477..9885496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9886981..9887123
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    9889530..9889549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9898235..9899019
FT                   /estimated_length=785
FT                   /gap_type="unknown"
FT   assembly_gap    9905246..9905265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9907125..9907144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9908957..9908976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9922874..9922893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9928816..9928835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9930201..9930456
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    9957038..9957057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9964550..9965979
FT                   /estimated_length=1430
FT                   /gap_type="unknown"
FT   assembly_gap    9978225..9979045
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    9980246..9982005
FT                   /estimated_length=1760
FT                   /gap_type="unknown"
FT   assembly_gap    9987705..9988185
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    10000108..10000127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10002592..10002611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10017492..10018059
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    10019050..10020184
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    10036343..10036413
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            <10053558..10062050
FT                   /locus_tag="mCG_144684"
FT                   /note="gene_id=mCG144684.0"
FT   mRNA            join(<10053558..10053614,10057610..10057905,
FT                   10059702..10062050)
FT                   /locus_tag="mCG_144684"
FT                   /product="mCG144684"
FT                   /note="gene_id=mCG144684.0 transcript_id=mCT184108.0
FT                   created on 05-JUN-2003"
FT   CDS             <10061458..10061685
FT                   /codon_start=1
FT                   /locus_tag="mCG_144684"
FT                   /product="mCG144684"
FT                   /note="gene_id=mCG144684.0 transcript_id=mCT184108.0
FT                   protein_id=mCP105421.0"
FT                   /protein_id="EDL20189.1"
FT   assembly_gap    10066339..10066358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10080157..10080177
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    10090793..10090936
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    10099102..10102821
FT                   /estimated_length=3720
FT                   /gap_type="unknown"
FT   assembly_gap    10103844..10103863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10105741..10105760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10107407..10110788
FT                   /estimated_length=3382
FT                   /gap_type="unknown"
FT   assembly_gap    10114719..10114738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10117895..10118149
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            10166690..10167849
FT                   /pseudo
FT                   /locus_tag="mCG_2587"
FT                   /note="gene_id=mCG2587.2"
FT   mRNA            join(10166690..10167041,10167165..10167849)
FT                   /pseudo
FT                   /locus_tag="mCG_2587"
FT                   /note="gene_id=mCG2587.2 transcript_id=mCT1946.2 created on
FT                   19-MAR-2003"
FT   assembly_gap    10167139..10167158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10173006..10173025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10203934..10203953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10207844..10208206
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    10212476..10212495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10264070..10264530
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    10270834..10270953
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    10272321..10272883
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    10284499..10284520
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10288814..10288833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10293476..10293950
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   gene            10302464..10316984
FT                   /locus_tag="mCG_1030434"
FT                   /note="gene_id=mCG1030434.1"
FT   mRNA            join(10302464..10302706,10307339..10307459,
FT                   10316375..10316984)
FT                   /locus_tag="mCG_1030434"
FT                   /product="mCG1030434"
FT                   /note="gene_id=mCG1030434.1 transcript_id=mCT148138.1
FT                   created on 19-MAR-2003"
FT   assembly_gap    10304900..10304919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10306094..10306113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10307387..10307459,10316375..10316706)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030434"
FT                   /product="mCG1030434"
FT                   /note="gene_id=mCG1030434.1 transcript_id=mCT148138.1
FT                   protein_id=mCP63230.1"
FT                   /protein_id="EDL20188.1"
FT   gene            complement(10317306..10320443)
FT                   /locus_tag="mCG_147658"
FT                   /note="gene_id=mCG147658.0"
FT   mRNA            complement(join(10317306..10318565,10320419..10320443))
FT                   /locus_tag="mCG_147658"
FT                   /product="mCG147658"
FT                   /note="gene_id=mCG147658.0 transcript_id=mCT187921.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10318188..10318349)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147658"
FT                   /product="mCG147658"
FT                   /note="gene_id=mCG147658.0 transcript_id=mCT187921.0
FT                   protein_id=mCP109052.0"
FT                   /protein_id="EDL20187.1"
FT                   NLTNDTGY"
FT   assembly_gap    10318792..10319397
FT                   /estimated_length=606
FT                   /gap_type="unknown"
FT   assembly_gap    10320780..10320881
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    10362133..10362322
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    10372154..10372173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10384295..10384405
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    10405606..10405625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10406711..10412335)
FT                   /gene="E130309B19Rik"
FT                   /locus_tag="mCG_2586"
FT                   /note="gene_id=mCG2586.2"
FT   mRNA            complement(join(10406711..10407838,10409619..10409844,
FT                   10411395..10412335))
FT                   /gene="E130309B19Rik"
FT                   /locus_tag="mCG_2586"
FT                   /product="RIKEN cDNA E130309B19"
FT                   /note="gene_id=mCG2586.2 transcript_id=mCT1945.2 created on
FT                   19-MAR-2003"
FT   CDS             complement(join(10407526..10407838,10409619..10409844,
FT                   10411395..10412010))
FT                   /codon_start=1
FT                   /gene="E130309B19Rik"
FT                   /locus_tag="mCG_2586"
FT                   /product="RIKEN cDNA E130309B19"
FT                   /note="gene_id=mCG2586.2 transcript_id=mCT1945.2
FT                   protein_id=mCP19953.2"
FT                   /protein_id="EDL20186.1"
FT   assembly_gap    10412420..10412627
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   gene            complement(10419860..10425069)
FT                   /locus_tag="mCG_147679"
FT                   /note="gene_id=mCG147679.0"
FT   mRNA            complement(join(10419860..10422093,10425041..10425069))
FT                   /locus_tag="mCG_147679"
FT                   /product="mCG147679"
FT                   /note="gene_id=mCG147679.0 transcript_id=mCT187942.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10420402..10420542)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147679"
FT                   /product="mCG147679"
FT                   /note="gene_id=mCG147679.0 transcript_id=mCT187942.0
FT                   protein_id=mCP109073.0"
FT                   /protein_id="EDL20185.1"
FT                   D"
FT   assembly_gap    10440872..10440939
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    10478051..10478942
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   assembly_gap    10480858..10480877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10493137..10493156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10497537..10497741
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    10528659..10528708
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    10545188..10545317
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(10570686..10650656)
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /note="gene_id=mCG142646.0"
FT   mRNA            complement(join(10570686..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10644492..10644698,10649464..10649520,10650059..10650371))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181353"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181353.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(10570689..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620791,10650357..10650656))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181349"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181349.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(10570689..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10644492..10644698,10650357..10650475))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181351"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181351.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(10570689..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620791,10635758..10635867,10644492..10644698,
FT                   10649464..10649520,10650357..10650457))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181348"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181348.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(10570689..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620791,10649623..10649800))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181350"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181350.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(10571936..10572371,10573483..10573585,
FT                   10650357..10650630))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181352"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181352.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(10572179..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10644492..10644502))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_c"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181351.0
FT                   protein_id=mCP104274.0 isoform=CRA_c"
FT                   /protein_id="EDL20182.1"
FT   CDS             complement(join(10572179..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10644492..10644502))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_c"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181353.0
FT                   protein_id=mCP104270.0 isoform=CRA_c"
FT                   /protein_id="EDL20184.1"
FT   CDS             complement(join(10572179..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620774))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_b"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181348.0
FT                   protein_id=mCP104271.0 isoform=CRA_b"
FT                   /protein_id="EDL20179.1"
FT                   LLMAEAAS"
FT   CDS             complement(join(10572179..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620774))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_b"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181349.0
FT                   protein_id=mCP104269.0 isoform=CRA_b"
FT                   /protein_id="EDL20180.1"
FT                   LLMAEAAS"
FT   CDS             complement(join(10572179..10572371,10573483..10573585,
FT                   10588779..10589384,10589558..10590271,10590365..10592583,
FT                   10620731..10620774))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_b"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181350.0
FT                   protein_id=mCP104275.0 isoform=CRA_b"
FT                   /protein_id="EDL20181.1"
FT                   LLMAEAAS"
FT   CDS             complement(join(10572179..10572371,10573483..10573532))
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_d"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181352.0
FT                   protein_id=mCP104272.0 isoform=CRA_d"
FT                   /protein_id="EDL20183.1"
FT   mRNA            complement(join(10643641..10644698,10649464..10649520,
FT                   10649623..10649846))
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, transcript variant
FT                   mCT181347"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181347.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(10644275..10644400)
FT                   /codon_start=1
FT                   /gene="Zfp644"
FT                   /locus_tag="mCG_142646"
FT                   /product="zinc finger protein 644, isoform CRA_a"
FT                   /note="gene_id=mCG142646.0 transcript_id=mCT181347.0
FT                   protein_id=mCP104273.0 isoform=CRA_a"
FT                   /protein_id="EDL20178.1"
FT   assembly_gap    10665322..10665341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10671648..10671667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10673994..10674013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10677249..10677268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10678278..10678297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10689504..10690367
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    10708911..10708958
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    10711096..10711332
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    10713006..10713025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10719241..10719260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10726718..10726737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10737987..10738583
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    10740734..10740753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10757591..10757610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10759237..10759461
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    10760536..10760555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10765240..10765357
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    10767363..10768191
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   gene            complement(10800124..10805005)
FT                   /locus_tag="mCG_127275"
FT                   /note="gene_id=mCG127275.1"
FT   mRNA            complement(join(10800124..10800262,10801148..10801299,
FT                   10801990..10802101,10804915..10805005))
FT                   /locus_tag="mCG_127275"
FT                   /product="mCG127275"
FT                   /note="gene_id=mCG127275.1 transcript_id=mCT128558.1
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(10800193..10800262,10801148..10801248))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127275"
FT                   /product="mCG127275"
FT                   /note="gene_id=mCG127275.1 transcript_id=mCT128558.1
FT                   protein_id=mCP63186.1"
FT                   /protein_id="EDL20177.1"
FT                   KALLGIFNGIF"
FT   assembly_gap    10843948..10843967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10848836..10848855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10861150..10885364)
FT                   /gene="Hfm1"
FT                   /locus_tag="mCG_127266"
FT                   /note="gene_id=mCG127266.1"
FT   mRNA            complement(join(10861150..10861407,10863389..10863521,
FT                   10863909..10863979,10870240..10870287,10870572..10870759,
FT                   10876472..10876775,10880113..10880226,10881961..10882058,
FT                   10883978..10884083,10884867..10884989))
FT                   /gene="Hfm1"
FT                   /locus_tag="mCG_127266"
FT                   /product="HFM1, ATP-dependent DNA helicase homolog (S.
FT                   cerevisiae), transcript variant mCT128549"
FT                   /note="gene_id=mCG127266.1 transcript_id=mCT128549.1
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(10861385..10861407,10863389..10863521,
FT                   10863909..10863979,10870240..10870287,10870572..10870759,
FT                   10876472..10876775,10880113..10880226,10881961..10881973))
FT                   /codon_start=1
FT                   /gene="Hfm1"
FT                   /locus_tag="mCG_127266"
FT                   /product="HFM1, ATP-dependent DNA helicase homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG127266.1 transcript_id=mCT128549.1
FT                   protein_id=mCP62618.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CA92"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3036246"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CA92"
FT                   /protein_id="EDL20175.1"
FT                   PWLNMKIVYREVGQCD"
FT   mRNA            complement(join(10862899..10863088,10863186..10863521,
FT                   10881961..10882058,10883978..10884083,10885303..10885364))
FT                   /gene="Hfm1"
FT                   /locus_tag="mCG_127266"
FT                   /product="HFM1, ATP-dependent DNA helicase homolog (S.
FT                   cerevisiae), transcript variant mCT181602"
FT                   /note="gene_id=mCG127266.1 transcript_id=mCT181602.0
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(10863494..10863521,10881961..10882031))
FT                   /codon_start=1
FT                   /gene="Hfm1"
FT                   /locus_tag="mCG_127266"
FT                   /product="HFM1, ATP-dependent DNA helicase homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG127266.1 transcript_id=mCT181602.0
FT                   protein_id=mCP104524.0 isoform=CRA_b"
FT                   /protein_id="EDL20176.1"
FT                   /translation="MPKSDDCFFSMDNLFFSSPDETENFFTQIGIL"
FT   assembly_gap    10865940..10865959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10893796..10893815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10894919..10894938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10896274..10896293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10903196..10903215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10917599..10937570
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /note="gene_id=mCG19140.1"
FT   mRNA            join(10917599..10917702,10918210..10918391,
FT                   10922135..10922218,10922436..10922571,10926018..10926111,
FT                   10926196..10926338,10927048..10927291,10927872..10927967,
FT                   10928756..10928931,10929784..10929866,10932445..10932594,
FT                   10936103..10937570)
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), transcript
FT                   variant mCT17919"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT17919.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<10917599..10917702,10918210..10918391,
FT                   10922135..10922218,10922436..10922571,10926018..10926111,
FT                   10926196..10926338,10927048..10927291,10928756..10928931,
FT                   10929784..10929866,10932445..10932594,10936103..10937570)
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), transcript
FT                   variant mCT191410"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191410.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10917669..10917702,10918210..10918391,
FT                   10922135..10922218,10922436..10922571,10926018..10926111,
FT                   10926196..10926338,10927048..10927291,10927872..10928931,
FT                   10929784..10929866,10932445..10932594,10936103..10937570)
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), transcript
FT                   variant mCT191411"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191411.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10918235..10918391,10922135..10922218,
FT                   10922436..10922571,10926018..10926111,10926196..10926338,
FT                   10927048..10927291,10928756..10928931,10929784..10929866,
FT                   10932445..10932594,10936103..10936494)
FT                   /codon_start=1
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191410.0
FT                   protein_id=mCP112394.0 isoform=CRA_b"
FT                   /protein_id="EDL20172.1"
FT   CDS             join(<10918235..10918391,10922135..10922218,
FT                   10922436..10922571,10926018..10926111,10926196..10926338,
FT                   10927048..10927291,10927872..10927988)
FT                   /codon_start=1
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191411.0
FT                   protein_id=mCP112395.0 isoform=CRA_c"
FT                   /protein_id="EDL20173.1"
FT   mRNA            join(<10918295..10918391,10922135..10922218,
FT                   10922436..10922571,10926018..10926111,10926196..10926338,
FT                   10927048..10927291,10927872..10927967,10928180..10928338,
FT                   10928756..10928931,10929784..10929866,10932445..10932594,
FT                   10936103..10936494)
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), transcript
FT                   variant mCT191409"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191409.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(10918295..10918391,10922135..10922218,
FT                   10922436..10922571,10926018..10926111,10926196..10926338,
FT                   10927048..10927291,10927872..10927967,10928756..10928931,
FT                   10929784..10929866,10932445..10932594,10936103..10936494)
FT                   /codon_start=1
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT17919.0
FT                   protein_id=mCP19965.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9Z0H0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1309511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0H0"
FT                   /protein_id="EDL20174.1"
FT   CDS             join(10918295..10918391,10922135..10922218,
FT                   10922436..10922571,10926018..10926111,10926196..10926338,
FT                   10927048..10927291,10927872..10927967,10928180..10928215)
FT                   /codon_start=1
FT                   /gene="Cdc7"
FT                   /locus_tag="mCG_19140"
FT                   /product="cell division cycle 7 (S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19140.1 transcript_id=mCT191409.0
FT                   protein_id=mCP112393.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UVV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1309511"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVV7"
FT                   /protein_id="EDL20171.1"
FT   assembly_gap    10929646..10929665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10940804..10940823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10942910..10942929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10955617..10956281
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    10975290..10975490
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    10982417..10982436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10995260..10995311
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    10996938..10996979
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            <11002515..11009725
FT                   /locus_tag="mCG_145319"
FT                   /note="gene_id=mCG145319.0"
FT   mRNA            join(<11002515..11002800,11007112..11007233,
FT                   11008901..11009725)
FT                   /locus_tag="mCG_145319"
FT                   /product="mCG145319"
FT                   /note="gene_id=mCG145319.0 transcript_id=mCT184743.0
FT                   created on 05-JUN-2003"
FT   CDS             <11008997..11009374
FT                   /codon_start=1
FT                   /locus_tag="mCG_145319"
FT                   /product="mCG145319"
FT                   /note="gene_id=mCG145319.0 transcript_id=mCT184743.0
FT                   protein_id=mCP105437.0"
FT                   /protein_id="EDL20170.1"
FT   assembly_gap    11030358..11030632
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            complement(11060352..11243474)
FT                   /gene="Tgfbr3"
FT                   /locus_tag="mCG_19131"
FT                   /note="gene_id=mCG19131.2"
FT   mRNA            complement(join(11060352..11063538,11072336..11072443,
FT                   11075277..11075324,11084395..11084512,11086664..11086960,
FT                   11090849..11091007,11091460..11091600,11093699..11093851,
FT                   11094314..11094642,11096287..11096476,11101958..11102105,
FT                   11103722..11103890,11108184..11108367,11131855..11131992,
FT                   11168679..11168863,11220039..11220195,11243054..11243474))
FT                   /gene="Tgfbr3"
FT                   /locus_tag="mCG_19131"
FT                   /product="transforming growth factor, beta receptor III"
FT                   /note="gene_id=mCG19131.2 transcript_id=mCT17558.2 created
FT                   on 24-MAR-2003"
FT   CDS             complement(join(11063420..11063538,11072336..11072443,
FT                   11075277..11075324,11084395..11084512,11086664..11086960,
FT                   11090849..11091007,11091460..11091600,11093699..11093851,
FT                   11094314..11094642,11096287..11096476,11101958..11102105,
FT                   11103722..11103890,11108184..11108367,11131855..11131992,
FT                   11168679..11168863,11220039..11220105))
FT                   /codon_start=1
FT                   /gene="Tgfbr3"
FT                   /locus_tag="mCG_19131"
FT                   /product="transforming growth factor, beta receptor III"
FT                   /note="gene_id=mCG19131.2 transcript_id=mCT17558.2
FT                   protein_id=mCP19954.2"
FT                   /db_xref="GOA:A0A0R4J097"
FT                   /db_xref="InterPro:IPR001507"
FT                   /db_xref="InterPro:IPR017977"
FT                   /db_xref="MGI:MGI:104637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J097"
FT                   /protein_id="EDL20169.1"
FT   assembly_gap    11065467..11065486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11067697..11067716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11069532..11069741
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    11080981..11081207
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    11111404..11111464
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    11112025..11112198
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    11165635..11165809
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            11195401..11196142
FT                   /pseudo
FT                   /locus_tag="mCG_51312"
FT                   /note="gene_id=mCG51312.2"
FT   mRNA            11195401..11196142
FT                   /pseudo
FT                   /locus_tag="mCG_51312"
FT                   /note="gene_id=mCG51312.2 transcript_id=mCT51495.2 created
FT                   on 24-MAR-2003"
FT   assembly_gap    11196359..11196501
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    11215042..11215111
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    11231513..11232007
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    11240530..11240549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11274517..11274644
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    11280376..11280576
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            11284970..11341819
FT                   /gene="Brdt"
FT                   /locus_tag="mCG_127267"
FT                   /note="gene_id=mCG127267.1"
FT   mRNA            join(11284970..11285118,11294973..11295114,
FT                   11295693..11295932,11297226..11297363,11298809..11298923,
FT                   11302139..11302311,11303749..11304099,11310489..11310617,
FT                   11311484..11311672,11312574..11312746,11312930..11313210,
FT                   11313317..11313442,11313509..11313724,11323049..11323110,
FT                   11323901..11324075,11330968..11331065,11331713..11331918,
FT                   11332607..11332787,11340219..11341819)
FT                   /gene="Brdt"
FT                   /locus_tag="mCG_127267"
FT                   /product="bromodomain, testis-specific"
FT                   /note="gene_id=mCG127267.1 transcript_id=mCT128550.1
FT                   created on 06-DEC-2002"
FT   assembly_gap    11294027..11294046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(11295744..11295932,11297226..11297363,
FT                   11298809..11298923,11302139..11302311,11303749..11304099,
FT                   11310489..11310617,11311484..11311672,11312574..11312746,
FT                   11312930..11313210,11313317..11313442,11313509..11313724,
FT                   11323049..11323110,11323901..11324075,11330968..11331065,
FT                   11331713..11331918,11332607..11332787,11340219..11340287)
FT                   /codon_start=1
FT                   /gene="Brdt"
FT                   /locus_tag="mCG_127267"
FT                   /product="bromodomain, testis-specific"
FT                   /note="gene_id=mCG127267.1 transcript_id=mCT128550.1
FT                   protein_id=mCP62620.1"
FT                   /db_xref="GOA:Q91Y44"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR031354"
FT                   /db_xref="MGI:MGI:1891374"
FT                   /db_xref="PDB:2WP1"
FT                   /db_xref="PDB:2WP2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91Y44"
FT                   /protein_id="EDL20168.1"
FT   assembly_gap    11306279..11306358
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    11316998..11317017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11325397..11325416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11326643..11326662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11328519..11328538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11333968..11334077
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            complement(11347492..11351863)
FT                   /locus_tag="mCG_1030696"
FT                   /note="gene_id=mCG1030696.0"
FT   mRNA            complement(join(11347492..11347699,11347745..11347886,
FT                   11351736..11351863))
FT                   /locus_tag="mCG_1030696"
FT                   /product="mCG1030696"
FT                   /note="gene_id=mCG1030696.0 transcript_id=mCT148400.0
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(11347678..11347699,11347745..11347886,
FT                   11351736..11351754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030696"
FT                   /product="mCG1030696"
FT                   /note="gene_id=mCG1030696.0 transcript_id=mCT148400.0
FT                   protein_id=mCP62361.1"
FT                   /protein_id="EDL20167.1"
FT                   PHFPMIQRGVTDAKG"
FT   assembly_gap    11347705..11347724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11353416..11353435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11357801..11358257
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   gene            <11358258..11384687
FT                   /gene="Abhd7"
FT                   /locus_tag="mCG_142678"
FT                   /note="gene_id=mCG142678.0"
FT   mRNA            join(<11358258..11358445,11360702..11360787,
FT                   11367686..11367843,11368170..11368298,11374449..11374552,
FT                   11381458..11381606,11384321..11384687)
FT                   /gene="Abhd7"
FT                   /locus_tag="mCG_142678"
FT                   /product="abhydrolase domain containing 7"
FT                   /note="gene_id=mCG142678.0 transcript_id=mCT181605.0
FT                   created on 24-MAR-2003"
FT   CDS             join(<11358260..11358445,11360702..11360787,
FT                   11367686..11367843,11368170..11368298,11374449..11374552,
FT                   11381458..11381606,11384321..11384549)
FT                   /codon_start=1
FT                   /gene="Abhd7"
FT                   /locus_tag="mCG_142678"
FT                   /product="abhydrolase domain containing 7"
FT                   /note="gene_id=mCG142678.0 transcript_id=mCT181605.0
FT                   protein_id=mCP104527.0"
FT                   /protein_id="EDL20166.1"
FT                   EETRRD"
FT   gene            complement(11359493..>11386569)
FT                   /locus_tag="mCG_145972"
FT                   /note="gene_id=mCG145972.0"
FT   mRNA            complement(join(11359493..11360283,11384450..11384522,
FT                   11386482..>11386569))
FT                   /locus_tag="mCG_145972"
FT                   /product="mCG145972"
FT                   /note="gene_id=mCG145972.0 transcript_id=mCT186080.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(11359757..>11360149)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145972"
FT                   /product="mCG145972"
FT                   /note="gene_id=mCG145972.0 transcript_id=mCT186080.0
FT                   protein_id=mCP107397.0"
FT                   /protein_id="EDL20165.1"
FT   assembly_gap    11380107..11380126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11386207..11389697
FT                   /gene="4921521K07Rik"
FT                   /locus_tag="mCG_53862"
FT                   /note="gene_id=mCG53862.2"
FT   mRNA            join(11386207..11386636,11387346..11389697)
FT                   /gene="4921521K07Rik"
FT                   /locus_tag="mCG_53862"
FT                   /product="RIKEN cDNA 4921521K07"
FT                   /note="gene_id=mCG53862.2 transcript_id=mCT54045.2 created
FT                   on 25-MAR-2003"
FT   CDS             11387465..11389015
FT                   /codon_start=1
FT                   /gene="4921521K07Rik"
FT                   /locus_tag="mCG_53862"
FT                   /product="RIKEN cDNA 4921521K07"
FT                   /note="gene_id=mCG53862.2 transcript_id=mCT54045.2
FT                   protein_id=mCP40090.2"
FT                   /db_xref="GOA:B2RT16"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1918152"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT16"
FT                   /protein_id="EDL20164.1"
FT   assembly_gap    11396244..11396263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11397487..11397506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11448399..11448458
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            11452408..11467229
FT                   /locus_tag="mCG_19133"
FT                   /note="gene_id=mCG19133.2"
FT   mRNA            join(11452408..11452537,11454714..11454775,
FT                   11458013..11458688,11459178..11459268,11459665..11459804,
FT                   11461550..11467229)
FT                   /locus_tag="mCG_19133"
FT                   /product="mCG19133, transcript variant mCT17560"
FT                   /note="gene_id=mCG19133.2 transcript_id=mCT17560.2 created
FT                   on 14-FEB-2003"
FT   mRNA            join(11452462..11452537,11454714..11454775,
FT                   11458013..11458688,11459181..11459268,11459665..11459804,
FT                   11461550..11467229)
FT                   /locus_tag="mCG_19133"
FT                   /product="mCG19133, transcript variant mCT180584"
FT                   /note="gene_id=mCG19133.2 transcript_id=mCT180584.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(11452504..11452537,11454714..11454775,
FT                   11458013..11458688,11459178..11459268,11459665..11459804,
FT                   11461550..11463813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19133"
FT                   /product="mCG19133, isoform CRA_b"
FT                   /note="gene_id=mCG19133.2 transcript_id=mCT17560.2
FT                   protein_id=mCP19968.2 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:2445097"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9V7"
FT                   /protein_id="EDL20163.1"
FT   CDS             join(11452504..11452537,11454714..11454775,
FT                   11458013..11458688,11459181..11459268,11459665..11459804,
FT                   11461550..11463813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19133"
FT                   /product="mCG19133, isoform CRA_a"
FT                   /note="gene_id=mCG19133.2 transcript_id=mCT180584.0
FT                   protein_id=mCP103506.0 isoform=CRA_a"
FT                   /protein_id="EDL20162.1"
FT   assembly_gap    11457946..11457968
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            11462295..11535266
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /note="gene_id=mCG19144.3"
FT   mRNA            join(11462295..11463796,11493804..11493897,
FT                   11533189..11533345,11533580..11535266)
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, transcript variant
FT                   mCT182165"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT182165.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(11462314..11463796,11493804..11493897,
FT                   11533189..11533306)
FT                   /codon_start=1
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, isoform CRA_d"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT182165.0
FT                   protein_id=mCP105085.0 isoform=CRA_d"
FT                   /protein_id="EDL20160.1"
FT   mRNA            join(11463620..11463796,11493804..11493897,
FT                   11498596..11498689,11500364..11500532,11500877..11500955,
FT                   11503761..11506218)
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, transcript variant
FT                   mCT180587"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180587.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(11489382..11489480,11493804..11493897,
FT                   11498596..11498689,11500364..11500532,11500877..11500955,
FT                   11502793..11503054)
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, transcript variant
FT                   mCT17922"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT17922.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(11489391..11489480,11493804..11493897,
FT                   11495628..11495835,11498596..11498689,11500364..11500532,
FT                   11500877..11500955,11503761..11506218)
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, transcript variant
FT                   mCT180585"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180585.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(11489428..11489480,11493804..11493897,
FT                   11498596..11503698)
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, transcript variant
FT                   mCT180586"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180586.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(11493823..11493897,11498596..11498689,
FT                   11500364..11500532,11500877..11500955,11503761..11503766)
FT                   /codon_start=1
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, isoform CRA_c"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180587.1
FT                   protein_id=mCP103508.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR027857"
FT                   /db_xref="MGI:MGI:5662806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JDB2"
FT                   /protein_id="EDL20159.1"
FT   CDS             join(11493823..11493897,11498596..11498689,
FT                   11500364..11500532,11500877..11500955,11502793..11502936)
FT                   /codon_start=1
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, isoform CRA_e"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT17922.1
FT                   protein_id=mCP19949.2 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR027857"
FT                   /db_xref="MGI:MGI:1923671"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9D1"
FT                   /protein_id="EDL20161.1"
FT   CDS             join(11493823..11493897,11498596..11498745)
FT                   /codon_start=1
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, isoform CRA_b"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180586.0
FT                   protein_id=mCP103507.0 isoform=CRA_b"
FT                   /protein_id="EDL20158.1"
FT   CDS             join(11493823..11493897,11495628..11495639)
FT                   /codon_start=1
FT                   /gene="1700028K03Rik"
FT                   /locus_tag="mCG_19144"
FT                   /product="RIKEN cDNA 1700028K03, isoform CRA_a"
FT                   /note="gene_id=mCG19144.3 transcript_id=mCT180585.0
FT                   protein_id=mCP103509.0 isoform=CRA_a"
FT                   /protein_id="EDL20157.1"
FT                   /translation="MAMDERRGKERVQWTTTIIISSSLKSPA"
FT   gene            complement(11503651..11551630)
FT                   /gene="Glmn"
FT                   /locus_tag="mCG_19137"
FT                   /note="gene_id=mCG19137.2"
FT   mRNA            complement(join(11503651..11503851,11504067..11504149,
FT                   11505648..11505771,11511958..11512021,11512594..11512700,
FT                   11513138..11513222,11515551..11515624,11515728..11515769,
FT                   11516517..11516606,11516920..11516950,11517426..11517479,
FT                   11524805..11524992,11526955..11527057,11528360..11528597,
FT                   11529907..11530015,11533126..11533242,11547494..11547619,
FT                   11550529..11550603,11551548..11551630))
FT                   /gene="Glmn"
FT                   /locus_tag="mCG_19137"
FT                   /product="glomulin, FKBP associated protein, transcript
FT                   variant mCT176849"
FT                   /note="gene_id=mCG19137.2 transcript_id=mCT176849.0 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(11503651..11503851,11504067..11504149,
FT                   11505648..11505771,11511958..11512021,11512594..11512700,
FT                   11513138..11513222,11515551..11515624,11515728..11515769,
FT                   11516517..11516606,11516920..11516950,11517426..11517479,
FT                   11524805..11524992,11526955..11527057,11528360..11528597,
FT                   11529907..11530015,11533126..11533242,11547494..11547619,
FT                   11550529..11550603,11551285..11551358))
FT                   /gene="Glmn"
FT                   /locus_tag="mCG_19137"
FT                   /product="glomulin, FKBP associated protein, transcript
FT                   variant mCT17915"
FT                   /note="gene_id=mCG19137.2 transcript_id=mCT17915.2 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(11503735..11503851,11504067..11504149,
FT                   11505648..11505771,11511958..11512021,11512594..11512700,
FT                   11513138..11513222,11515551..11515624,11515728..11515769,
FT                   11516517..11516606,11516920..11516950,11517426..11517479,
FT                   11524805..11524992,11526955..11527057,11528360..11528597,
FT                   11529907..11530015,11533126..11533242,11547494..11547619,
FT                   11550529..11550567))
FT                   /codon_start=1
FT                   /gene="Glmn"
FT                   /locus_tag="mCG_19137"
FT                   /product="glomulin, FKBP associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG19137.2 transcript_id=mCT176849.0
FT                   protein_id=mCP99771.0 isoform=CRA_a"
FT                   /protein_id="EDL20155.1"
FT   CDS             complement(join(11503735..11503851,11504067..11504149,
FT                   11505648..11505771,11511958..11512021,11512594..11512700,
FT                   11513138..11513222,11515551..11515624,11515728..11515769,
FT                   11516517..11516606,11516920..11516950,11517426..11517479,
FT                   11524805..11524992,11526955..11527057,11528360..11528597,
FT                   11529907..11530015,11533126..11533242,11547494..11547619,
FT                   11550529..11550567))
FT                   /codon_start=1
FT                   /gene="Glmn"
FT                   /locus_tag="mCG_19137"
FT                   /product="glomulin, FKBP associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG19137.2 transcript_id=mCT17915.2
FT                   protein_id=mCP19972.2 isoform=CRA_a"
FT                   /protein_id="EDL20156.1"
FT   assembly_gap    11535339..11535358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11551114..11615624
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /note="gene_id=mCG19132.3"
FT   mRNA            join(11551114..11551335,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609095,11615266..11615624)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT176845"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176845.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(11551114..11551335,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11595562..11596458)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT185198"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT185198.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(11551436..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609095,11615266..11615624)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT17559"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT17559.3 created
FT                   on 12-JUN-2003"
FT   mRNA            join(11551436..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11615266..11615624)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT176847"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176847.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(<11551436..11551601,11552267..11552312,
FT                   11555478..11555606,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609095,11615266..11615623)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT191365"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT191365.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(11551436..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11595562..11596458)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT176844"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176844.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(11551529..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11615266..11615275)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_e"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176847.1
FT                   protein_id=mCP99769.1 isoform=CRA_e"
FT                   /protein_id="EDL20152.1"
FT   CDS             join(11551529..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609083)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_a"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT17559.3
FT                   protein_id=mCP19962.3 isoform=CRA_a"
FT                   /protein_id="EDL20147.1"
FT   CDS             join(11551529..11551601,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11595562..11595565)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_b"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176844.1
FT                   protein_id=mCP99768.1 isoform=CRA_b"
FT                   /protein_id="EDL20148.1"
FT   mRNA            join(11551723..11551826,11552267..11552312,
FT                   11555478..11555592,11557273..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609095,11615266..11615624)
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, transcript variant
FT                   mCT176846"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176846.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(<11555523..11555606,11557273..11557371,
FT                   11557568..11557633,11560652..11560740,11571894..11571929,
FT                   11573575..11574508,11577455..11577549,11579643..11579723,
FT                   11586817..11586885,11608942..11609083)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_d"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT191365.0
FT                   protein_id=mCP112332.0 isoform=CRA_d"
FT                   /protein_id="EDL20151.1"
FT   CDS             join(11557276..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609083)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_c"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176845.1
FT                   protein_id=mCP99767.1 isoform=CRA_c"
FT                   /protein_id="EDL20149.1"
FT                   HLKFEDLEKLTMIFRTSC"
FT   CDS             join(11557276..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11608942..11609083)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_c"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT176846.1
FT                   protein_id=mCP99766.1 isoform=CRA_c"
FT                   /protein_id="EDL20150.1"
FT                   HLKFEDLEKLTMIFRTSC"
FT   CDS             join(11557276..11557371,11557568..11557633,
FT                   11560652..11560740,11571894..11571929,11573575..11574508,
FT                   11577455..11577549,11579643..11579723,11586817..11586885,
FT                   11595562..11595565)
FT                   /codon_start=1
FT                   /gene="AW060207"
FT                   /locus_tag="mCG_19132"
FT                   /product="expressed sequence AW060207, isoform CRA_f"
FT                   /note="gene_id=mCG19132.3 transcript_id=mCT185198.0
FT                   protein_id=mCP106456.0 isoform=CRA_f"
FT                   /protein_id="EDL20153.1"
FT   gene            complement(11584005..11587605)
FT                   /locus_tag="mCG_19142"
FT                   /note="gene_id=mCG19142.1"
FT   mRNA            complement(join(11584005..11584188,11585472..11585550,
FT                   11587332..11587605))
FT                   /locus_tag="mCG_19142"
FT                   /product="mCG19142"
FT                   /note="gene_id=mCG19142.1 transcript_id=mCT17920.1 created
FT                   on 14-FEB-2003"
FT   CDS             complement(11584024..11584107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19142"
FT                   /product="mCG19142"
FT                   /note="gene_id=mCG19142.1 transcript_id=mCT17920.1
FT                   protein_id=mCP19948.1"
FT                   /protein_id="EDL20154.1"
FT                   /translation="MRHHEIRAVCSLYCSKQNGIQYITTKS"
FT   assembly_gap    11589683..11589768
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            complement(11612882..11641790)
FT                   /locus_tag="mCG_147655"
FT                   /note="gene_id=mCG147655.0"
FT   mRNA            complement(join(11612882..11613871,11641724..11641790))
FT                   /locus_tag="mCG_147655"
FT                   /product="mCG147655"
FT                   /note="gene_id=mCG147655.0 transcript_id=mCT187918.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11612957..11613163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147655"
FT                   /product="mCG147655"
FT                   /note="gene_id=mCG147655.0 transcript_id=mCT187918.0
FT                   protein_id=mCP109048.0"
FT                   /protein_id="EDL20146.1"
FT   assembly_gap    11645342..11645557
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            complement(11652046..>11657315)
FT                   /locus_tag="mCG_145318"
FT                   /note="gene_id=mCG145318.0"
FT   mRNA            complement(join(11652046..11653389,11656083..11656407,
FT                   11657244..>11657315))
FT                   /locus_tag="mCG_145318"
FT                   /product="mCG145318"
FT                   /note="gene_id=mCG145318.0 transcript_id=mCT184742.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11653380..11653389,11656083..11656407,
FT                   11657244..>11657247))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145318"
FT                   /product="mCG145318"
FT                   /note="gene_id=mCG145318.0 transcript_id=mCT184742.0
FT                   protein_id=mCP105436.0"
FT                   /protein_id="EDL20145.1"
FT                   ICLDFIAW"
FT   assembly_gap    11661177..11661196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11664803..11665137
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    11669847..11669866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11670647..11678351)
FT                   /gene="Gfi1"
FT                   /locus_tag="mCG_19138"
FT                   /note="gene_id=mCG19138.1"
FT   mRNA            complement(join(11670647..11671905,11674098..11674263,
FT                   11675092..11675229,11675348..11675835,11677230..11677415,
FT                   11677731..11678351))
FT                   /gene="Gfi1"
FT                   /locus_tag="mCG_19138"
FT                   /product="growth factor independent 1"
FT                   /note="gene_id=mCG19138.1 transcript_id=mCT17916.1 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(11671727..11671905,11674098..11674263,
FT                   11675092..11675229,11675348..11675835,11677230..11677415,
FT                   11677731..11677845))
FT                   /codon_start=1
FT                   /gene="Gfi1"
FT                   /locus_tag="mCG_19138"
FT                   /product="growth factor independent 1"
FT                   /note="gene_id=mCG19138.1 transcript_id=mCT17916.1
FT                   protein_id=mCP19964.2"
FT                   /db_xref="GOA:A0A0R4J292"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR029840"
FT                   /db_xref="MGI:MGI:103170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J292"
FT                   /protein_id="EDL20144.1"
FT   assembly_gap    11676653..11676680
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            complement(11698803..11829153)
FT                   /gene="Evi5"
FT                   /locus_tag="mCG_19136"
FT                   /note="gene_id=mCG19136.1"
FT   mRNA            complement(join(11698803..11702465,11718689..11718784,
FT                   11742249..11742344,11744412..11744558,11749749..11749907,
FT                   11751863..11752003,11753176..11753310,11766408..11766461,
FT                   11767596..11767656,11769661..11769758,11769852..11769941,
FT                   11770824..11770967,11772940..11773065,11773655..11773729,
FT                   11774483..11774707,11775756..11775945,11796149..11796378,
FT                   11829035..11829153))
FT                   /gene="Evi5"
FT                   /locus_tag="mCG_19136"
FT                   /product="ecotropic viral integration site 5, transcript
FT                   variant mCT17914"
FT                   /note="gene_id=mCG19136.1 transcript_id=mCT17914.1 created
FT                   on 04-DEC-2002"
FT   mRNA            complement(join(11698803..11702465,11718689..11718784,
FT                   11742249..11742344,11744412..11744558,11749749..11749907,
FT                   11751863..11752003,11753176..11753310,11766408..11766461,
FT                   11767596..11767656,11769661..11769758,11769852..11769941,
FT                   11770824..11770967,11772940..11773065,11773655..11773729,
FT                   11774483..11774707,11775756..11775945,11791519..11791544,
FT                   11796149..11796378,11829035..11829153))
FT                   /gene="Evi5"
FT                   /locus_tag="mCG_19136"
FT                   /product="ecotropic viral integration site 5, transcript
FT                   variant mCT176848"
FT                   /note="gene_id=mCG19136.1 transcript_id=mCT176848.0 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(11702415..11702465,11718689..11718784,
FT                   11742249..11742344,11744412..11744558,11749749..11749907,
FT                   11751863..11752003,11753176..11753310,11766408..11766461,
FT                   11767596..11767656,11769661..11769758,11769852..11769941,
FT                   11770824..11770967,11772940..11773065,11773655..11773729,
FT                   11774483..11774707,11775756..11775945,11796149..11796378,
FT                   11829035..11829085))
FT                   /codon_start=1
FT                   /gene="Evi5"
FT                   /locus_tag="mCG_19136"
FT                   /product="ecotropic viral integration site 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19136.1 transcript_id=mCT17914.1
FT                   protein_id=mCP19959.2 isoform=CRA_b"
FT                   /protein_id="EDL20142.1"
FT   CDS             complement(join(11702415..11702465,11718689..11718784,
FT                   11742249..11742344,11744412..11744558,11749749..11749907,
FT                   11751863..11752003,11753176..11753310,11766408..11766461,
FT                   11767596..11767656,11769661..11769758,11769852..11769941,
FT                   11770824..11770967,11772940..11773065,11773655..11773729,
FT                   11774483..11774707,11775756..11775945,11791519..11791532))
FT                   /codon_start=1
FT                   /gene="Evi5"
FT                   /locus_tag="mCG_19136"
FT                   /product="ecotropic viral integration site 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19136.1 transcript_id=mCT176848.0
FT                   protein_id=mCP99770.0 isoform=CRA_a"
FT                   /protein_id="EDL20141.1"
FT   assembly_gap    11722610..11722893
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    11742112..11742143
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    11778415..11778434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11784348..11785439
FT                   /gene="1700013N18Rik"
FT                   /locus_tag="mCG_19134"
FT                   /note="gene_id=mCG19134.0"
FT   mRNA            11784348..11785439
FT                   /gene="1700013N18Rik"
FT                   /locus_tag="mCG_19134"
FT                   /product="RIKEN cDNA 1700013N18"
FT                   /note="gene_id=mCG19134.0 transcript_id=mCT17561.0 created
FT                   on 04-DEC-2002"
FT   CDS             11784582..11785025
FT                   /codon_start=1
FT                   /gene="1700013N18Rik"
FT                   /locus_tag="mCG_19134"
FT                   /product="RIKEN cDNA 1700013N18"
FT                   /note="gene_id=mCG19134.0 transcript_id=mCT17561.0
FT                   protein_id=mCP19958.1"
FT                   /protein_id="EDL20143.1"
FT   assembly_gap    11822849..11823166
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    11829327..11829346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11839153..11839740
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    11848627..11848646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11854835..11862288
FT                   /locus_tag="mCG_13589"
FT                   /note="gene_id=mCG13589.2"
FT   mRNA            join(11854835..11854912,11856136..11856205,
FT                   11856288..11856403,11857528..11857662,11857925..11858127,
FT                   11858976..11859153,11861428..11861516,11862136..11862288)
FT                   /locus_tag="mCG_13589"
FT                   /product="mCG13589"
FT                   /note="gene_id=mCG13589.2 transcript_id=mCT15808.2 created
FT                   on 07-FEB-2003"
FT   CDS             join(11854910..11854912,11856136..11856205,
FT                   11856288..11856403,11857528..11857662,11857925..11858127,
FT                   11858976..11859153,11861428..11861516,11862136..11862235)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13589"
FT                   /product="mCG13589"
FT                   /note="gene_id=mCG13589.2 transcript_id=mCT15808.2
FT                   protein_id=mCP19955.2"
FT                   /db_xref="GOA:Q58EU6"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="MGI:MGI:102854"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU6"
FT                   /protein_id="EDL20140.1"
FT                   QKKASFLRAQERAAES"
FT   gene            complement(11863441..11946495)
FT                   /gene="2900024C23Rik"
FT                   /locus_tag="mCG_13592"
FT                   /note="gene_id=mCG13592.2"
FT   mRNA            complement(join(11863441..11864455,11865851..11866027,
FT                   11868580..11868687,11880412..11880546,11946386..11946495))
FT                   /gene="2900024C23Rik"
FT                   /locus_tag="mCG_13592"
FT                   /product="RIKEN cDNA 2900024C23, transcript variant
FT                   mCT15813"
FT                   /note="gene_id=mCG13592.2 transcript_id=mCT15813.2 created
FT                   on 04-DEC-2002"
FT   mRNA            complement(join(11863441..11864455,11865851..11866027,
FT                   11868580..11868695,11946397..11946470))
FT                   /gene="2900024C23Rik"
FT                   /locus_tag="mCG_13592"
FT                   /product="RIKEN cDNA 2900024C23, transcript variant
FT                   mCT176841"
FT                   /note="gene_id=mCG13592.2 transcript_id=mCT176841.0 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(11863643..11864455,11865851..11866027,
FT                   11868580..11868695,11946397..11946439))
FT                   /codon_start=1
FT                   /gene="2900024C23Rik"
FT                   /locus_tag="mCG_13592"
FT                   /product="RIKEN cDNA 2900024C23, isoform CRA_b"
FT                   /note="gene_id=mCG13592.2 transcript_id=mCT176841.0
FT                   protein_id=mCP99763.0 isoform=CRA_b"
FT                   /protein_id="EDL20139.1"
FT   CDS             complement(join(11863643..11864455,11865851..11866027,
FT                   11868580..11868687,11880412..11880546,11946386..11946439))
FT                   /codon_start=1
FT                   /gene="2900024C23Rik"
FT                   /locus_tag="mCG_13592"
FT                   /product="RIKEN cDNA 2900024C23, isoform CRA_a"
FT                   /note="gene_id=mCG13592.2 transcript_id=mCT15813.2
FT                   protein_id=mCP19978.2 isoform=CRA_a"
FT                   /protein_id="EDL20138.1"
FT   assembly_gap    11873169..11873188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11874201..11874220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11880920..11880971
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    11883199..11883234
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    11891490..11891509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11896637..11896656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11900325..11900344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11935337..11935510
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    11942563..11942975
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    11961147..11961185
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12002427..12002508
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    12006096..12006175
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    12010748..12010767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12017974..12019144
FT                   /estimated_length=1171
FT                   /gap_type="unknown"
FT   gene            complement(<12030519..12032956)
FT                   /locus_tag="mCG_147653"
FT                   /note="gene_id=mCG147653.0"
FT   mRNA            complement(join(<12030519..12031036,12031836..12032956))
FT                   /locus_tag="mCG_147653"
FT                   /product="mCG147653"
FT                   /note="gene_id=mCG147653.0 transcript_id=mCT187916.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<12030519..12030803)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147653"
FT                   /product="mCG147653"
FT                   /note="gene_id=mCG147653.0 transcript_id=mCT187916.0
FT                   protein_id=mCP109046.0"
FT                   /protein_id="EDL20137.1"
FT   assembly_gap    12031289..12031308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12046861..12066769
FT                   /gene="Mtf2"
FT                   /locus_tag="mCG_13604"
FT                   /note="gene_id=mCG13604.1"
FT   mRNA            join(<12046861..12046936,12047138..12047238,
FT                   12047783..12047931,12051905..12052000,12053182..12053250,
FT                   12053969..12054092,12058929..12058996,12060616..12060786,
FT                   12063819..12063924,12064064..12064116,12064224..12064328,
FT                   12066380..12066769)
FT                   /gene="Mtf2"
FT                   /locus_tag="mCG_13604"
FT                   /product="metal response element binding transcription
FT                   factor 2"
FT                   /note="gene_id=mCG13604.1 transcript_id=mCT15863.0 created
FT                   on 04-DEC-2002"
FT   CDS             join(12046861..12046936,12047138..12047238,
FT                   12047783..12047931,12051905..12052000,12053182..12053250,
FT                   12053969..12054092,12058929..12058996,12060616..12060786,
FT                   12063819..12063924,12064064..12064116,12064224..12064328,
FT                   12066380..12066386)
FT                   /codon_start=1
FT                   /gene="Mtf2"
FT                   /locus_tag="mCG_13604"
FT                   /product="metal response element binding transcription
FT                   factor 2"
FT                   /note="gene_id=mCG13604.1 transcript_id=mCT15863.0
FT                   protein_id=mCP19963.0"
FT                   /protein_id="EDL20136.1"
FT   gene            complement(12078818..12092165)
FT                   /gene="Tmed5"
FT                   /locus_tag="mCG_13593"
FT                   /note="gene_id=mCG13593.2"
FT   mRNA            complement(join(12078818..12078999,12089551..12089648,
FT                   12091767..12092095))
FT                   /gene="Tmed5"
FT                   /locus_tag="mCG_13593"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 5, transcript variant mCT176842"
FT                   /note="gene_id=mCG13593.2 transcript_id=mCT176842.0 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(12078906..12078999,12089551..12089648,
FT                   12091767..12091955))
FT                   /codon_start=1
FT                   /gene="Tmed5"
FT                   /locus_tag="mCG_13593"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 5, isoform CRA_b"
FT                   /note="gene_id=mCG13593.2 transcript_id=mCT176842.0
FT                   protein_id=mCP99764.0 isoform=CRA_b"
FT                   /protein_id="EDL20135.1"
FT   mRNA            complement(join(12081178..12084314,12085449..12085632,
FT                   12089551..12089648,12091767..12092165))
FT                   /gene="Tmed5"
FT                   /locus_tag="mCG_13593"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 5, transcript variant mCT15852"
FT                   /note="gene_id=mCG13593.2 transcript_id=mCT15852.1 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(12084096..12084314,12085449..12085632,
FT                   12089551..12089648,12091767..12091955))
FT                   /codon_start=1
FT                   /gene="Tmed5"
FT                   /locus_tag="mCG_13593"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG13593.2 transcript_id=mCT15852.1
FT                   protein_id=mCP19975.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2RS96"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015717"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="MGI:MGI:1921586"
FT                   /db_xref="UniProtKB/TrEMBL:A2RS96"
FT                   /protein_id="EDL20134.1"
FT                   DKRKSRT"
FT   gene            12091645..12194897
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /note="gene_id=mCG13595.2"
FT   mRNA            join(12091645..12091845,12094737..12094879,
FT                   12095288..12095459,12098242..12098385,12100189..12100295,
FT                   12108456..12108584,12115363..12115459,12118129..12118250,
FT                   12121071..12121362,12123252..12123376,12127589..12127743,
FT                   12131194..12131414,12134050..12134160,12135165..12135296,
FT                   12140686..12140820,12141103..12141180,12150132..12150248,
FT                   12153077..12153244,12154893..12155035,12157181..12157344,
FT                   12158935..12159148,12162498..12162597,12163238..12163354,
FT                   12167810..12167953,12173192..12173395,12177010..12177147,
FT                   12181920..12182120,12189823..12190290,12194003..12194897)
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, transcript
FT                   variant mCT180575"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180575.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(12092403..12092529,12094737..12094879,
FT                   12095288..12095459,12098242..12098400,12100189..12100295,
FT                   12108456..12108584,12115363..12115459,12118129..12118250,
FT                   12121071..12121362,12127589..12127743,12131194..12131414,
FT                   12134050..12134093)
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, transcript
FT                   variant mCT180577"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180577.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(12092405..12092614,12094737..12094879,
FT                   12095288..12095459,12098242..12098400,12100189..12100509,
FT                   12108456..12108584,12115363..12115459,12118129..12118250,
FT                   12121071..12121097)
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, transcript
FT                   variant mCT180576"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180576.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(12092408..12092529,12094737..12094879,
FT                   12095288..12095459,12098242..12098400,12100189..12100295,
FT                   12108456..12108584,12115363..12115459,12118129..12118250,
FT                   12121071..12121362,12123252..12123376,12127589..12127743,
FT                   12131194..12131414,12134050..12134160,12135165..12135296,
FT                   12140686..12140820,12141103..12141180,12150132..12150248,
FT                   12153077..12153244,12154893..12155035,12157181..12157344,
FT                   12158935..12159148,12162498..12162597,12163238..12163354,
FT                   12167810..12167953,12173192..12173395,12177010..12177147,
FT                   12181920..12182120,12189823..12190290,12194003..12194897)
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, transcript
FT                   variant mCT15853"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT15853.2 created
FT                   on 14-FEB-2003"
FT   CDS             join(12094740..12094879,12095288..12095459,
FT                   12098242..12098400,12100189..12100295,12108456..12108584,
FT                   12115363..12115459,12118129..12118250,12121071..12121362,
FT                   12123252..12123376,12127589..12127743,12131194..12131414,
FT                   12134050..12134160,12135165..12135296,12140686..12140820,
FT                   12141103..12141180,12150132..12150248,12153077..12153244,
FT                   12154893..12155035,12157181..12157344,12158935..12159148,
FT                   12162498..12162597,12163238..12163354,12167810..12167953,
FT                   12173192..12173395,12177010..12177147,12181920..12182120,
FT                   12189823..12190290,12194003..12194017)
FT                   /codon_start=1
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, isoform CRA_a"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT15853.2
FT                   protein_id=mCP19979.2 isoform=CRA_a"
FT                   /protein_id="EDL20130.1"
FT   CDS             join(12094740..12094879,12095288..12095459,
FT                   12098242..12098385,12100189..12100295,12108456..12108584,
FT                   12115363..12115459,12118129..12118250,12121071..12121362,
FT                   12123252..12123376,12127589..12127743,12131194..12131414,
FT                   12134050..12134160,12135165..12135296,12140686..12140820,
FT                   12141103..12141180,12150132..12150248,12153077..12153244,
FT                   12154893..12155035,12157181..12157344,12158935..12159148,
FT                   12162498..12162597,12163238..12163354,12167810..12167953,
FT                   12173192..12173395,12177010..12177147,12181920..12182120,
FT                   12189823..12190290,12194003..12194017)
FT                   /codon_start=1
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, isoform CRA_b"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180575.0
FT                   protein_id=mCP103498.0 isoform=CRA_b"
FT                   /protein_id="EDL20131.1"
FT   CDS             join(12094740..12094879,12095288..12095459,
FT                   12098242..12098400,12100189..12100295,12108456..12108584,
FT                   12115363..12115459,12118129..12118250,12121071..12121362,
FT                   12127589..12127594)
FT                   /codon_start=1
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, isoform CRA_d"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180577.0
FT                   protein_id=mCP103497.0 isoform=CRA_d"
FT                   /protein_id="EDL20133.1"
FT                   KLITQIPD"
FT   CDS             join(12094740..12094879,12095288..12095459,
FT                   12098242..12098400,12100189..12100299)
FT                   /codon_start=1
FT                   /gene="Ccdc18"
FT                   /locus_tag="mCG_13595"
FT                   /product="coiled-coil domain containing 18, isoform CRA_c"
FT                   /note="gene_id=mCG13595.2 transcript_id=mCT180576.0
FT                   protein_id=mCP103499.0 isoform=CRA_c"
FT                   /protein_id="EDL20132.1"
FT   gene            complement(12104579..12106278)
FT                   /pseudo
FT                   /locus_tag="mCG_13601"
FT                   /note="gene_id=mCG13601.2"
FT   mRNA            complement(join(12104579..12105299,12106024..12106278))
FT                   /pseudo
FT                   /locus_tag="mCG_13601"
FT                   /note="gene_id=mCG13601.2 transcript_id=mCT15859.2 created
FT                   on 25-MAR-2003"
FT   assembly_gap    12133749..12133768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12144101..12144120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12155846..12155865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12165268..12165287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12170643..12170662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12190946..12190965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12230196..12240228
FT                   /gene="Dr1"
FT                   /locus_tag="mCG_13599"
FT                   /note="gene_id=mCG13599.1"
FT   mRNA            join(12230196..12231088,12236853..12237016,
FT                   12239815..12240228)
FT                   /gene="Dr1"
FT                   /locus_tag="mCG_13599"
FT                   /product="down-regulator of transcription 1"
FT                   /note="gene_id=mCG13599.1 transcript_id=mCT15857.1 created
FT                   on 03-DEC-2002"
FT   CDS             join(12230869..12231088,12236853..12237016,
FT                   12239815..12239961)
FT                   /codon_start=1
FT                   /gene="Dr1"
FT                   /locus_tag="mCG_13599"
FT                   /product="down-regulator of transcription 1"
FT                   /note="gene_id=mCG13599.1 transcript_id=mCT15857.1
FT                   protein_id=mCP19939.2"
FT                   /protein_id="EDL20129.1"
FT                   AGSSQDEEDDDDI"
FT   assembly_gap    12248585..12248604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12255866..12256251
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    12263710..12263729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12274117..>12309259
FT                   /locus_tag="mCG_13607"
FT                   /note="gene_id=mCG13607.1"
FT   mRNA            join(<12274117..12274270,12275151..12275356,
FT                   12278448..12278657,12280010..12280198,12281081..12281222,
FT                   12288002..12288214,12292042..12292176,12293188..12293405,
FT                   12293897..12294178,12297351..12297775,12299764..12299955,
FT                   12303004..12303313,12305433..12305596,12309046..>12309259)
FT                   /locus_tag="mCG_13607"
FT                   /product="mCG13607, transcript variant mCT15866"
FT                   /note="gene_id=mCG13607.1 transcript_id=mCT15866.2 created
FT                   on 26-MAR-2003"
FT   CDS             join(12274117..12274270,12275151..12275356,
FT                   12278448..12278657,12280010..12280198,12281081..12281222,
FT                   12288002..12288214,12292042..12292176,12293188..12293405,
FT                   12293897..12294178,12297351..12297775,12299764..12299955,
FT                   12303004..12303313,12305433..12305596,12309046..12309259)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13607"
FT                   /product="mCG13607, isoform CRA_a"
FT                   /note="gene_id=mCG13607.1 transcript_id=mCT15866.2
FT                   protein_id=mCP19937.2 isoform=CRA_a"
FT                   /protein_id="EDL20127.1"
FT   assembly_gap    12292580..12292881
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   mRNA            join(12293885..12294200,12297351..12297775,
FT                   12299764..12299955,12303004..12303313,12305433..12305596,
FT                   12309046..>12309259)
FT                   /locus_tag="mCG_13607"
FT                   /product="mCG13607, transcript variant mCT181603"
FT                   /note="gene_id=mCG13607.1 transcript_id=mCT181603.0 created
FT                   on 26-MAR-2003"
FT   CDS             join(12294183..12294200,12297351..12297775,
FT                   12299764..12299955,12303004..12303313,12305433..12305596,
FT                   12309046..12309259)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13607"
FT                   /product="mCG13607, isoform CRA_b"
FT                   /note="gene_id=mCG13607.1 transcript_id=mCT181603.0
FT                   protein_id=mCP104525.0 isoform=CRA_b"
FT                   /protein_id="EDL20128.1"
FT   gene            12321394..12325092
FT                   /locus_tag="mCG_142511"
FT                   /note="gene_id=mCG142511.0"
FT   mRNA            join(12321394..12321432,12321525..12321757,
FT                   12324270..12325092)
FT                   /locus_tag="mCG_142511"
FT                   /product="mCG142511"
FT                   /note="gene_id=mCG142511.0 transcript_id=mCT180566.0
FT                   created on 14-FEB-2003"
FT   CDS             12324697..12324990
FT                   /codon_start=1
FT                   /locus_tag="mCG_142511"
FT                   /product="mCG142511"
FT                   /note="gene_id=mCG142511.0 transcript_id=mCT180566.0
FT                   protein_id=mCP103488.0"
FT                   /protein_id="EDL20126.1"
FT   assembly_gap    12328246..12329163
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   gene            12329290..12333978
FT                   /locus_tag="mCG_1030693"
FT                   /note="gene_id=mCG1030693.1"
FT   mRNA            join(12329290..12329484,12330527..12330849,
FT                   12331958..12333978)
FT                   /locus_tag="mCG_1030693"
FT                   /product="mCG1030693, transcript variant mCT148397"
FT                   /note="gene_id=mCG1030693.1 transcript_id=mCT148397.1
FT                   created on 14-FEB-2003"
FT   mRNA            join(12329409..12329484,12330527..12330849,
FT                   12333387..12333711)
FT                   /locus_tag="mCG_1030693"
FT                   /product="mCG1030693, transcript variant mCT180565"
FT                   /note="gene_id=mCG1030693.1 transcript_id=mCT180565.0
FT                   created on 14-FEB-2003"
FT   CDS             12330580..12330846
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030693"
FT                   /product="mCG1030693, isoform CRA_a"
FT                   /note="gene_id=mCG1030693.1 transcript_id=mCT180565.0
FT                   protein_id=mCP103487.0 isoform=CRA_a"
FT                   /protein_id="EDL20124.1"
FT   CDS             12331985..12332305
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030693"
FT                   /product="mCG1030693, isoform CRA_b"
FT                   /note="gene_id=mCG1030693.1 transcript_id=mCT148397.1
FT                   protein_id=mCP63029.1 isoform=CRA_b"
FT                   /protein_id="EDL20125.1"
FT                   TA"
FT   gene            12349565..12393051
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /note="gene_id=mCG141431.0"
FT   mRNA            join(12349565..12350062,12364322..12364474,
FT                   12365080..12365169,12380782..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391865..12392021,12392818..12393051)
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, transcript variant mCT175381"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT175381.0
FT                   created on 26-MAR-2003"
FT   mRNA            join(<12349581..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12385677,12386548..12386694,
FT                   12387769..12387876,12388113..12388509,12388909..12389009,
FT                   12389112..12389846,12390421..12390504,12391865..12392021,
FT                   12392818..12392968)
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, transcript variant mCT191435"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT191435.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<12349583..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384988)
FT                   /codon_start=1
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, isoform CRA_d"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT191435.0
FT                   protein_id=mCP112377.0 isoform=CRA_d"
FT                   /protein_id="EDL20123.1"
FT   mRNA            join(12349589..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391855..12392021,12392818..12392990)
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, transcript variant mCT181604"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT181604.0
FT                   created on 26-MAR-2003"
FT   mRNA            join(<12349595..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391865..12392021,12392818..12393051)
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, transcript variant mCT191434"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT191434.0
FT                   created on 09-MAR-2004"
FT   CDS             join(12349595..12350062,12364322..12364474,
FT                   12365080..12365169,12380782..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391865..12392021,12392818..12392879)
FT                   /codon_start=1
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT175381.0
FT                   protein_id=mCP98300.0 isoform=CRA_a"
FT                   /protein_id="EDL20120.1"
FT   CDS             join(12349595..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391865..12392021,12392818..12392879)
FT                   /codon_start=1
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT191434.0
FT                   protein_id=mCP112376.0 isoform=CRA_c"
FT                   /db_xref="GOA:P23440"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:97525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23440"
FT                   /protein_id="EDL20122.1"
FT   CDS             join(12349595..12350062,12364322..12364474,
FT                   12365080..12365169,12380785..12380925,12381013..12381087,
FT                   12381600..12381664,12382532..12382598,12382803..12382850,
FT                   12384323..12384472,12384755..12384898,12385612..12385677,
FT                   12386548..12386694,12387769..12387876,12388113..12388222,
FT                   12388422..12388509,12388909..12389009,12389112..12389219,
FT                   12389495..12389558,12389772..12389846,12390421..12390504,
FT                   12391855..12391905)
FT                   /codon_start=1
FT                   /gene="Pde6b"
FT                   /locus_tag="mCG_141431"
FT                   /product="phosphodiesterase 6B, cGMP, rod receptor, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG141431.0 transcript_id=mCT181604.0
FT                   protein_id=mCP104526.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q62037"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:97525"
FT                   /db_xref="UniProtKB/TrEMBL:Q62037"
FT                   /protein_id="EDL20121.1"
FT   assembly_gap    12354964..12355336
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    12368490..12368509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12374779..12375121
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    12377550..12378168
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    12379001..12379114
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            complement(12394564..12395763)
FT                   /locus_tag="mCG_13600"
FT                   /note="gene_id=mCG13600.1"
FT   mRNA            complement(join(12394564..12394652,12395046..12395144,
FT                   12395341..12395712))
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, transcript variant mCT175384"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT175384.0 created
FT                   on 07-NOV-2002"
FT   mRNA            complement(join(12394569..12394652,12395341..12395395,
FT                   12395641..12395763))
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, transcript variant mCT175385"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT175385.0 created
FT                   on 07-NOV-2002"
FT   mRNA            complement(join(12394569..12394652,12395046..12395144,
FT                   12395341..12395395,12395641..12395763))
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, transcript variant mCT15858"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT15858.1 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(12394627..12394652,12395341..12395395,
FT                   12395641..12395676))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, isoform CRA_c"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT175385.0
FT                   protein_id=mCP98304.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BTB6"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="MGI:MGI:106636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTB6"
FT                   /protein_id="EDL20119.1"
FT   CDS             complement(join(12394627..12394652,12395046..12395144,
FT                   12395341..12395395,12395641..12395676))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, isoform CRA_a"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT15858.1
FT                   protein_id=mCP19981.1 isoform=CRA_a"
FT                   /protein_id="EDL20117.1"
FT   CDS             complement(join(12394627..12394652,12395046..12395144,
FT                   12395341..12395365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13600"
FT                   /product="mCG13600, isoform CRA_b"
FT                   /note="gene_id=mCG13600.1 transcript_id=mCT175384.0
FT                   protein_id=mCP98303.0 isoform=CRA_b"
FT                   /protein_id="EDL20118.1"
FT                   SILK"
FT   assembly_gap    12400681..12400991
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   gene            complement(12402621..12410665)
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /note="gene_id=mCG13608.2"
FT   mRNA            complement(join(12402621..12403828,12404591..12404700,
FT                   12405006..12405163,12405422..12405574,12406038..12406154,
FT                   12406239..12406376,12406773..12406849,12407018..12407231,
FT                   12407503..12407661,12410285..12410665))
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, transcript variant mCT15861"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT15861.2 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(12403551..12403828,12404591..12404700,
FT                   12405006..12405163,12405422..12405574,12406038..12406154,
FT                   12406239..12406376,12406773..12406849,12407018..12407231,
FT                   12407503..12407661,12410285..12410431))
FT                   /codon_start=1
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, isoform CRA_a"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT15861.2
FT                   protein_id=mCP19943.2 isoform=CRA_a"
FT                   /protein_id="EDL20114.1"
FT   mRNA            complement(join(12406080..12406154,12406239..12406376,
FT                   12406773..12406849,12410285..12410440))
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, transcript variant mCT180581"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT180581.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(12406802..12406849,12410285..12410419))
FT                   /codon_start=1
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, isoform CRA_c"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT180581.0
FT                   protein_id=mCP103503.0 isoform=CRA_c"
FT                   /protein_id="EDL20116.1"
FT                   QILWASLLQMCCLLP"
FT   mRNA            complement(12408584..12410466)
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, transcript variant mCT180580"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT180580.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(12410060..12410431)
FT                   /codon_start=1
FT                   /gene="Mfsd7"
FT                   /locus_tag="mCG_13608"
FT                   /product="major facilitator superfamily domain containing
FT                   7, isoform CRA_b"
FT                   /note="gene_id=mCG13608.2 transcript_id=mCT180580.0
FT                   protein_id=mCP103502.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:2442629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C260"
FT                   /protein_id="EDL20115.1"
FT   assembly_gap    12413746..12413765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12413766..12414756)
FT                   /locus_tag="mCG_132236"
FT                   /note="gene_id=mCG132236.0"
FT   mRNA            complement(12413766..12414756)
FT                   /locus_tag="mCG_132236"
FT                   /product="mCG132236"
FT                   /note="gene_id=mCG132236.0 transcript_id=mCT133586.0
FT                   created on 26-MAR-2003"
FT   CDS             complement(12413944..12414597)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132236"
FT                   /product="mCG132236"
FT                   /note="gene_id=mCG132236.0 transcript_id=mCT133586.0
FT                   protein_id=mCP62748.1"
FT                   /protein_id="EDL20113.1"
FT   assembly_gap    12417903..12417922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12424181..12467720
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /note="gene_id=mCG13609.2"
FT   mRNA            join(12424181..12424376,12434998..12435037,
FT                   12435303..12435443,12436715..12436832,12438036..12438132,
FT                   12441229..12441284,12449063..12449170,12450759..12452147)
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, transcript variant
FT                   mCT180582"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT180582.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(12424226..12424376,12434998..12435037,
FT                   12435303..12435443,12436715..12436832,12438036..12438132,
FT                   12441229..12441284,12449063..12449170,12450759..12450847,
FT                   12458746..12458907,12462539..12462619,12463269..12467720)
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, transcript variant
FT                   mCT15867"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT15867.2 created
FT                   on 10-FEB-2003"
FT   mRNA            join(<12424256..12424376,12434998..12435037,
FT                   12435303..12435443,12436715..12436832,12438036..12438132,
FT                   12441229..12441284,12449063..12449170,12450759..12450847,
FT                   12458746..12458883,12462539..12462619,12463269..12466011)
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, transcript variant
FT                   mCT191354"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT191354.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12424340..12424376,12434998..12435037,
FT                   12435303..12435443,12436715..12436832,12437505..>12437541)
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, transcript variant
FT                   mCT180583"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT180583.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<12435417..12435443,12436715..12436832,
FT                   12438036..12438132,12441229..12441284,12449063..12449170,
FT                   12450759..12450847,12458746..12458883,12462539..12462619,
FT                   12463269..12463316)
FT                   /codon_start=1
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, isoform CRA_c"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT191354.0
FT                   protein_id=mCP112314.0 isoform=CRA_c"
FT                   /protein_id="EDL20111.1"
FT   CDS             join(12436724..12436832,12438036..12438132,
FT                   12441229..12441284,12449063..12449170,12450759..12450847,
FT                   12458746..12458907,12462539..12462619,12463269..12463316)
FT                   /codon_start=1
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, isoform CRA_d"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT15867.2
FT                   protein_id=mCP19946.2 isoform=CRA_d"
FT                   /protein_id="EDL20112.1"
FT   CDS             join(12436724..12436832,12438036..12438132,
FT                   12441229..12441284,12449063..12449170,12450759..12450925)
FT                   /codon_start=1
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, isoform CRA_a"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT180582.0
FT                   protein_id=mCP103505.0 isoform=CRA_a"
FT                   /protein_id="EDL20109.1"
FT                   HQFIPCLRTSFENVT"
FT   CDS             join(12436724..12436832,12437505..>12437541)
FT                   /codon_start=1
FT                   /gene="Pcgf3"
FT                   /locus_tag="mCG_13609"
FT                   /product="polycomb group ring finger 3, isoform CRA_b"
FT                   /note="gene_id=mCG13609.2 transcript_id=mCT180583.0
FT                   protein_id=mCP103504.0 isoform=CRA_b"
FT                   /protein_id="EDL20110.1"
FT                   VSAV"
FT   assembly_gap    12474373..12474414
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            12480012..12480494
FT                   /locus_tag="mCG_1030300"
FT                   /note="gene_id=mCG1030300.1"
FT   mRNA            12480012..12480494
FT                   /locus_tag="mCG_1030300"
FT                   /product="mCG1030300"
FT                   /note="gene_id=mCG1030300.1 transcript_id=mCT148004.1
FT                   created on 25-MAR-2003"
FT   CDS             12480085..12480438
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030300"
FT                   /product="mCG1030300"
FT                   /note="gene_id=mCG1030300.1 transcript_id=mCT148004.1
FT                   protein_id=mCP63109.0"
FT                   /protein_id="EDL20108.1"
FT                   KVLKAQAQSQKAK"
FT   gene            complement(12481466..12512856)
FT                   /gene="Cplx1"
FT                   /locus_tag="mCG_13598"
FT                   /note="gene_id=mCG13598.2"
FT   mRNA            complement(join(12481466..12483232,12488300..12488475,
FT                   12511335..12511438,12512718..12512856))
FT                   /gene="Cplx1"
FT                   /locus_tag="mCG_13598"
FT                   /product="complexin 1"
FT                   /note="gene_id=mCG13598.2 transcript_id=mCT15856.2 created
FT                   on 23-NOV-2004"
FT   CDS             complement(join(12483035..12483232,12488300..12488475,
FT                   12511335..12511365))
FT                   /codon_start=1
FT                   /gene="Cplx1"
FT                   /locus_tag="mCG_13598"
FT                   /product="complexin 1"
FT                   /note="gene_id=mCG13598.2 transcript_id=mCT15856.2
FT                   protein_id=mCP19980.3"
FT                   /protein_id="EDL20107.1"
FT   assembly_gap    12496215..12496273
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(12532300..>12592624)
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /note="gene_id=mCG13590.3"
FT   mRNA            complement(join(12532300..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12586137..12586251,12587060..12587119,12587907..12587968,
FT                   12592380..>12592604))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT191441"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191441.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12532304..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579963,12586137..12586251,12587060..12587119,
FT                   12587907..12587968,12592380..>12592609))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT191440"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191440.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12532308..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534951,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579963,12586137..12586251,12587060..12587119,
FT                   12587907..12587968,12592380..12592606))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT15809"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT15809.2 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12532308..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12548239..12548432,12554048..12554127,12554553..12554670,
FT                   12555098..12555292,12559668..12559801,12560774..12560896,
FT                   12561680..12561828,12562367..12562416,12565749..12565872,
FT                   12567221..12567305,12569285..12569397,12569787..12569922,
FT                   12572296..12572385,12576420..12576545,12579821..12579958,
FT                   12586137..12586251,12587060..12587119,12587907..>12587963))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT180573"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180573.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12532309..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579958,12586137..12586251,12587060..12587119,
FT                   12587907..12587968,12592380..>12592624))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT191438"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191438.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12532309..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579958,12582533..12582614,12586137..12586251,
FT                   12587060..12587119,12587907..12587968,12592380..12592606))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT180571"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180571.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12532309..12533205,12534278..12534423,
FT                   12534763..12534975,12539452..12539568,12543797..12543919,
FT                   12545004..12545174,12545560..12546039,12547122..12547268,
FT                   12548239..12548432,12554048..12554127,12554553..12554670,
FT                   12555098..12555292,12559668..12559801,12560774..12560896,
FT                   12561680..12561828,12562367..12562416,12565749..12565872,
FT                   12567221..12567305,12569285..12569397,12569787..12569922,
FT                   12572296..12572385,12576420..12576545,12586137..12586251,
FT                   12587060..12587119,12587907..12587968,12592380..>12592604))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT191439"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191439.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(12532744..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579963,12586137..12586251,12587060..12587119,
FT                   12587907..12587968,12592380..>12592578))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_g"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191440.0
FT                   protein_id=mCP112370.0 isoform=CRA_g"
FT                   /protein_id="EDL20105.1"
FT   CDS             complement(join(12532744..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534951,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579963,12586137..12586251,12587060..12587119,
FT                   12587907..12587968,12592380..12592524))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_a"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT15809.2
FT                   protein_id=mCP19966.2 isoform=CRA_a"
FT                   /protein_id="EDL20099.1"
FT                   WSEFENQGSRPLF"
FT   CDS             complement(join(12532744..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12586137..>12586196))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_h"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191441.0
FT                   protein_id=mCP112371.0 isoform=CRA_h"
FT                   /protein_id="EDL20106.1"
FT   CDS             complement(join(12532744..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12548239..12548432,12554048..12554127,12554553..12554670,
FT                   12555098..12555292,12559668..12559801,12560774..12560896,
FT                   12561680..12561828,12562367..12562416,12565749..12565872,
FT                   12567221..12567305,12569285..12569397,12569787..12569922,
FT                   12572296..12572385,12576420..12576545,12579821..12579958,
FT                   12586137..>12586196))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_d"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180573.0
FT                   protein_id=mCP103493.0 isoform=CRA_d"
FT                   /protein_id="EDL20102.1"
FT   CDS             complement(join(12532744..12532845,12533029..12533205,
FT                   12534278..12534423,12534763..12534975,12539452..12539568,
FT                   12543797..12543919,12545004..12545174,12545560..12546039,
FT                   12547122..12547268,12548239..12548432,12554048..12554127,
FT                   12554553..12554670,12555098..12555292,12559668..12559801,
FT                   12560774..12560896,12561680..12561828,12562367..12562416,
FT                   12565749..12565872,12567221..12567305,12569285..12569397,
FT                   12569787..12569922,12572296..12572385,12576420..12576545,
FT                   12579821..12579958,12586137..>12586196))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_e"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191438.0
FT                   protein_id=mCP112368.0 isoform=CRA_e"
FT                   /protein_id="EDL20103.1"
FT   CDS             complement(join(12533017..12533205,12534278..12534423,
FT                   12534763..12534975,12539452..12539568,12543797..12543919,
FT                   12545004..12545174,12545560..12546039,12547122..12547268,
FT                   12548239..12548432,12554048..12554127,12554553..12554670,
FT                   12555098..12555292,12559668..12559801,12560774..12560896,
FT                   12561680..12561828,12562367..12562416,12565749..12565872,
FT                   12567221..12567305,12569285..12569397,12569787..12569922,
FT                   12572296..12572385,12576420..12576545,12586137..>12586196))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_f"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT191439.0
FT                   protein_id=mCP112369.0 isoform=CRA_f"
FT                   /protein_id="EDL20104.1"
FT                   RAVLVVHPDKVGV"
FT   mRNA            complement(join(12542968..12543919,12545004..12545174,
FT                   12545560..12546039,12547122..12547268,12548239..12548432,
FT                   12554048..12554127,12554553..12554670,12555098..12555292,
FT                   12559668..12559801,12560774..12560896,12561680..12561828,
FT                   12562367..12562416,12565749..12565872,12567221..12567305,
FT                   12569285..12569397,12569787..12569922,12572296..12572385,
FT                   12576420..12576545,12579821..12579958,12586137..12586251,
FT                   12587060..12587119,12587907..12587968,12592380..12592606))
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, transcript variant
FT                   mCT180572"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180572.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(12579933..12579958,12586137..12586251,
FT                   12587060..12587119,12587907..12587968,12592380..12592524))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_c"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180572.0
FT                   protein_id=mCP103494.0 isoform=CRA_c"
FT                   /protein_id="EDL20101.1"
FT   CDS             complement(join(12582607..12582614,12586137..12586251,
FT                   12587060..12587119,12587907..12587968,12592380..12592524))
FT                   /codon_start=1
FT                   /gene="Gak"
FT                   /locus_tag="mCG_13590"
FT                   /product="cyclin G associated kinase, isoform CRA_b"
FT                   /note="gene_id=mCG13590.3 transcript_id=mCT180571.0
FT                   protein_id=mCP103495.0 isoform=CRA_b"
FT                   /protein_id="EDL20100.1"
FT   gene            12592068..12611046
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /note="gene_id=mCG13606.2"
FT   mRNA            join(12592068..12592779,12601116..12601369,
FT                   12601546..12601584,12602351..12602448,12604785..12604836,
FT                   12605080..12605115,12605659..12605742,12606002..12606166,
FT                   12607131..12607209,12607520..12607655,12608798..12611046)
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, transcript variant
FT                   mCT15865"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT15865.3 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<12592710..12592779,12601116..12601369,
FT                   12601546..12601584,12602354..12602448,12604785..12604836,
FT                   12605080..12605115,12605659..12605742,12606002..12606166,
FT                   12607131..12607209,12607520..12607655,12608798..12610730)
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, transcript variant
FT                   mCT191352"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT191352.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12592742..12592922,12601116..12601369,
FT                   12601546..12601584,12602351..12602448,12604785..12604836,
FT                   12605080..12605115,12605659..12605742,12606002..12606166,
FT                   12607131..12607209,12607520..12607655,12608798..12610824)
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, transcript variant
FT                   mCT176843"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT176843.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<12592881..12592922,12601152..12601369,
FT                   12601546..12601584,12602351..12602448,12604785..12604836,
FT                   12605080..12605115,12605659..12605742,12606002..12606166,
FT                   12607131..12607209,12607520..12607655,12608798..12610214)
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, transcript variant
FT                   mCT191353"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT191353.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12601208..12601369,12601546..12601584,
FT                   12602351..12602448,12604785..12604836,12605080..12605115,
FT                   12605659..12605742,12606002..12606166,12607131..12607209,
FT                   12607520..12607655,12608798..12609464)
FT                   /codon_start=1
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, isoform CRA_b"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT191353.0
FT                   protein_id=mCP112313.0 isoform=CRA_b"
FT                   /protein_id="EDL20096.1"
FT   CDS             join(<12601208..12601369,12601546..12601584,
FT                   12602354..12602448,12604785..12604836,12605080..12605115,
FT                   12605659..12605742,12606002..12606166,12607131..12607209,
FT                   12607520..12607655,12608798..12609464)
FT                   /codon_start=1
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, isoform CRA_a"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT191352.0
FT                   protein_id=mCP112312.0 isoform=CRA_a"
FT                   /protein_id="EDL20095.1"
FT   CDS             join(12601226..12601369,12601546..12601584,
FT                   12602351..12602448,12604785..12604836,12605080..12605115,
FT                   12605659..12605742,12606002..12606166,12607131..12607209,
FT                   12607520..12607655,12608798..12609464)
FT                   /codon_start=1
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, isoform CRA_c"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT15865.3
FT                   protein_id=mCP19969.3 isoform=CRA_c"
FT                   /protein_id="EDL20097.1"
FT   CDS             join(12601226..12601369,12601546..12601584,
FT                   12602351..12602448,12604785..12604836,12605080..12605115,
FT                   12605659..12605742,12606002..12606166,12607131..12607209,
FT                   12607520..12607655,12608798..12609464)
FT                   /codon_start=1
FT                   /gene="3010001K23Rik"
FT                   /locus_tag="mCG_13606"
FT                   /product="RIKEN cDNA 3010001K23, isoform CRA_c"
FT                   /note="gene_id=mCG13606.2 transcript_id=mCT176843.0
FT                   protein_id=mCP99765.0 isoform=CRA_c"
FT                   /protein_id="EDL20098.1"
FT   assembly_gap    12603172..12603191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12609650..12632998)
FT                   /gene="Dgkq"
FT                   /locus_tag="mCG_13588"
FT                   /note="gene_id=mCG13588.2"
FT   mRNA            complement(join(12609650..12611771,12612105..12612257,
FT                   12612338..12612449,12612547..12612693,12612785..12612885,
FT                   12613161..12613339,12613450..12613598,12613777..12613928,
FT                   12615354..12615469,12616141..12616179,12616596..12616746,
FT                   12617044..12617105,12617316..12617370,12617504..12617594,
FT                   12617676..12617896,12618068..12618168,12618250..12618324,
FT                   12618400..12618553,12618804..12618929,12619006..12619091,
FT                   12619384..12619483,12621166..12621245,12623403..12623771))
FT                   /gene="Dgkq"
FT                   /locus_tag="mCG_13588"
FT                   /product="diacylglycerol kinase, theta, transcript variant
FT                   mCT15812"
FT                   /note="gene_id=mCG13588.2 transcript_id=mCT15812.2 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12610578..12611771,12612105..12612257,
FT                   12612338..12612449,12612547..12612693,12612785..12613339,
FT                   12613450..12613928,12615354..12615469,12616141..12616179,
FT                   12617036..12617105,12617316..12617370,12617504..12617594,
FT                   12617676..12617896,12618068..12618168,12618250..12618324,
FT                   12618400..12618553,12618804..12618929,12619006..12619045,
FT                   12619384..12619483,12621166..12621245,12632776..12632998))
FT                   /gene="Dgkq"
FT                   /locus_tag="mCG_13588"
FT                   /product="diacylglycerol kinase, theta, transcript variant
FT                   mCT180570"
FT                   /note="gene_id=mCG13588.2 transcript_id=mCT180570.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(12611670..12611771,12612105..12612257,
FT                   12612338..12612449,12612547..12612693,12612785..12612885,
FT                   12613161..12613339,12613450..12613598,12613777..12613928,
FT                   12615354..12615469,12616141..12616179,12616596..12616746,
FT                   12617044..12617105,12617316..12617370,12617504..12617594,
FT                   12617676..12617896,12618068..12618168,12618250..12618324,
FT                   12618400..12618553,12618804..12618929,12619006..12619091,
FT                   12619384..12619483,12621166..12621245,12623403..12623655))
FT                   /codon_start=1
FT                   /gene="Dgkq"
FT                   /locus_tag="mCG_13588"
FT                   /product="diacylglycerol kinase, theta, isoform CRA_a"
FT                   /note="gene_id=mCG13588.2 transcript_id=mCT15812.2
FT                   protein_id=mCP19950.2 isoform=CRA_a"
FT                   /protein_id="EDL20093.1"
FT                   GNPL"
FT   CDS             complement(join(12615430..12615469,12616141..12616179,
FT                   12617036..12617105,12617316..12617370,12617504..12617594,
FT                   12617676..12617896,12618068..12618168,12618250..12618324,
FT                   12618400..12618493))
FT                   /codon_start=1
FT                   /gene="Dgkq"
FT                   /locus_tag="mCG_13588"
FT                   /product="diacylglycerol kinase, theta, isoform CRA_b"
FT                   /note="gene_id=mCG13588.2 transcript_id=mCT180570.0
FT                   protein_id=mCP103492.0 isoform=CRA_b"
FT                   /protein_id="EDL20094.1"
FT   assembly_gap    12625457..12625796
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   gene            <12632636..12648874
FT                   /gene="Idua"
FT                   /locus_tag="mCG_13596"
FT                   /note="gene_id=mCG13596.3"
FT   mRNA            join(<12632636..12632843,12643531..12643616,
FT                   12643736..12643843,12644143..12644238,12644327..12644529,
FT                   12644603..12644782,12644893..12645109,12645412..12645624,
FT                   12645704..12645826,12646213..12646342,12646416..12646487,
FT                   12647365..12647465,12647579..12648874)
FT                   /gene="Idua"
FT                   /locus_tag="mCG_13596"
FT                   /product="iduronidase, alpha-L-, transcript variant
FT                   mCT191449"
FT                   /note="gene_id=mCG13596.3 transcript_id=mCT191449.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12632643..12632843,12633445..12633585,
FT                   12643531..12643616,12643736..12643843,12644143..12644238,
FT                   12644327..12644529,12644603..12644782,12644893..12645109,
FT                   12645412..12645624,12645704..12645826,12646213..12646342,
FT                   12646416..12646487,12647365..12647465,12647579..12648874)
FT                   /gene="Idua"
FT                   /locus_tag="mCG_13596"
FT                   /product="iduronidase, alpha-L-, transcript variant
FT                   mCT15854"
FT                   /note="gene_id=mCG13596.3 transcript_id=mCT15854.2 created
FT                   on 07-NOV-2002"
FT   CDS             join(<12632668..12632843,12643531..12643616,
FT                   12643736..12643843,12644143..12644238,12644327..12644529,
FT                   12644603..12644782,12644893..12645109,12645412..12645624,
FT                   12645704..12645826,12646213..12646226)
FT                   /codon_start=1
FT                   /gene="Idua"
FT                   /locus_tag="mCG_13596"
FT                   /product="iduronidase, alpha-L-, isoform CRA_a"
FT                   /note="gene_id=mCG13596.3 transcript_id=mCT191449.0
FT                   protein_id=mCP112408.0 isoform=CRA_a"
FT                   /protein_id="EDL20088.1"
FT                   QFPTYAHGGGPRG"
FT   CDS             join(12632689..12632843,12633445..12633585,
FT                   12643531..12643616,12643736..12643843,12644143..12644238,
FT                   12644327..12644529,12644603..12644782,12644893..12645109,
FT                   12645412..12645624,12645704..12645826,12646213..12646226)
FT                   /codon_start=1
FT                   /gene="Idua"
FT                   /locus_tag="mCG_13596"
FT                   /product="iduronidase, alpha-L-, isoform CRA_b"
FT                   /note="gene_id=mCG13596.3 transcript_id=mCT15854.2
FT                   protein_id=mCP19974.2 isoform=CRA_b"
FT                   /protein_id="EDL20089.1"
FT   gene            complement(12633876..12639398)
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /note="gene_id=mCG13597.2"
FT   mRNA            complement(join(12633876..12636066,12636757..12637374,
FT                   12639299..12639398))
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, transcript variant mCT15855"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT15855.2 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12633876..12636066,12636757..12637374,
FT                   12638722..12638845))
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, transcript variant mCT180579"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT180579.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12633876..12636066,12636757..12637374,
FT                   12638608..12638813))
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, transcript variant mCT180578"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT180578.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(12634543..12636066,12636757..12637374,
FT                   12638608..12638628))
FT                   /codon_start=1
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, isoform CRA_b"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT180578.0
FT                   protein_id=mCP103501.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8U1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR030331"
FT                   /db_xref="MGI:MGI:2385894"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8U1"
FT                   /protein_id="EDL20091.1"
FT   CDS             complement(join(12634543..12636066,12636757..12637347))
FT                   /codon_start=1
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, isoform CRA_a"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT15855.2
FT                   protein_id=mCP19938.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UPH6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR030331"
FT                   /db_xref="MGI:MGI:2385894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPH6"
FT                   /protein_id="EDL20090.1"
FT                   EELLAADSAL"
FT   CDS             complement(join(12634543..12636066,12636757..12637347))
FT                   /codon_start=1
FT                   /gene="Slc26a1"
FT                   /locus_tag="mCG_13597"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 1, isoform CRA_a"
FT                   /note="gene_id=mCG13597.2 transcript_id=mCT180579.0
FT                   protein_id=mCP103500.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UPH6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR030331"
FT                   /db_xref="MGI:MGI:2385894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPH6"
FT                   /protein_id="EDL20092.1"
FT                   EELLAADSAL"
FT   assembly_gap    12637783..12637802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12645832..12645851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12656686..12656822
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    12658047..12659389
FT                   /estimated_length=1343
FT                   /gap_type="unknown"
FT   gene            <12667413..12671065
FT                   /gene="Fgfrl1"
FT                   /locus_tag="mCG_13605"
FT                   /note="gene_id=mCG13605.2"
FT   mRNA            join(<12667413..12667689,12668798..12668878,
FT                   12668986..12669270,12669350..12669703,12669947..12671065)
FT                   /gene="Fgfrl1"
FT                   /locus_tag="mCG_13605"
FT                   /product="fibroblast growth factor receptor-like 1"
FT                   /note="gene_id=mCG13605.2 transcript_id=mCT15864.2 created
FT                   on 07-NOV-2002"
FT   CDS             join(<12667416..12667689,12668798..12668878,
FT                   12668986..12669270,12669350..12669703,12669947..12670476)
FT                   /codon_start=1
FT                   /gene="Fgfrl1"
FT                   /locus_tag="mCG_13605"
FT                   /product="fibroblast growth factor receptor-like 1"
FT                   /note="gene_id=mCG13605.2 transcript_id=mCT15864.2
FT                   protein_id=mCP19947.0"
FT                   /protein_id="EDL20087.1"
FT   assembly_gap    12685244..12685263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12693557..12713037)
FT                   /gene="F830003B07"
FT                   /locus_tag="mCG_13591"
FT                   /note="gene_id=mCG13591.2"
FT   mRNA            complement(join(12693557..12693726,12695912..12695984,
FT                   12708019..12708082,12709773..12709815,12711322..12711373,
FT                   12711476..12711528,12712637..12712902))
FT                   /gene="F830003B07"
FT                   /locus_tag="mCG_13591"
FT                   /product="hypothetical protein F830003B07, transcript
FT                   variant mCT180574"
FT                   /note="gene_id=mCG13591.2 transcript_id=mCT180574.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(12693638..12693720,12694059..12694226,
FT                   12695912..12695984,12708019..12708082,12709773..12709815,
FT                   12711322..12711373,12711476..12711528,12712637..12713037))
FT                   /gene="F830003B07"
FT                   /locus_tag="mCG_13591"
FT                   /product="hypothetical protein F830003B07, transcript
FT                   variant mCT15810"
FT                   /note="gene_id=mCG13591.2 transcript_id=mCT15810.2 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(12693711..12693726,12695912..12695984,
FT                   12708019..12708082,12709773..12709815,12711322..12711373,
FT                   12711476..12711527))
FT                   /codon_start=1
FT                   /gene="F830003B07"
FT                   /locus_tag="mCG_13591"
FT                   /product="hypothetical protein F830003B07, isoform CRA_b"
FT                   /note="gene_id=mCG13591.2 transcript_id=mCT180574.0
FT                   protein_id=mCP103496.0 isoform=CRA_b"
FT                   /protein_id="EDL20086.1"
FT   CDS             complement(join(12693711..12693720,12694059..12694226,
FT                   12695912..12695984,12708019..12708082,12709773..12709815,
FT                   12711322..12711373,12711476..12711527))
FT                   /codon_start=1
FT                   /gene="F830003B07"
FT                   /locus_tag="mCG_13591"
FT                   /product="hypothetical protein F830003B07, isoform CRA_a"
FT                   /note="gene_id=mCG13591.2 transcript_id=mCT15810.2
FT                   protein_id=mCP19977.2 isoform=CRA_a"
FT                   /protein_id="EDL20085.1"
FT   gene            12724715..12725263
FT                   /pseudo
FT                   /locus_tag="mCG_49299"
FT                   /note="gene_id=mCG49299.2"
FT   mRNA            12724715..12725263
FT                   /pseudo
FT                   /locus_tag="mCG_49299"
FT                   /note="gene_id=mCG49299.2 transcript_id=mCT49482.2 created
FT                   on 21-MAR-2003"
FT   gene            <12725899..12730972
FT                   /locus_tag="mCG_1030692"
FT                   /note="gene_id=mCG1030692.0"
FT   mRNA            join(<12725899..12725990,12729060..12729193,
FT                   12730687..12730972)
FT                   /locus_tag="mCG_1030692"
FT                   /product="mCG1030692"
FT                   /note="gene_id=mCG1030692.0 transcript_id=mCT148396.0
FT                   created on 10-FEB-2003"
FT   CDS             join(<12725900..12725990,12729060..12729175)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030692"
FT                   /product="mCG1030692"
FT                   /note="gene_id=mCG1030692.0 transcript_id=mCT148396.0
FT                   protein_id=mCP63011.0"
FT                   /protein_id="EDL20084.1"
FT   gene            complement(12739301..12757441)
FT                   /gene="1810008K16Rik"
FT                   /locus_tag="mCG_13594"
FT                   /note="gene_id=mCG13594.1"
FT   mRNA            complement(join(12739301..12739512,12740973..12741119,
FT                   12741882..12742007,12748181..12748281,12757261..12757441))
FT                   /gene="1810008K16Rik"
FT                   /locus_tag="mCG_13594"
FT                   /product="RIKEN cDNA 1810008K16"
FT                   /note="gene_id=mCG13594.1 transcript_id=mCT15811.0 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(12739363..12739512,12740973..12741119,
FT                   12741882..12742007,12748181..12748281,12757261..12757384))
FT                   /codon_start=1
FT                   /gene="1810008K16Rik"
FT                   /locus_tag="mCG_13594"
FT                   /product="RIKEN cDNA 1810008K16"
FT                   /note="gene_id=mCG13594.1 transcript_id=mCT15811.0
FT                   protein_id=mCP19971.1"
FT                   /db_xref="GOA:A2RTW8"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015719"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="MGI:MGI:1914616"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTW8"
FT                   /protein_id="EDL20083.1"
FT   gene            complement(<12759267..>12770815)
FT                   /locus_tag="mCG_132244"
FT                   /note="gene_id=mCG132244.0"
FT   mRNA            complement(join(<12759267..12760171,12761321..12761444,
FT                   12762581..12762805,12763753..12764559,12765156..12765435,
FT                   12770613..>12770815))
FT                   /locus_tag="mCG_132244"
FT                   /product="mCG132244"
FT                   /note="gene_id=mCG132244.0 transcript_id=mCT133594.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(12759267..12760171,12761321..12761444,
FT                   12762581..12762805,12763753..12764559,12765156..12765435,
FT                   12770613..12770815))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132244"
FT                   /product="mCG132244"
FT                   /note="gene_id=mCG132244.0 transcript_id=mCT133594.1
FT                   protein_id=mCP63317.1"
FT                   /protein_id="EDL20082.1"
FT   assembly_gap    12772372..12772391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12773156..12773434
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    12777071..12777090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12783595..12784988
FT                   /pseudo
FT                   /locus_tag="mCG_1030339"
FT                   /note="gene_id=mCG1030339.1"
FT   mRNA            12783595..12784988
FT                   /pseudo
FT                   /locus_tag="mCG_1030339"
FT                   /note="gene_id=mCG1030339.1 transcript_id=mCT148043.1
FT                   created on 21-MAR-2003"
FT   gene            complement(<12804805..>12814351)
FT                   /locus_tag="mCG_13603"
FT                   /note="gene_id=mCG13603.1"
FT   mRNA            complement(join(<12804805..12805709,12806862..12806985,
FT                   12808114..12808338,12809342..12810148,12810763..12811042,
FT                   12814149..>12814351))
FT                   /locus_tag="mCG_13603"
FT                   /product="mCG13603"
FT                   /note="gene_id=mCG13603.1 transcript_id=mCT15862.2 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(12804805..12805709,12806862..12806985,
FT                   12808114..12808338,12809342..12810148,12810763..12811042,
FT                   12814149..12814351))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13603"
FT                   /product="mCG13603"
FT                   /note="gene_id=mCG13603.1 transcript_id=mCT15862.2
FT                   protein_id=mCP19945.2"
FT                   /protein_id="EDL20081.1"
FT   assembly_gap    12825043..12825228
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            complement(<12835124..>12853415)
FT                   /locus_tag="mCG_132240"
FT                   /note="gene_id=mCG132240.1"
FT   mRNA            complement(join(<12835124..12835803,12837090..12837213,
FT                   12840225..12840449,12852147..12852562,12853128..>12853415))
FT                   /locus_tag="mCG_132240"
FT                   /product="mCG132240"
FT                   /note="gene_id=mCG132240.1 transcript_id=mCT133590.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(12835124..12835803,12837090..12837213,
FT                   12840225..12840449,12852147..>12852203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132240"
FT                   /product="mCG132240"
FT                   /note="gene_id=mCG132240.1 transcript_id=mCT133590.1
FT                   protein_id=mCP62836.1"
FT                   /protein_id="EDL20080.1"
FT   assembly_gap    12839376..12839400
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    12843299..12845101
FT                   /estimated_length=1803
FT                   /gap_type="unknown"
FT   assembly_gap    12850501..12850613
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    12859580..12859952
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    12861480..12861714
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    12863973..12863992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12865840..12865859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12880731..12880929
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    12894137..12894156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12898461..12898480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12909562..12909795
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    12920818..12923591
FT                   /estimated_length=2774
FT                   /gap_type="unknown"
FT   assembly_gap    12950323..12950591
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   gene            complement(12960247..12973281)
FT                   /gene="V2r16"
FT                   /locus_tag="mCG_3469"
FT                   /note="gene_id=mCG3469.1"
FT   mRNA            complement(join(12960247..12962755,12964439..12964562,
FT                   12965714..12965938,12968694..12969497,12973047..12973281))
FT                   /gene="V2r16"
FT                   /locus_tag="mCG_3469"
FT                   /product="vomeronasal 2, receptor, 16"
FT                   /note="gene_id=mCG3469.1 transcript_id=mCT2619.1 created on
FT                   07-NOV-2002"
FT   CDS             complement(join(12969467..12969497,12973047..12973246))
FT                   /codon_start=1
FT                   /gene="V2r16"
FT                   /locus_tag="mCG_3469"
FT                   /product="vomeronasal 2, receptor, 16"
FT                   /note="gene_id=mCG3469.1 transcript_id=mCT2619.1
FT                   protein_id=mCP6630.2"
FT                   /db_xref="MGI:MGI:1316730"
FT                   /db_xref="UniProtKB/TrEMBL:O35204"
FT                   /protein_id="EDL20079.1"
FT   assembly_gap    12993175..12995094
FT                   /estimated_length=1920
FT                   /gap_type="unknown"
FT   gene            complement(<13013975..>13026489)
FT                   /locus_tag="mCG_3470"
FT                   /note="gene_id=mCG3470.2"
FT   mRNA            complement(join(<13013975..13014879,13016029..13016152,
FT                   13019135..13019359,13020386..13021192,13021805..13022084,
FT                   13026317..>13026489))
FT                   /locus_tag="mCG_3470"
FT                   /product="mCG3470"
FT                   /note="gene_id=mCG3470.2 transcript_id=mCT2620.2 created on
FT                   21-MAR-2003"
FT   CDS             complement(join(13013975..13014879,13016029..13016152,
FT                   13019135..13019359,13020386..13021192,13021805..13022084,
FT                   13026317..>13026489))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3470"
FT                   /product="mCG3470"
FT                   /note="gene_id=mCG3470.2 transcript_id=mCT2620.2
FT                   protein_id=mCP6632.2"
FT                   /protein_id="EDL20078.1"
FT   assembly_gap    13036379..13039023
FT                   /estimated_length=2645
FT                   /gap_type="unknown"
FT   assembly_gap    13043293..13043457
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    13044938..13046767
FT                   /estimated_length=1830
FT                   /gap_type="unknown"
FT   assembly_gap    13047940..13048003
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    13052073..13052267
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            complement(<13054317..>13066010)
FT                   /locus_tag="mCG_132250"
FT                   /note="gene_id=mCG132250.1"
FT   mRNA            complement(join(<13054317..13055176,13056320..13056443,
FT                   13058842..13059063,13059887..13060690,13061241..13061523,
FT                   13065820..>13066010))
FT                   /locus_tag="mCG_132250"
FT                   /product="mCG132250"
FT                   /note="gene_id=mCG132250.1 transcript_id=mCT133600.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13054317..13055176,13056320..13056443,
FT                   13058842..13059063,13059887..13060690,13061241..13061523,
FT                   13065820..>13066010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132250"
FT                   /product="mCG132250"
FT                   /note="gene_id=mCG132250.1 transcript_id=mCT133600.1
FT                   protein_id=mCP63119.1"
FT                   /protein_id="EDL20077.1"
FT                   LGCIFLPKCCVILLD"
FT   assembly_gap    13063214..13063331
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    13093249..13098942
FT                   /estimated_length=5694
FT                   /gap_type="unknown"
FT   assembly_gap    13103818..13107336
FT                   /estimated_length=3519
FT                   /gap_type="unknown"
FT   gene            complement(<13111266..>13141054)
FT                   /locus_tag="mCG_132255"
FT                   /note="gene_id=mCG132255.1"
FT   mRNA            complement(join(<13111266..13112122,13113273..13113396,
FT                   13120534..13120758,13122476..13123279,13123872..13124154,
FT                   13140864..>13141054))
FT                   /locus_tag="mCG_132255"
FT                   /product="mCG132255"
FT                   /note="gene_id=mCG132255.1 transcript_id=mCT133605.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13111266..13112122,13113273..13113396,
FT                   13120534..13120758,13122476..13123279,13123872..13124154,
FT                   13140864..>13141054))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132255"
FT                   /product="mCG132255"
FT                   /note="gene_id=mCG132255.1 transcript_id=mCT133605.1
FT                   protein_id=mCP63173.1"
FT                   /protein_id="EDL20076.1"
FT                   LLGCIFLPKCCVILD"
FT   gene            complement(<13164460..>13173580)
FT                   /locus_tag="mCG_23236"
FT                   /note="gene_id=mCG23236.1"
FT   mRNA            complement(join(<13164460..13165364,13167794..13168022,
FT                   13168795..13169601,13170183..13170465,13173381..>13173580))
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, transcript variant mCT181183"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT181183.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(13164460..13165364,13167794..13168022,
FT                   13168795..13169601,13170183..13170465,13173381..13173580))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, isoform CRA_b"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT181183.0
FT                   protein_id=mCP104104.0 isoform=CRA_b"
FT                   /protein_id="EDL20074.1"
FT   mRNA            complement(join(<13164460..13165214,13166526..13166649,
FT                   13167798..13168022,13168795..13169601,13170183..13170465,
FT                   13173381..13173550))
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, transcript variant mCT181182"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT181182.0 created
FT                   on 21-MAR-2003"
FT   mRNA            complement(join(<13164460..13165364,13166526..13166649,
FT                   13167798..13168022,13168795..13169601,13170183..13170465,
FT                   13173381..13173550))
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, transcript variant mCT23524"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT23524.1 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(13164460..13165214,13166526..13166649,
FT                   13167798..13168022,13168795..13169601,13170183..13170465,
FT                   13173381..13173547))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, isoform CRA_a"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT181182.0
FT                   protein_id=mCP104105.0 isoform=CRA_a"
FT                   /protein_id="EDL20073.1"
FT   CDS             complement(join(13164460..13165364,13166526..13166649,
FT                   13167798..13168022,13168795..13169601,13170183..13170465,
FT                   13173381..13173547))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23236"
FT                   /product="mCG23236, isoform CRA_c"
FT                   /note="gene_id=mCG23236.1 transcript_id=mCT23524.1
FT                   protein_id=mCP6727.1 isoform=CRA_c"
FT                   /protein_id="EDL20075.1"
FT   gene            13185870..13187322
FT                   /pseudo
FT                   /locus_tag="mCG_51047"
FT                   /note="gene_id=mCG51047.2"
FT   mRNA            13185870..13187322
FT                   /pseudo
FT                   /locus_tag="mCG_51047"
FT                   /note="gene_id=mCG51047.2 transcript_id=mCT51230.2 created
FT                   on 21-MAR-2003"
FT   assembly_gap    13195870..13195889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13232886..13233215
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   gene            complement(<13235242..>13246503)
FT                   /locus_tag="mCG_23591"
FT                   /note="gene_id=mCG23591.1"
FT   mRNA            complement(join(<13235242..13235996,13237299..13237422,
FT                   13240590..13240814,13241653..13242456,13243042..13243324,
FT                   13246304..>13246503))
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, transcript variant mCT23527"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT23527.2 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(<13235242..13236146,13237299..13237422,
FT                   13240590..13240814,13241653..13242456,13243042..13243324,
FT                   13246304..>13246503))
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, transcript variant mCT181186"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT181186.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(<13235242..13236146,13240586..13240814,
FT                   13241653..13242456,13243042..13243324,13246304..>13246503))
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, transcript variant mCT181185"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT181185.0 created
FT                   on 20-MAR-2003"
FT   CDS             complement(join(13235242..13235996,13237299..13237422,
FT                   13240590..13240814,13241653..13242456,13243042..13243324,
FT                   13246304..13246503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, isoform CRA_c"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT23527.2
FT                   protein_id=mCP6729.2 isoform=CRA_c"
FT                   /protein_id="EDL20072.1"
FT   CDS             complement(join(13235242..13236146,13237299..13237422,
FT                   13240590..13240814,13241653..13242456,13243042..13243324,
FT                   13246304..13246503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, isoform CRA_b"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT181186.0
FT                   protein_id=mCP104107.0 isoform=CRA_b"
FT                   /protein_id="EDL20071.1"
FT   CDS             complement(join(13235242..13236146,13240586..13240814,
FT                   13241653..13242456,13243042..13243324,13246304..13246503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23591"
FT                   /product="mCG23591, isoform CRA_a"
FT                   /note="gene_id=mCG23591.1 transcript_id=mCT181185.0
FT                   protein_id=mCP104108.0 isoform=CRA_a"
FT                   /protein_id="EDL20070.1"
FT   assembly_gap    13251236..13251351
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            <13279230..>13320021
FT                   /locus_tag="mCG_23592"
FT                   /note="gene_id=mCG23592.2"
FT   mRNA            join(<13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316473,13319117..>13320021)
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, transcript variant mCT181188"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT181188.0 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316469,13317814..13317937,
FT                   13319117..>13320021)
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, transcript variant mCT23528"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT23528.1 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316469,13317814..13317937,
FT                   13319267..>13320021)
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, transcript variant mCT181187"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT181187.0 created
FT                   on 20-MAR-2003"
FT   CDS             join(13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316473,13319117..13320021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, isoform CRA_c"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT181188.0
FT                   protein_id=mCP104110.0 isoform=CRA_c"
FT                   /protein_id="EDL20069.1"
FT   CDS             join(13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316469,13317814..13317937,
FT                   13319117..13320021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, isoform CRA_b"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT23528.1
FT                   protein_id=mCP6732.1 isoform=CRA_b"
FT                   /protein_id="EDL20068.1"
FT   CDS             join(13279230..13279435,13287972..13288254,
FT                   13288603..13289409,13316245..13316469,13317814..13317937,
FT                   13319267..13320021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23592"
FT                   /product="mCG23592, isoform CRA_a"
FT                   /note="gene_id=mCG23592.2 transcript_id=mCT181187.0
FT                   protein_id=mCP104109.0 isoform=CRA_a"
FT                   /protein_id="EDL20067.1"
FT   assembly_gap    13291363..13297136
FT                   /estimated_length=5774
FT                   /gap_type="unknown"
FT   assembly_gap    13365064..13365083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13375956..>13409363
FT                   /locus_tag="mCG_23590"
FT                   /note="gene_id=mCG23590.2"
FT   mRNA            join(<13375956..13376152,13382972..13383251,
FT                   13383686..13384492,13385315..13385539,13390234..13390357,
FT                   13408459..>13409363)
FT                   /locus_tag="mCG_23590"
FT                   /product="mCG23590, transcript variant mCT181184"
FT                   /note="gene_id=mCG23590.2 transcript_id=mCT181184.0 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<13375956..13376152,13382972..13383251,
FT                   13383686..13384492,13385315..13385539,13390234..13390357,
FT                   13408576..>13409363)
FT                   /locus_tag="mCG_23590"
FT                   /product="mCG23590, transcript variant mCT23526"
FT                   /note="gene_id=mCG23590.2 transcript_id=mCT23526.2 created
FT                   on 20-MAR-2003"
FT   CDS             join(<13375956..13376152,13382972..13383251,
FT                   13383686..13384492,13385315..13385539,13390234..13390357,
FT                   13408459..13409363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23590"
FT                   /product="mCG23590, isoform CRA_a"
FT                   /note="gene_id=mCG23590.2 transcript_id=mCT181184.0
FT                   protein_id=mCP104106.0 isoform=CRA_a"
FT                   /protein_id="EDL20065.1"
FT   CDS             join(<13375956..13376152,13382972..13383251,
FT                   13383686..13384492,13385315..13385539,13390234..13390357,
FT                   13408576..13409363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23590"
FT                   /product="mCG23590, isoform CRA_b"
FT                   /note="gene_id=mCG23590.2 transcript_id=mCT23526.2
FT                   protein_id=mCP6728.2 isoform=CRA_b"
FT                   /protein_id="EDL20066.1"
FT   assembly_gap    13444814..13444833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13463316..13465125
FT                   /estimated_length=1810
FT                   /gap_type="unknown"
FT   assembly_gap    13485564..13485684
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    13489528..13491095
FT                   /estimated_length=1568
FT                   /gap_type="unknown"
FT   assembly_gap    13492943..13493623
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    13499109..13499128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13506541..13506560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13507655..13507674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13508876..13511078
FT                   /estimated_length=2203
FT                   /gap_type="unknown"
FT   gene            complement(13511106..13515173)
FT                   /gene="Tpte2"
FT                   /locus_tag="mCG_134216"
FT                   /note="gene_id=mCG134216.1"
FT   mRNA            complement(join(13511106..13511193,13511343..13511498,
FT                   13511857..13512019,13512258..13512400,13512839..13513005,
FT                   13513356..13513452,13514625..13514701,13515011..13515173))
FT                   /gene="Tpte2"
FT                   /locus_tag="mCG_134216"
FT                   /product="transmembrane phosphoinositide 3-phosphatase and
FT                   tensin homolog 2, transcript variant mCT175383"
FT                   /note="gene_id=mCG134216.1 transcript_id=mCT175383.0
FT                   created on 07-NOV-2002"
FT   mRNA            complement(join(13511106..13511193,13511343..13511465,
FT                   13511857..13512019,13512258..13512400,13512839..13513005,
FT                   13513356..13513452,13514625..13514761))
FT                   /gene="Tpte2"
FT                   /locus_tag="mCG_134216"
FT                   /product="transmembrane phosphoinositide 3-phosphatase and
FT                   tensin homolog 2, transcript variant mCT135597"
FT                   /note="gene_id=mCG134216.1 transcript_id=mCT135597.1
FT                   created on 07-NOV-2002"
FT   CDS             complement(join(13511353..13511498,13511857..13512019,
FT                   13512258..13512400,13512839..13513005,13513356..13513452,
FT                   13514625..13514701,13515011..13515012))
FT                   /codon_start=1
FT                   /gene="Tpte2"
FT                   /locus_tag="mCG_134216"
FT                   /product="transmembrane phosphoinositide 3-phosphatase and
FT                   tensin homolog 2, isoform CRA_b"
FT                   /note="gene_id=mCG134216.1 transcript_id=mCT175383.0
FT                   protein_id=mCP98302.0 isoform=CRA_b"
FT                   /protein_id="EDL20064.1"
FT   CDS             complement(join(13511353..13511465,13511857..13512019,
FT                   13512258..13512400,13512839..13513005,13513356..13513452,
FT                   13514625..13514703))
FT                   /codon_start=1
FT                   /gene="Tpte2"
FT                   /locus_tag="mCG_134216"
FT                   /product="transmembrane phosphoinositide 3-phosphatase and
FT                   tensin homolog 2, isoform CRA_a"
FT                   /note="gene_id=mCG134216.1 transcript_id=mCT135597.1
FT                   protein_id=mCP62668.1 isoform=CRA_a"
FT                   /protein_id="EDL20063.1"
FT   assembly_gap    13516084..13516103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13533315..13533334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13535244..13535263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13542336..13542355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13544953..13544972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13555445..13555713
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    13564526..13564561
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    13567609..13567940
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    13574583..13574602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13580443..13580548
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    13581806..13582792
FT                   /estimated_length=987
FT                   /gap_type="unknown"
FT   assembly_gap    13584759..13584778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13585521..13585934
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    13588257..13588276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13590630..13590649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13593057..13593264
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    13594751..13594770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13596456..13598615
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   assembly_gap    13600351..13601075
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   gene            complement(<13640971..>13644287)
FT                   /locus_tag="mCG_21740"
FT                   /note="gene_id=mCG21740.2"
FT   mRNA            complement(join(<13640971..13642543,13643912..13643972,
FT                   13644161..>13644287))
FT                   /locus_tag="mCG_21740"
FT                   /product="mCG21740"
FT                   /note="gene_id=mCG21740.2 transcript_id=mCT21272.2 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(13640971..13642543,13643912..13643972,
FT                   13644161..>13644287))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21740"
FT                   /product="mCG21740"
FT                   /note="gene_id=mCG21740.2 transcript_id=mCT21272.2
FT                   protein_id=mCP10254.2"
FT                   /protein_id="EDL20062.1"
FT                   IELGSVGACL"
FT   assembly_gap    13654371..13654390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13670987..13671149
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    13678599..13678618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13690329..13690575
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   gene            complement(13699157..>13712034)
FT                   /locus_tag="mCG_145978"
FT                   /note="gene_id=mCG145978.0"
FT   mRNA            complement(join(13699157..13699329,13699518..13699644,
FT                   13711918..>13712034))
FT                   /locus_tag="mCG_145978"
FT                   /product="mCG145978"
FT                   /note="gene_id=mCG145978.0 transcript_id=mCT186086.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(13699265..13699329,13699518..13699644,
FT                   13711918..>13712034))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145978"
FT                   /product="mCG145978"
FT                   /note="gene_id=mCG145978.0 transcript_id=mCT186086.0
FT                   protein_id=mCP107403.0"
FT                   /protein_id="EDL20061.1"
FT   gene            complement(13716621..>13718530)
FT                   /locus_tag="mCG_134214"
FT                   /note="gene_id=mCG134214.0"
FT   mRNA            complement(13716621..>13718530)
FT                   /locus_tag="mCG_134214"
FT                   /product="mCG134214"
FT                   /note="gene_id=mCG134214.0 transcript_id=mCT135595.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(13717895..>13718260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134214"
FT                   /product="mCG134214"
FT                   /note="gene_id=mCG134214.0 transcript_id=mCT135595.0
FT                   protein_id=mCP62664.0"
FT                   /protein_id="EDL20060.1"
FT                   RVIEITIYEDRGVSSGR"
FT   assembly_gap    13724356..13724375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13738043..13738272
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            complement(13742602..>13745835)
FT                   /locus_tag="mCG_142614"
FT                   /note="gene_id=mCG142614.0"
FT   mRNA            complement(join(13742602..13744379,13744891..13744922,
FT                   13745709..>13745835))
FT                   /locus_tag="mCG_142614"
FT                   /product="mCG142614"
FT                   /note="gene_id=mCG142614.0 transcript_id=mCT181180.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(13743015..13744379,13744891..13744922,
FT                   13745709..>13745835))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142614"
FT                   /product="mCG142614"
FT                   /note="gene_id=mCG142614.0 transcript_id=mCT181180.0
FT                   protein_id=mCP104102.0"
FT                   /protein_id="EDL20059.1"
FT   assembly_gap    13747126..13747733
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    13750409..13751028
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    13752788..13753168
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    13758403..13758422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13790133..13790461
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   gene            complement(<13794401..>13808228)
FT                   /locus_tag="mCG_142615"
FT                   /note="gene_id=mCG142615.0"
FT   mRNA            complement(join(<13794401..13796000,13806446..13806568,
FT                   13807096..13807156,13808102..>13808228))
FT                   /locus_tag="mCG_142615"
FT                   /product="mCG142615"
FT                   /note="gene_id=mCG142615.0 transcript_id=mCT181181.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(13794401..13796000,13806446..13806568,
FT                   13807096..13807156,13808102..>13808228))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142615"
FT                   /product="mCG142615"
FT                   /note="gene_id=mCG142615.0 transcript_id=mCT181181.0
FT                   protein_id=mCP104103.0"
FT                   /protein_id="EDL20058.1"
FT                   A"
FT   assembly_gap    13817621..13818339
FT                   /estimated_length=719
FT                   /gap_type="unknown"
FT   gene            <13826856..>13843463
FT                   /locus_tag="mCG_51140"
FT                   /note="gene_id=mCG51140.1"
FT   mRNA            join(<13826856..13827046,13841999..>13843463)
FT                   /locus_tag="mCG_51140"
FT                   /product="mCG51140"
FT                   /note="gene_id=mCG51140.1 transcript_id=mCT51323.1 created
FT                   on 13-MAR-2003"
FT   CDS             join(<13826856..13827046,13841999..13843463)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51140"
FT                   /product="mCG51140"
FT                   /note="gene_id=mCG51140.1 transcript_id=mCT51323.1
FT                   protein_id=mCP40135.1"
FT                   /protein_id="EDL20057.1"
FT   assembly_gap    13861491..13861510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13862659..13862678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13864616..13870670
FT                   /estimated_length=6055
FT                   /gap_type="unknown"
FT   assembly_gap    13873714..13873733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13877737..13880085
FT                   /estimated_length=2349
FT                   /gap_type="unknown"
FT   assembly_gap    13881496..13883187
FT                   /estimated_length=1692
FT                   /gap_type="unknown"
FT   gene            13888190..13973651
FT                   /locus_tag="mCG_134223"
FT                   /note="gene_id=mCG134223.1"
FT   mRNA            join(13888190..13888279,13897427..13897526,
FT                   13904853..13904979,13905167..13905227,13906511..13907904,
FT                   13971872..13973649)
FT                   /locus_tag="mCG_134223"
FT                   /product="mCG134223, transcript variant mCT135604"
FT                   /note="gene_id=mCG134223.1 transcript_id=mCT135604.1
FT                   created on 03-DEC-2002"
FT   mRNA            join(13888207..13888279,13904853..13904979,
FT                   13905167..13905227,13906511..13907904,13971872..13973651)
FT                   /locus_tag="mCG_134223"
FT                   /product="mCG134223, transcript variant mCT176840"
FT                   /note="gene_id=mCG134223.1 transcript_id=mCT176840.0
FT                   created on 03-DEC-2002"
FT   CDS             join(13904946..13904979,13905167..13905227,
FT                   13906511..13907904,13971872..13971966)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134223"
FT                   /product="mCG134223, isoform CRA_a"
FT                   /note="gene_id=mCG134223.1 transcript_id=mCT135604.1
FT                   protein_id=mCP63308.1 isoform=CRA_a"
FT                   /protein_id="EDL20054.1"
FT                   FITVVYKCVK"
FT   CDS             join(13904946..13904979,13905167..13905227,
FT                   13906511..13907904,13971872..13971966)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134223"
FT                   /product="mCG134223, isoform CRA_a"
FT                   /note="gene_id=mCG134223.1 transcript_id=mCT176840.0
FT                   protein_id=mCP99762.0 isoform=CRA_a"
FT                   /protein_id="EDL20055.1"
FT                   FITVVYKCVK"
FT   assembly_gap    13913988..13914007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13939228..13951204
FT                   /estimated_length=11977
FT                   /gap_type="unknown"
FT   gene            complement(13958654..13959543)
FT                   /locus_tag="mCG_147647"
FT                   /note="gene_id=mCG147647.0"
FT   mRNA            complement(join(13958654..13958962,13959262..13959543))
FT                   /locus_tag="mCG_147647"
FT                   /product="mCG147647"
FT                   /note="gene_id=mCG147647.0 transcript_id=mCT187910.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13958665..13958778)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147647"
FT                   /product="mCG147647"
FT                   /note="gene_id=mCG147647.0 transcript_id=mCT187910.0
FT                   protein_id=mCP109040.0"
FT                   /protein_id="EDL20056.1"
FT   assembly_gap    13969599..13971685
FT                   /estimated_length=2087
FT                   /gap_type="unknown"
FT   assembly_gap    13991148..13991167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<14001584..>14012548)
FT                   /locus_tag="mCG_142585"
FT                   /note="gene_id=mCG142585.0"
FT   mRNA            complement(join(<14001584..14002407,14009375..14010904,
FT                   14012422..>14012548))
FT                   /locus_tag="mCG_142585"
FT                   /product="mCG142585"
FT                   /note="gene_id=mCG142585.0 transcript_id=mCT181030.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(14001584..14002407,14009375..14010904,
FT                   14012422..>14012548))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142585"
FT                   /product="mCG142585"
FT                   /note="gene_id=mCG142585.0 transcript_id=mCT181030.0
FT                   protein_id=mCP103952.0"
FT                   /protein_id="EDL20053.1"
FT                   TEQGVVAHTFNPST"
FT   assembly_gap    14027492..14027511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14028554..14028622
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    14029942..14035860
FT                   /estimated_length=5919
FT                   /gap_type="unknown"
FT   gene            complement(<14045324..>14048724)
FT                   /locus_tag="mCG_142584"
FT                   /note="gene_id=mCG142584.0"
FT   mRNA            complement(join(<14045324..14045429,14045804..14047240,
FT                   14048344..14048404,14048598..>14048724))
FT                   /locus_tag="mCG_142584"
FT                   /product="mCG142584"
FT                   /note="gene_id=mCG142584.0 transcript_id=mCT181031.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(14045324..14045429,14045804..14047240,
FT                   14048344..14048404,14048598..>14048724))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142584"
FT                   /product="mCG142584"
FT                   /note="gene_id=mCG142584.0 transcript_id=mCT181031.0
FT                   protein_id=mCP103953.0"
FT                   /protein_id="EDL20052.1"
FT                   "
FT   gene            14067824..14071668
FT                   /gene="Plcxd1"
FT                   /locus_tag="mCG_23690"
FT                   /note="gene_id=mCG23690.2"
FT   mRNA            join(14067824..14067874,14068003..14068180,
FT                   14068871..14068960,14069243..14069379,14069655..14069783,
FT                   14070030..14070185,14070300..14070483,14071249..14071668)
FT                   /gene="Plcxd1"
FT                   /locus_tag="mCG_23690"
FT                   /product="phosphatidylinositol-specific phospholipase C, X
FT                   domain containing 1, transcript variant mCT23776"
FT                   /note="gene_id=mCG23690.2 transcript_id=mCT23776.2 created
FT                   on 04-FEB-2003"
FT   CDS             join(14068042..14068180,14068871..14068960,
FT                   14069243..14069379,14069655..14069783,14070030..14070185,
FT                   14070300..14070483,14071249..14071487)
FT                   /codon_start=1
FT                   /gene="Plcxd1"
FT                   /locus_tag="mCG_23690"
FT                   /product="phosphatidylinositol-specific phospholipase C, X
FT                   domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG23690.2 transcript_id=mCT23776.2
FT                   protein_id=mCP21605.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9J3"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="MGI:MGI:2685422"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J3"
FT                   /protein_id="EDL20051.1"
FT                   DGFVSKVISLNCKLLSP"
FT   mRNA            join(14069060..14069275,14069655..14069783,
FT                   14070030..14070117,14070300..14070483,14071249..14071668)
FT                   /gene="Plcxd1"
FT                   /locus_tag="mCG_23690"
FT                   /product="phosphatidylinositol-specific phospholipase C, X
FT                   domain containing 1, transcript variant mCT179879"
FT                   /note="gene_id=mCG23690.2 transcript_id=mCT179879.0 created
FT                   on 04-FEB-2003"
FT   CDS             join(14070462..14070483,14071249..14071487)
FT                   /codon_start=1
FT                   /gene="Plcxd1"
FT                   /locus_tag="mCG_23690"
FT                   /product="phosphatidylinositol-specific phospholipase C, X
FT                   domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG23690.2 transcript_id=mCT179879.0
FT                   protein_id=mCP102801.0 isoform=CRA_a"
FT                   /protein_id="EDL20050.1"
FT   gene            complement(14071827..14076054)
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /note="gene_id=mCG23685.2"
FT   mRNA            complement(join(14071827..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074637,14074724..14074794,
FT                   14074914..14075289))
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), transcript
FT                   variant mCT23771"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT23771.1 created
FT                   on 04-FEB-2003"
FT   mRNA            complement(join(14071833..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14075060))
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), transcript
FT                   variant mCT179876"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179876.0 created
FT                   on 04-FEB-2003"
FT   mRNA            complement(join(14071839..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074637,14074724..14074794,
FT                   14074914..14075051,14075711..14076054))
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), transcript
FT                   variant mCT179877"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179877.0 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(14071875..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074637,14074724..14074794,
FT                   14074914..14075051,14075711..14076026))
FT                   /codon_start=1
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), isoform CRA_b"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179877.0
FT                   protein_id=mCP102799.0 isoform=CRA_b"
FT                   /protein_id="EDL20047.1"
FT   CDS             complement(join(14071875..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074637,14074724..14074794,
FT                   14074914..14075178))
FT                   /codon_start=1
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), isoform CRA_d"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT23771.1
FT                   protein_id=mCP21620.1 isoform=CRA_d"
FT                   /protein_id="EDL20049.1"
FT   CDS             complement(join(14071875..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074541))
FT                   /codon_start=1
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), isoform CRA_a"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179876.0
FT                   protein_id=mCP102800.0 isoform=CRA_a"
FT                   /protein_id="EDL20046.1"
FT   mRNA            complement(join(<14071884..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074551,14074914..14075030))
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), transcript
FT                   variant mCT179878"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179878.0 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(<14071884..14072022,14072122..14072274,
FT                   14072364..14072512,14072744..14072952,14073053..14073211,
FT                   14074120..14074190,14074507..14074551,14074914..14075002))
FT                   /codon_start=1
FT                   /gene="Gtpbp6"
FT                   /locus_tag="mCG_23685"
FT                   /product="GTP binding protein 6 (putative), isoform CRA_c"
FT                   /note="gene_id=mCG23685.2 transcript_id=mCT179878.0
FT                   protein_id=mCP102798.0 isoform=CRA_c"
FT                   /protein_id="EDL20048.1"
FT   gene            <14075584..14076415
FT                   /locus_tag="mCG_1030686"
FT                   /note="gene_id=mCG1030686.0"
FT   mRNA            join(<14075584..14075965,14076018..14076415)
FT                   /locus_tag="mCG_1030686"
FT                   /product="mCG1030686"
FT                   /note="gene_id=mCG1030686.0 transcript_id=mCT148390.0
FT                   created on 13-MAR-2003"
FT   CDS             join(<14075592..14075965,14076018..14076177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030686"
FT                   /product="mCG1030686"
FT                   /note="gene_id=mCG1030686.0 transcript_id=mCT148390.0
FT                   protein_id=mCP62947.0"
FT                   /protein_id="EDL20045.1"
FT                   RIESRSLTRSEKLG"
FT   gene            14077940..>14096945
FT                   /locus_tag="mCG_142312"
FT                   /note="gene_id=mCG142312.0"
FT   mRNA            join(14077940..14078166,14079745..14079914,
FT                   14091613..14091733,14092204..14092296,14095090..>14096945)
FT                   /locus_tag="mCG_142312"
FT                   /product="mCG142312, transcript variant mCT179855"
FT                   /note="gene_id=mCG142312.0 transcript_id=mCT179855.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(14078183..14078391,14079745..14079914,
FT                   14086270..14086401,14091613..14091733,14092204..14092296,
FT                   14095090..>14096945)
FT                   /locus_tag="mCG_142312"
FT                   /product="mCG142312, transcript variant mCT179854"
FT                   /note="gene_id=mCG142312.0 transcript_id=mCT179854.0
FT                   created on 04-FEB-2003"
FT   CDS             join(14079900..14079914,14091613..14091733,
FT                   14092204..14092296,14095090..14096945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142312"
FT                   /product="mCG142312, isoform CRA_b"
FT                   /note="gene_id=mCG142312.0 transcript_id=mCT179855.0
FT                   protein_id=mCP102777.0 isoform=CRA_b"
FT                   /protein_id="EDL20044.1"
FT                   "
FT   gene            complement(14085563..14086779)
FT                   /pseudo
FT                   /locus_tag="mCG_134217"
FT                   /note="gene_id=mCG134217.0"
FT   mRNA            complement(14085563..14086779)
FT                   /pseudo
FT                   /locus_tag="mCG_134217"
FT                   /note="gene_id=mCG134217.0 transcript_id=mCT135598.0
FT                   created on 13-MAR-2003"
FT   CDS             join(14091700..14091733,14092204..14092296,
FT                   14095090..14096945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142312"
FT                   /product="mCG142312, isoform CRA_a"
FT                   /note="gene_id=mCG142312.0 transcript_id=mCT179854.0
FT                   protein_id=mCP102776.0 isoform=CRA_a"
FT                   /protein_id="EDL20043.1"
FT   gene            complement(14097496..14099856)
FT                   /locus_tag="mCG_1030685"
FT                   /note="gene_id=mCG1030685.0"
FT   mRNA            complement(join(14097496..14097525,14099532..14099856))
FT                   /locus_tag="mCG_1030685"
FT                   /product="mCG1030685"
FT                   /note="gene_id=mCG1030685.0 transcript_id=mCT148389.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(14099672..14099737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030685"
FT                   /product="mCG1030685"
FT                   /note="gene_id=mCG1030685.0 transcript_id=mCT148389.0
FT                   protein_id=mCP62945.1"
FT                   /protein_id="EDL20042.1"
FT                   /translation="MCLQNVSRVSQQVAESREERR"
FT   gene            14103714..14140224
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /note="gene_id=mCG142311.0"
FT   mRNA            join(14103714..14103800,14103917..14104060,
FT                   14107984..14108056,14108221..14108320,14111419..14111528,
FT                   14112646..14112705,14112827..14113042,14114525..14114689,
FT                   14119787..14119946,14120596..14120750,14121378..14121540,
FT                   14123097..14123242,14127062..14127178,14128419..14128502,
FT                   14130973..14131043,14132268..14132355,14136380..14136487,
FT                   14137397..14137469,14139117..14140224)
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   transcript variant mCT179851"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179851.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(14103715..14103800,14103917..14104060,
FT                   14104349..14104518,14108221..14108320,14111419..14111528,
FT                   14112646..14112705,14112827..14113042,14114525..14114689,
FT                   14119787..14119946,14120596..14120750,14121378..14121540,
FT                   14123097..14123242,14127062..14127178,14128419..14128502,
FT                   14130973..14131043,14132268..14132355,14136380..14136487,
FT                   14137397..14137469,14139117..14139775)
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   transcript variant mCT179850"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179850.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(14103725..14103800,14103917..14104060,
FT                   14108221..14108320,14111419..14111528,14112646..14112705,
FT                   14112827..14113042,14114525..14114689,14119787..14119946,
FT                   14120596..14120750,14121378..14121540,14123097..14123242,
FT                   14127062..14127178,14128419..14128502,14130973..14131043,
FT                   14132268..14132355,14136380..14136487,14137397..14137469,
FT                   14139117..14140224)
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   transcript variant mCT179853"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179853.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(14103725..14103800,14103917..14104060,
FT                   14108221..14108320,14111419..14111528,14112646..14112705,
FT                   14114525..14114689,14119787..14119946,14120596..14120750,
FT                   14121378..14121540,14123097..14123242,14127062..14127178,
FT                   14128419..14128502,14130973..14131043,14132268..14132355,
FT                   14136380..14136487,14137397..14137469,14139117..14140224)
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   transcript variant mCT179852"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179852.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(<14103742..14103800,14103917..14104060,
FT                   14108221..14108320,14111419..14111528,14112646..14112705,
FT                   14112827..14113042,14114525..14114689,14119787..14119946,
FT                   14120596..14120750,14121378..14121540,14123097..14123242,
FT                   14127059..14127178,14128419..14128502,14130973..14131043,
FT                   14132268..14132355,14136380..14136487,14137397..14137469,
FT                   14139117..14140223)
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   transcript variant mCT191297"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT191297.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<14103770..14103800,14103917..14104060,
FT                   14108221..14108320,14111419..14111528,14112646..14112705,
FT                   14112827..14113042,14114525..14114689,14119787..14119946,
FT                   14120596..14120750,14121378..14121540,14123097..14123242,
FT                   14127059..14127178,14128419..14128502,14130973..14131043,
FT                   14132268..14132355,14136380..14136487,14137397..14137469,
FT                   14139117..14139159)
FT                   /codon_start=1
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT191297.0
FT                   protein_id=mCP112277.0 isoform=CRA_d"
FT                   /protein_id="EDL20041.1"
FT   CDS             join(14103928..14104060,14108221..14108320,
FT                   14111419..14111528,14112646..14112705,14112827..14113042,
FT                   14114525..14114689,14119787..14119946,14120596..14120750,
FT                   14121378..14121540,14123097..14123242,14127062..14127178,
FT                   14128419..14128502,14130973..14131043,14132268..14132355,
FT                   14136380..14136487,14137397..14137469,14139117..14139159)
FT                   /codon_start=1
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179853.0
FT                   protein_id=mCP102773.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q810L3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:2444898"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810L3"
FT                   /protein_id="EDL20040.1"
FT   CDS             join(14103928..14104060,14108221..14108320,
FT                   14111419..14111528,14112646..14112705,14114525..14114689,
FT                   14119787..14119946,14120596..14120750,14121378..14121540,
FT                   14123097..14123242,14127062..14127178,14128419..14128502,
FT                   14130973..14131043,14132268..14132355,14136380..14136487,
FT                   14137397..14137469,14139117..14139159)
FT                   /codon_start=1
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179852.0
FT                   protein_id=mCP102772.0 isoform=CRA_b"
FT                   /protein_id="EDL20039.1"
FT                   AMKFNHICEQTRFKN"
FT   CDS             join(14112844..14113042,14114525..14114689,
FT                   14119787..14119946,14120596..14120750,14121378..14121540,
FT                   14123097..14123242,14127062..14127178,14128419..14128502,
FT                   14130973..14131043,14132268..14132355,14136380..14136487,
FT                   14137397..14137469,14139117..14139159)
FT                   /codon_start=1
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179850.0
FT                   protein_id=mCP102774.0 isoform=CRA_a"
FT                   /protein_id="EDL20037.1"
FT                   QTRFKN"
FT   CDS             join(14112844..14113042,14114525..14114689,
FT                   14119787..14119946,14120596..14120750,14121378..14121540,
FT                   14123097..14123242,14127062..14127178,14128419..14128502,
FT                   14130973..14131043,14132268..14132355,14136380..14136487,
FT                   14137397..14137469,14139117..14139159)
FT                   /codon_start=1
FT                   /gene="Chfr"
FT                   /locus_tag="mCG_142311"
FT                   /product="checkpoint with forkhead and ring finger domains,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142311.0 transcript_id=mCT179851.0
FT                   protein_id=mCP102775.0 isoform=CRA_a"
FT                   /protein_id="EDL20038.1"
FT                   QTRFKN"
FT   assembly_gap    14115614..14115633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14117488..14117873
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   gene            complement(14135764..>14144736)
FT                   /locus_tag="mCG_145971"
FT                   /note="gene_id=mCG145971.0"
FT   mRNA            complement(join(14135764..14136739,14138518..14138602,
FT                   14144548..>14144736))
FT                   /locus_tag="mCG_145971"
FT                   /product="mCG145971"
FT                   /note="gene_id=mCG145971.0 transcript_id=mCT186079.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(14136037..>14136291)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145971"
FT                   /product="mCG145971"
FT                   /note="gene_id=mCG145971.0 transcript_id=mCT186079.0
FT                   protein_id=mCP107396.0"
FT                   /protein_id="EDL20036.1"
FT   gene            14144809..14187462
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /note="gene_id=mCG54759.2"
FT   mRNA            join(14144809..14145148,14149817..14150127,
FT                   14152552..14152821,14154000..14154112,14155555..14156201,
FT                   14156894..14157005,14157839..14158145,14161142..14161344,
FT                   14161854..14161991,14165135..14165296,14165860..14166228,
FT                   14167013..14167090,14168073..14168336,14169070..14169164,
FT                   14170838..14171054,14171722..14171865,14173055..14173252,
FT                   14175511..14175627,14180386..14180525,14181364..14181496,
FT                   14181647..14181769,14184295..14184456,14185137..14185300,
FT                   14186420..14187462)
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3,
FT                   transcript variant mCT178283"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT178283.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(14144809..14145148,14149817..14150127,
FT                   14152552..14152701,14154000..14154112,14155555..14156201,
FT                   14156894..14157005,14157839..14158145,14161142..14161344,
FT                   14161854..14161991,14165135..14165300,14165866..14166228,
FT                   14167013..14167090,14168073..14168336,14169070..14169164,
FT                   14170838..14171054,14171722..14171865,14173055..14173252,
FT                   14175511..14175627,14180386..14180525,14181364..14181496,
FT                   14181647..14181769,14184295..14184456,14185137..14185300,
FT                   14186420..14187462)
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3,
FT                   transcript variant mCT54942"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT54942.2 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<14144927..14145148,14149817..14150127,
FT                   14152552..14152701,14154000..14154112,14155555..14156201,
FT                   14156894..14157005,14157839..14158145,14161142..14161344,
FT                   14161854..14161991,14165135..14165296,14165860..14166228,
FT                   14167013..14167090,14168073..14168336,14169070..14169164,
FT                   14170838..14171054,14171722..14171865,14173055..14173252,
FT                   14175511..14175627,14180386..14180525,14181364..14181496,
FT                   14181647..14181769,14184295..14184456,14185137..14185300,
FT                   14186420..14186665)
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3,
FT                   transcript variant mCT191307"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT191307.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14149956..14150127,14152552..14152701,
FT                   14154000..14154112,14155555..14156201,14156894..14157005,
FT                   14157839..14158145,14161142..14161344,14161854..14161991,
FT                   14165135..14165296,14165860..14166228,14167013..14167090,
FT                   14168073..14168336,14169070..14169164,14170838..14171054,
FT                   14171722..14171865,14173055..14173252,14175511..14175627,
FT                   14180386..14180525,14181364..14181496,14181647..14181769,
FT                   14184295..14184456,14185137..14185300,14186420..14186591)
FT                   /codon_start=1
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT191307.0
FT                   protein_id=mCP112304.0 isoform=CRA_b"
FT                   /protein_id="EDL20034.1"
FT   CDS             join(14149992..14150127,14152552..14152821,
FT                   14154000..14154112,14155555..14156201,14156894..14157005,
FT                   14157839..14158145,14161142..14161344,14161854..14161991,
FT                   14165135..14165296,14165860..14166228,14167013..14167090,
FT                   14168073..14168336,14169070..14169164,14170838..14171054,
FT                   14171722..14171865,14173055..14173252,14175511..14175627,
FT                   14180386..14180525,14181364..14181496,14181647..14181769,
FT                   14184295..14184456,14185137..14185300,14186420..14186591)
FT                   /codon_start=1
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT178283.0
FT                   protein_id=mCP101205.0 isoform=CRA_a"
FT                   /protein_id="EDL20033.1"
FT   CDS             join(14149992..14150127,14152552..14152701,
FT                   14154000..14154112,14155555..14156201,14156894..14157005,
FT                   14157839..14158145,14161142..14161344,14161854..14161991,
FT                   14165135..14165300,14165866..14165981)
FT                   /codon_start=1
FT                   /gene="Golga3"
FT                   /locus_tag="mCG_54759"
FT                   /product="golgi autoantigen, golgin subfamily a, 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG54759.2 transcript_id=mCT54942.2
FT                   protein_id=mCP41667.2 isoform=CRA_c"
FT                   /protein_id="EDL20035.1"
FT                   S"
FT   assembly_gap    14156284..14156467
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    14181876..14181896
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    14192196..14192215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14194192..14220264
FT                   /gene="D5Ertd585e"
FT                   /locus_tag="mCG_23688"
FT                   /note="gene_id=mCG23688.2"
FT   mRNA            join(14194192..14194929,14197853..14198326,
FT                   14199779..14199985,14201161..14201357,14201453..14201641,
FT                   14205434..14205556,14208012..14208078,14214287..14214456,
FT                   14215653..14215759,14216454..14216644,14217665..14218295,
FT                   14218736..14218867,14219254..14220264)
FT                   /gene="D5Ertd585e"
FT                   /locus_tag="mCG_23688"
FT                   /product="DNA segment, Chr 5, ERATO Doi 585, expressed"
FT                   /note="gene_id=mCG23688.2 transcript_id=mCT23774.2 created
FT                   on 20-JAN-2003"
FT   CDS             join(14194743..14194929,14197853..14198326,
FT                   14199779..14199985,14201161..14201357,14201453..14201641,
FT                   14205434..14205556,14208012..14208078,14214287..14214456,
FT                   14215653..14215759,14216454..14216644,14217665..14218295,
FT                   14218736..14218867,14219254..14219473)
FT                   /codon_start=1
FT                   /gene="D5Ertd585e"
FT                   /locus_tag="mCG_23688"
FT                   /product="DNA segment, Chr 5, ERATO Doi 585, expressed"
FT                   /note="gene_id=mCG23688.2 transcript_id=mCT23774.2
FT                   protein_id=mCP21627.2"
FT                   /protein_id="EDL20032.1"
FT   assembly_gap    14210419..14210438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14224116..>14234995)
FT                   /gene="Pgam5"
FT                   /locus_tag="mCG_23692"
FT                   /note="gene_id=mCG23692.3"
FT   mRNA            complement(join(14224116..14225398,14230607..14230737,
FT                   14230835..14230923,14231006..14231131,14232182..14232360,
FT                   14234764..>14234995))
FT                   /gene="Pgam5"
FT                   /locus_tag="mCG_23692"
FT                   /product="phosphoglycerate mutase family member 5,
FT                   transcript variant mCT191319"
FT                   /note="gene_id=mCG23692.3 transcript_id=mCT191319.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14224121..14225398,14230607..14230740,
FT                   14230835..14230923,14231006..14231131,14232182..14232360,
FT                   14234764..14234985))
FT                   /gene="Pgam5"
FT                   /locus_tag="mCG_23692"
FT                   /product="phosphoglycerate mutase family member 5,
FT                   transcript variant mCT23778"
FT                   /note="gene_id=mCG23692.3 transcript_id=mCT23778.2 created
FT                   on 20-JAN-2003"
FT   CDS             complement(join(14225248..14225398,14230607..14230737,
FT                   14230835..14230923,14231006..14231131,14232182..14232360,
FT                   14234764..>14234993))
FT                   /codon_start=1
FT                   /gene="Pgam5"
FT                   /locus_tag="mCG_23692"
FT                   /product="phosphoglycerate mutase family member 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23692.3 transcript_id=mCT191319.0
FT                   protein_id=mCP112298.0 isoform=CRA_a"
FT                   /protein_id="EDL20030.1"
FT   CDS             complement(join(14225248..14225398,14230607..14230740,
FT                   14230835..14230923,14231006..14231131,14232182..14232360,
FT                   14234764..14234951))
FT                   /codon_start=1
FT                   /gene="Pgam5"
FT                   /locus_tag="mCG_23692"
FT                   /product="phosphoglycerate mutase family member 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23692.3 transcript_id=mCT23778.2
FT                   protein_id=mCP21606.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="MGI:MGI:1919792"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNW0"
FT                   /protein_id="EDL20031.1"
FT                   PDKITRS"
FT   gene            complement(14239404..14251196)
FT                   /gene="Pxmp2"
FT                   /locus_tag="mCG_134215"
FT                   /note="gene_id=mCG134215.2"
FT   mRNA            complement(join(14239404..14239744,14242664..14242783,
FT                   14246202..14246364,14248649..14248756,14250896..14251196))
FT                   /gene="Pxmp2"
FT                   /locus_tag="mCG_134215"
FT                   /product="peroxisomal membrane protein 2, transcript
FT                   variant mCT135596"
FT                   /note="gene_id=mCG134215.2 transcript_id=mCT135596.2
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(14239676..14239744,14242664..14242783,
FT                   14246202..14246364,14248649..14248756,14250896..14251017))
FT                   /codon_start=1
FT                   /gene="Pxmp2"
FT                   /locus_tag="mCG_134215"
FT                   /product="peroxisomal membrane protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG134215.2 transcript_id=mCT135596.2
FT                   protein_id=mCP62666.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5D073"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:107487"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D073"
FT                   /protein_id="EDL20028.1"
FT   mRNA            complement(join(14245805..14245841,14246202..14246364,
FT                   14248649..14248756,14250896..14251196))
FT                   /gene="Pxmp2"
FT                   /locus_tag="mCG_134215"
FT                   /product="peroxisomal membrane protein 2, transcript
FT                   variant mCT175382"
FT                   /note="gene_id=mCG134215.2 transcript_id=mCT175382.1
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(14245815..14245841,14246202..14246364,
FT                   14248649..14248756,14250896..14251017))
FT                   /codon_start=1
FT                   /gene="Pxmp2"
FT                   /locus_tag="mCG_134215"
FT                   /product="peroxisomal membrane protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG134215.2 transcript_id=mCT175382.1
FT                   protein_id=mCP98301.0 isoform=CRA_b"
FT                   /protein_id="EDL20029.1"
FT   gene            <14251395..14303501
FT                   /gene="Pole"
FT                   /locus_tag="mCG_20937"
FT                   /note="gene_id=mCG20937.1"
FT   mRNA            join(<14251395..14251456,14254207..14254348,
FT                   14254756..14254836,14255200..14255244,14255379..14255471,
FT                   14256777..14256931,14259069..14259210,14259524..14259604,
FT                   14260318..14260425,14260701..14260811,14261037..14261122,
FT                   14261327..14261446,14262815..14262947,14263157..14263270,
FT                   14263542..14263754,14264050..14264157,14264702..14264830,
FT                   14264910..14265012,14265099..14265245,14265583..14265728,
FT                   14267833..14267981,14269411..14269503,14269691..14269835,
FT                   14272163..14272320,14272603..14272798,14274776..14274990,
FT                   14277847..14277949,14278574..14278654,14278746..14278868,
FT                   14283742..14283951,14284178..14284387,14284568..14284711,
FT                   14289490..14289630,14289882..14290035,14290112..14290218,
FT                   14290373..14290549,14290632..14290855,14291036..14291256,
FT                   14291464..14291668,14293654..14293827,14295499..14295624,
FT                   14298491..14298668,14300209..14300340,14300473..14300666,
FT                   14301886..14302086,14302420..14302545,14303004..14303093,
FT                   14303178..14303501)
FT                   /gene="Pole"
FT                   /locus_tag="mCG_20937"
FT                   /product="polymerase (DNA directed), epsilon"
FT                   /note="gene_id=mCG20937.1 transcript_id=mCT23678.2 created
FT                   on 03-DEC-2002"
FT   CDS             join(14251395..14251456,14254207..14254348,
FT                   14254756..14254836,14255200..14255244,14255379..14255471,
FT                   14256777..14256931,14259069..14259210,14259524..14259604,
FT                   14260318..14260425,14260701..14260811,14261037..14261122,
FT                   14261327..14261446,14262815..14262947,14263157..14263270,
FT                   14263542..14263754,14264050..14264157,14264702..14264830,
FT                   14264910..14265012,14265099..14265245,14265583..14265728,
FT                   14267833..14267981,14269411..14269503,14269691..14269835,
FT                   14272163..14272320,14272603..14272798,14274776..14274990,
FT                   14277847..14277949,14278574..14278654,14278746..14278868,
FT                   14283742..14283951,14284178..14284387,14284568..14284711,
FT                   14289490..14289630,14289882..14290035,14290112..14290218,
FT                   14290373..14290549,14290632..14290855,14291036..14291256,
FT                   14291464..14291668,14293654..14293827,14295499..14295624,
FT                   14298491..14298659)
FT                   /codon_start=1
FT                   /gene="Pole"
FT                   /locus_tag="mCG_20937"
FT                   /product="polymerase (DNA directed), epsilon"
FT                   /note="gene_id=mCG20937.1 transcript_id=mCT23678.2
FT                   protein_id=mCP21657.2"
FT                   /protein_id="EDL20027.1"
FT                   SSCPRQPLARATSS"
FT   assembly_gap    14255847..14255866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14279826..14279929
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    14296845..14296864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14299526..14299545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14305862..>14309005)
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /note="gene_id=mCG20940.1"
FT   mRNA            complement(join(14305862..14306347,14306555..14306632,
FT                   14306718..14306783,14306906..14306999,14307151..14307281,
FT                   14307601..14307739,14307824..14307904,14308055..14308151,
FT                   14308228..14308303,14308383..14308454,14308550..14308685,
FT                   14308830..>14309005))
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, transcript variant mCT179870"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT179870.0 created
FT                   on 07-FEB-2003"
FT   mRNA            complement(join(14305862..14306284,14306555..14306632,
FT                   14306718..14306783,14306906..14306999,14307151..14307281,
FT                   14307601..14307739,14307824..14307904,14308055..14308151,
FT                   14308228..14308303,14308383..14308454,14308550..14308685,
FT                   14308830..>14308966))
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, transcript variant mCT179869"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT179869.0 created
FT                   on 07-FEB-2003"
FT   mRNA            complement(join(14305864..14306632,14306718..14306783,
FT                   14306906..14306999,14307151..14307281,14307601..14307739,
FT                   14307824..14307904,14308055..14308151,14308228..14308303,
FT                   14308383..14308454,14308550..14308685,14308830..>14308966))
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, transcript variant mCT23764"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT23764.1 created
FT                   on 07-FEB-2003"
FT   CDS             complement(join(14306243..14306347,14306555..14306632,
FT                   14306718..14306783,14306906..14306999,14307151..14307281,
FT                   14307601..14307739,14307824..14307904,14308055..14308151,
FT                   14308228..14308303,14308383..14308454,14308550..14308685,
FT                   14308830..14309005))
FT                   /codon_start=1
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, isoform CRA_b"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT179870.0
FT                   protein_id=mCP102792.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8K3P1"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="InterPro:IPR003045"
FT                   /db_xref="InterPro:IPR027309"
FT                   /db_xref="MGI:MGI:2665170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K3P1"
FT                   /protein_id="EDL20025.1"
FT                   PSQQDSTSTDPKGLAQL"
FT   CDS             complement(join(14306243..14306284,14306555..14306632,
FT                   14306718..14306783,14306906..14306999,14307151..14307281,
FT                   14307601..14307739,14307824..14307904,14308055..14308151,
FT                   14308228..14308303,14308383..14308454,14308550..14308685,
FT                   14308830..14308966))
FT                   /codon_start=1
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, isoform CRA_a"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT179869.0
FT                   protein_id=mCP102791.0 isoform=CRA_a"
FT                   /protein_id="EDL20024.1"
FT   CDS             complement(join(14306243..14306632,14306718..14306783,
FT                   14306906..14306999,14307151..14307281,14307601..14307739,
FT                   14307824..14307904,14308055..14308151,14308228..14308303,
FT                   14308383..14308454,14308550..14308685,14308830..14308966))
FT                   /codon_start=1
FT                   /gene="P2rx2"
FT                   /locus_tag="mCG_20940"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 2, isoform CRA_c"
FT                   /note="gene_id=mCG20940.1 transcript_id=mCT23764.1
FT                   protein_id=mCP21612.1 isoform=CRA_c"
FT                   /protein_id="EDL20026.1"
FT                   QDSTSTDPKGLAQL"
FT   assembly_gap    14316601..14317584
FT                   /estimated_length=984
FT                   /gap_type="unknown"
FT   gene            14320210..14322362
FT                   /locus_tag="mCG_134234"
FT                   /note="gene_id=mCG134234.1"
FT   mRNA            join(14320210..14320402,14320600..14320725,
FT                   14321003..14321128,14322126..14322362)
FT                   /locus_tag="mCG_134234"
FT                   /product="mCG134234"
FT                   /note="gene_id=mCG134234.1 transcript_id=mCT135615.1
FT                   created on 13-MAR-2003"
FT   CDS             join(14320289..14320402,14320600..14320725,
FT                   14321003..14321128,14322126..14322128)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134234"
FT                   /product="mCG134234"
FT                   /note="gene_id=mCG134234.1 transcript_id=mCT135615.1
FT                   protein_id=mCP62956.1"
FT                   /protein_id="EDL20023.1"
FT                   PSSHCTKRTGLLALCLPV"
FT   assembly_gap    14320738..14320915
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    14323037..14323620
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   gene            complement(14328275..>14418334)
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /note="gene_id=mCG20938.3"
FT   mRNA            complement(join(14328275..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342762..14342791,14342911..14342979,14343866..14343916,
FT                   14344547..14344776,14345415..14345635,14345790..14346114,
FT                   14348121..14348166,14362591..14362620,14385940..14385975,
FT                   14387753..14387857,14402743..14402943,14417728..14418320))
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, transcript variant
FT                   mCT130850"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT130850.1 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(14328275..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342516..14342587,14342762..14342791,14342911..14342979,
FT                   14343866..14343916,14344547..14344776,14345415..14345635,
FT                   14345790..14346114,14348121..14348166,14362591..14362620,
FT                   14385940..14385975,14387753..14387857,14402743..14402943,
FT                   14417728..14418320))
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, transcript variant
FT                   mCT23679"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT23679.2 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(14329312..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342516..14342587,14342762..14342791,14342911..14342979,
FT                   14343866..14345018,14345415..14345635,14345790..14346114,
FT                   14348121..14348166,14362591..14362620,14385940..14385975,
FT                   14387753..14387857,14402743..14402943,14417728..>14418334))
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, transcript variant
FT                   mCT191364"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT191364.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(14329563..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342762..14342791,14342911..14342979,14343866..14343916,
FT                   14344547..14344776,14345415..14345635,14345790..14346114,
FT                   14348121..14348166,14362591..14362620,14385940..14385975,
FT                   14387753..14387857,14402743..14402943,14417728..14418015))
FT                   /codon_start=1
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, isoform CRA_a"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT130850.1
FT                   protein_id=mCP63356.1 isoform=CRA_a"
FT                   /protein_id="EDL20019.1"
FT   CDS             complement(join(14329563..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342516..14342587,14342762..14342791,14342911..14342979,
FT                   14343866..14343916,14344547..14344776,14345415..14345635,
FT                   14345790..14346114,14348121..14348166,14362591..14362620,
FT                   14385940..14385975,14387753..14387857,14402743..14402943,
FT                   14417728..14418015))
FT                   /codon_start=1
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, isoform CRA_c"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT23679.2
FT                   protein_id=mCP21639.2 isoform=CRA_c"
FT                   /protein_id="EDL20021.1"
FT   CDS             complement(join(14329563..14330400,14337471..14337675,
FT                   14337809..14337892,14338069..14338146,14340905..14341034,
FT                   14342516..14342587,14342762..14342791,14342911..14342979,
FT                   14343866..>14344084))
FT                   /codon_start=1
FT                   /gene="2410025L10Rik"
FT                   /locus_tag="mCG_20938"
FT                   /product="RIKEN cDNA 2410025L10, isoform CRA_b"
FT                   /note="gene_id=mCG20938.3 transcript_id=mCT191364.0
FT                   protein_id=mCP112333.0 isoform=CRA_b"
FT                   /protein_id="EDL20020.1"
FT   gene            complement(14335084..14515760)
FT                   /locus_tag="mCG_147663"
FT                   /note="gene_id=mCG147663.0"
FT   mRNA            complement(join(14335084..14336696,14515720..14515760))
FT                   /locus_tag="mCG_147663"
FT                   /product="mCG147663"
FT                   /note="gene_id=mCG147663.0 transcript_id=mCT187926.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14335488..14335724)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147663"
FT                   /product="mCG147663"
FT                   /note="gene_id=mCG147663.0 transcript_id=mCT187926.0
FT                   protein_id=mCP109056.0"
FT                   /protein_id="EDL20015.1"
FT   gene            14352349..14354588
FT                   /locus_tag="mCG_147680"
FT                   /note="gene_id=mCG147680.0"
FT   mRNA            join(14352349..14352393,14352800..14354588)
FT                   /locus_tag="mCG_147680"
FT                   /product="mCG147680"
FT                   /note="gene_id=mCG147680.0 transcript_id=mCT187943.0
FT                   created on 13-JAN-2004"
FT   CDS             14352802..14353026
FT                   /codon_start=1
FT                   /locus_tag="mCG_147680"
FT                   /product="mCG147680"
FT                   /note="gene_id=mCG147680.0 transcript_id=mCT187943.0
FT                   protein_id=mCP109074.0"
FT                   /protein_id="EDL20022.1"
FT   assembly_gap    14371214..14371233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14375030..14375134
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            14417835..14419794
FT                   /locus_tag="mCG_147672"
FT                   /note="gene_id=mCG147672.0"
FT   mRNA            14417835..14419794
FT                   /locus_tag="mCG_147672"
FT                   /product="mCG147672"
FT                   /note="gene_id=mCG147672.0 transcript_id=mCT187935.0
FT                   created on 13-JAN-2004"
FT   CDS             14419357..14419575
FT                   /codon_start=1
FT                   /locus_tag="mCG_147672"
FT                   /product="mCG147672"
FT                   /note="gene_id=mCG147672.0 transcript_id=mCT187935.0
FT                   protein_id=mCP109066.0"
FT                   /protein_id="EDL20018.1"
FT   assembly_gap    14455884..14455903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14478465..14480584
FT                   /estimated_length=2120
FT                   /gap_type="unknown"
FT   gene            <14487612..14498432
FT                   /gene="A630023P12Rik"
FT                   /locus_tag="mCG_1030684"
FT                   /note="gene_id=mCG1030684.1"
FT   mRNA            join(<14487612..14487764,14497494..14497611,
FT                   14498054..>14498425)
FT                   /gene="A630023P12Rik"
FT                   /locus_tag="mCG_1030684"
FT                   /product="RIKEN cDNA A630023P12, transcript variant
FT                   mCT179835"
FT                   /note="gene_id=mCG1030684.1 transcript_id=mCT179835.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(<14493625..14493815,14494548..14494797,
FT                   14497494..14497611,14498054..14498432)
FT                   /gene="A630023P12Rik"
FT                   /locus_tag="mCG_1030684"
FT                   /product="RIKEN cDNA A630023P12, transcript variant
FT                   mCT148388"
FT                   /note="gene_id=mCG1030684.1 transcript_id=mCT148388.0
FT                   created on 04-FEB-2003"
FT   assembly_gap    14493969..14494374
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   CDS             join(<14497534..14497611,14498054..14498425)
FT                   /codon_start=1
FT                   /gene="A630023P12Rik"
FT                   /locus_tag="mCG_1030684"
FT                   /product="RIKEN cDNA A630023P12, isoform CRA_a"
FT                   /note="gene_id=mCG1030684.1 transcript_id=mCT179835.0
FT                   protein_id=mCP102757.0 isoform=CRA_a"
FT                   /protein_id="EDL20016.1"
FT   CDS             join(<14497534..14497611,14498054..14498425)
FT                   /codon_start=1
FT                   /gene="A630023P12Rik"
FT                   /locus_tag="mCG_1030684"
FT                   /product="RIKEN cDNA A630023P12, isoform CRA_a"
FT                   /note="gene_id=mCG1030684.1 transcript_id=mCT148388.0
FT                   protein_id=mCP62928.0 isoform=CRA_a"
FT                   /protein_id="EDL20017.1"
FT   assembly_gap    14505790..14505809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14508304..14508323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14517261..14594277
FT                   /gene="Galnt9"
FT                   /locus_tag="mCG_129543"
FT                   /note="gene_id=mCG129543.1"
FT   mRNA            join(14517261..14517850,14550316..14550496,
FT                   14561112..14561278,14562665..14562839,14568914..14569111,
FT                   14575455..14575572,14586975..14587160,14588302..14588439,
FT                   14590743..14590838,14592070..14592237,14593409..14594276)
FT                   /gene="Galnt9"
FT                   /locus_tag="mCG_129543"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 9, transcript variant
FT                   mCT130856"
FT                   /note="gene_id=mCG129543.1 transcript_id=mCT130856.1
FT                   created on 04-FEB-2003"
FT   CDS             join(14517610..14517850,14550316..14550496,
FT                   14561112..14561278,14562665..14562839,14568914..14569111,
FT                   14575455..14575572,14586975..14587160,14588302..14588439,
FT                   14590743..14590838,14592070..14592237,14593409..14593555)
FT                   /codon_start=1
FT                   /gene="Galnt9"
FT                   /locus_tag="mCG_129543"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 9, isoform CRA_a"
FT                   /note="gene_id=mCG129543.1 transcript_id=mCT130856.1
FT                   protein_id=mCP63329.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X942"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2677965"
FT                   /db_xref="UniProtKB/TrEMBL:G3X942"
FT                   /protein_id="EDL20013.1"
FT   assembly_gap    14523555..14523751
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    14546422..14547384
FT                   /estimated_length=963
FT                   /gap_type="unknown"
FT   mRNA            join(14576396..14576475,14586975..14587160,
FT                   14588302..14588439,14590743..14590838,14592070..14592237,
FT                   14593409..14594277)
FT                   /gene="Galnt9"
FT                   /locus_tag="mCG_129543"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 9, transcript variant
FT                   mCT179842"
FT                   /note="gene_id=mCG129543.1 transcript_id=mCT179842.0
FT                   created on 04-FEB-2003"
FT   CDS             join(14586996..14587160,14588302..14588439,
FT                   14590743..14590838,14592070..14592237,14593409..14593555)
FT                   /codon_start=1
FT                   /gene="Galnt9"
FT                   /locus_tag="mCG_129543"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 9, isoform CRA_b"
FT                   /note="gene_id=mCG129543.1 transcript_id=mCT179842.0
FT                   protein_id=mCP102764.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TB05"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2677965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TB05"
FT                   /protein_id="EDL20014.1"
FT                   GQKWMIRNWIKHARH"
FT   assembly_gap    14606514..14606533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14621784..14626807)
FT                   /gene="Noc4l"
FT                   /locus_tag="mCG_3281"
FT                   /note="gene_id=mCG3281.2"
FT   mRNA            complement(join(14621784..14622348,14622431..14622544,
FT                   14622697..14622779,14622898..14623058,14623169..14623279,
FT                   14623437..14623497,14623700..14623811,14623899..14623949,
FT                   14624310..14624344,14624477..14624576,14624677..14624826,
FT                   14625044..14625151,14625681..14625787,14626387..14626507,
FT                   14626608..14626807))
FT                   /gene="Noc4l"
FT                   /locus_tag="mCG_3281"
FT                   /product="nucleolar complex associated 4 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG3281.2 transcript_id=mCT2288.2 created on
FT                   04-FEB-2003"
FT   CDS             complement(join(14622229..14622348,14622431..14622544,
FT                   14622697..14622779,14622898..14623058,14623169..14623279,
FT                   14623437..14623497,14623700..14623811,14623899..14623949,
FT                   14624310..14624344,14624477..14624576,14624677..14624826,
FT                   14625044..14625151,14625681..14625787,14626387..14626507,
FT                   14626608..14626724))
FT                   /codon_start=1
FT                   /gene="Noc4l"
FT                   /locus_tag="mCG_3281"
FT                   /product="nucleolar complex associated 4 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG3281.2 transcript_id=mCT2288.2
FT                   protein_id=mCP21614.2"
FT                   /db_xref="GOA:Q3T9T2"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="MGI:MGI:2140843"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9T2"
FT                   /protein_id="EDL20012.1"
FT   gene            14626850..14631797
FT                   /gene="Ddx51"
FT                   /locus_tag="mCG_3283"
FT                   /note="gene_id=mCG3283.2"
FT   mRNA            join(14626850..14627176,14627266..14627399,
FT                   14627856..14628006,14628257..14628402,14628480..14628551,
FT                   14628695..14628801,14628953..14629061,14629148..14629293,
FT                   14629428..14629620,14629719..14629834,14629913..14630029,
FT                   14630204..14630305,14630476..14630539,14630639..14630773,
FT                   14630969..14631797)
FT                   /gene="Ddx51"
FT                   /locus_tag="mCG_3283"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 51"
FT                   /note="gene_id=mCG3283.2 transcript_id=mCT2287.2 created on
FT                   03-DEC-2002"
FT   CDS             join(14626876..14627176,14627266..14627399,
FT                   14627856..14628006,14628257..14628402,14628480..14628551,
FT                   14628695..14628801,14628953..14629061,14629148..14629293,
FT                   14629428..14629620,14629719..14629834,14629913..14630029,
FT                   14630204..14630305,14630476..14630539,14630639..14630773,
FT                   14630969..14630995)
FT                   /codon_start=1
FT                   /gene="Ddx51"
FT                   /locus_tag="mCG_3283"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 51"
FT                   /note="gene_id=mCG3283.2 transcript_id=mCT2287.2
FT                   protein_id=mCP21655.2"
FT                   /protein_id="EDL20011.1"
FT                   LKAA"
FT   gene            complement(14637741..14744014)
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /note="gene_id=mCG129539.1"
FT   mRNA            complement(join(14637741..14639436,14639902..14639979,
FT                   14640830..14640976,14641425..14641552,14641912..14642107,
FT                   14644245..14644466,14646480..14646664,14646778..14646985,
FT                   14648232..14648341,14648415..14648460,14649822..14650118,
FT                   14650231..14650309,14653336..14653392,14653514..14653650,
FT                   14656171..14656344,14656508..14656749,14657218..14657371,
FT                   14657459..14657503,14657905..14658039,14658449..14658532,
FT                   14658724..14658882,14661170..14661313,14661564..14661675,
FT                   14664994..14665190,14666545..14666714,14666799..14667001,
FT                   14668648..14668913,14669328..14669422,14670584..14670742,
FT                   14672127..14672291,14674997..14675166,14676827..14676993,
FT                   14678257..14678443,14681303..14681439,14681537..14681711,
FT                   14682148..14682317,14684405..14684541,14692452..14692629,
FT                   14692798..14692988,14694101..14694208,14697787..14697876,
FT                   14700256..14700313,14700894..14700943,14702600..14702678,
FT                   14703189..14703329,14707085..14707270,14708740..14709036,
FT                   14712686..14713071,14713572..14713679,14715360..14715450,
FT                   14728792..14730161,14743901..14744014))
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, transcript variant
FT                   mCT130852"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT130852.1
FT                   created on 20-JAN-2003"
FT   mRNA            complement(join(14637741..14639436,14639902..14639979,
FT                   14640830..14640976,14641425..14641552,14641912..14642107,
FT                   14644245..14644466,14646480..14646664,14646778..14646985,
FT                   14648232..14648341,14648415..14648460,14649822..14650118,
FT                   14650231..14650309,14653336..14653392,14653514..14653650,
FT                   14656171..14656344,14656508..14656749,14657218..14657371,
FT                   14657459..14657503,14657905..14658039,14658449..14658532,
FT                   14658724..14658882,14661170..14661313,14661564..14661675,
FT                   14664994..14665190,14666545..14666714,14666799..14667001,
FT                   14668648..14668913,14669328..14669422,14670584..14670742,
FT                   14672127..14672291,14674997..14675166,14676827..14676993,
FT                   14678257..14678443,14681303..14681439,14681537..14681711,
FT                   14682148..14682317,14684405..14684541,14692452..14692629,
FT                   14692798..14692988,14694101..14694208,14697787..14697876,
FT                   14700256..14700313,14700894..14700943,14702600..14702678,
FT                   14703189..14703329,14707085..14707270,14708740..14709036,
FT                   14712686..14713071,14715360..14715450,14728792..14730161,
FT                   14743901..>14743936))
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, transcript variant
FT                   mCT191437"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT191437.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(14639164..14639436,14639902..14639979,
FT                   14640830..14640976,14641425..14641552,14641912..14642107,
FT                   14644245..14644466,14646480..14646664,14646778..14646985,
FT                   14648232..14648341,14648415..14648460,14649822..14650118,
FT                   14650231..14650309,14653336..14653392,14653514..14653650,
FT                   14656171..14656344,14656508..14656749,14657218..14657371,
FT                   14657459..14657503,14657905..14658039,14658449..14658532,
FT                   14658724..14658882,14661170..14661313,14661564..14661675,
FT                   14664994..14665190,14666545..14666714,14666799..14667001,
FT                   14668648..14668913,14669328..14669422,14670584..14670742,
FT                   14672127..14672291,14674997..14675166,14676827..14676993,
FT                   14678257..14678443,14681303..14681439,14681537..14681711,
FT                   14682148..14682317,14684405..14684541,14692452..14692629,
FT                   14692798..14692988,14694101..14694208,14697787..14697876,
FT                   14700256..14700313,14700894..14700943,14702600..14702678,
FT                   14703189..14703329,14707085..14707270,14708740..14709036,
FT                   14712686..14713071,14715360..14715450,14728792..>14730141))
FT                   /codon_start=1
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, isoform CRA_c"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT191437.0
FT                   protein_id=mCP112366.0 isoform=CRA_c"
FT                   /protein_id="EDL20009.1"
FT                   KTPTKPPCQ"
FT   CDS             complement(join(14639164..14639436,14639902..14639979,
FT                   14640830..14640976,14641425..14641552,14641912..14642107,
FT                   14644245..14644466,14646480..14646664,14646778..14646985,
FT                   14648232..14648341,14648415..14648460,14649822..14650118,
FT                   14650231..14650309,14653336..14653392,14653514..14653650,
FT                   14656171..14656344,14656508..14656749,14657218..14657371,
FT                   14657459..14657503,14657905..14658039,14658449..14658532,
FT                   14658724..14658882,14661170..14661313,14661564..14661675,
FT                   14664994..14665190,14666545..14666714,14666799..14667001,
FT                   14668648..14668913,14669328..14669422,14670584..14670742,
FT                   14672127..14672291,14674997..14675166,14676827..14676993,
FT                   14678257..14678443,14681303..14681439,14681537..14681711,
FT                   14682148..14682317,14684405..14684541,14692452..14692629,
FT                   14692798..14692988,14694101..14694208,14697787..14697876,
FT                   14700256..14700313,14700894..14700943,14702600..14702678,
FT                   14703189..14703329,14707085..14707270,14708740..14709036,
FT                   14712686..14713071,14713572..14713679,14715360..14715450,
FT                   14728792..14730126))
FT                   /codon_start=1
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, isoform CRA_a"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT130852.1
FT                   protein_id=mCP62696.1 isoform=CRA_a"
FT                   /protein_id="EDL20007.1"
FT   gene            complement(14662836..14664594)
FT                   /locus_tag="mCG_147661"
FT                   /note="gene_id=mCG147661.0"
FT   mRNA            complement(14662836..14664594)
FT                   /locus_tag="mCG_147661"
FT                   /product="mCG147661"
FT                   /note="gene_id=mCG147661.0 transcript_id=mCT187924.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14663725..14663982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147661"
FT                   /product="mCG147661"
FT                   /note="gene_id=mCG147661.0 transcript_id=mCT187924.0
FT                   protein_id=mCP109054.0"
FT                   /protein_id="EDL20010.1"
FT   mRNA            complement(join(14711460..14713071,14713572..14713679,
FT                   14715360..14715450,14727200..14727310,14728792..14730161,
FT                   14743458..14743566))
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, transcript variant
FT                   mCT179071"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT179071.0
FT                   created on 20-JAN-2003"
FT   CDS             complement(join(14712656..14713071,14713572..14713679,
FT                   14715360..14715450,14727200..14727310,14728792..14730126))
FT                   /codon_start=1
FT                   /gene="Ep400"
FT                   /locus_tag="mCG_129539"
FT                   /product="E1A binding protein p400, isoform CRA_b"
FT                   /note="gene_id=mCG129539.1 transcript_id=mCT179071.0
FT                   protein_id=mCP101993.0 isoform=CRA_b"
FT                   /protein_id="EDL20008.1"
FT   gene            complement(14747074..>14753998)
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /note="gene_id=mCG3282.3"
FT   mRNA            complement(join(14747074..14747385,14747928..14748619,
FT                   14748942..14749044,14749958..14750011,14751016..14751153,
FT                   14753089..14753299,14753642..>14753998))
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, transcript variant
FT                   mCT191289"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT191289.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14747078..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753299,
FT                   14753964..14753995))
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, transcript variant
FT                   mCT176850"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT176850.0 created
FT                   on 03-DEC-2002"
FT   mRNA            complement(join(14747078..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753299,
FT                   14753642..14753899))
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, transcript variant
FT                   mCT176851"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT176851.0 created
FT                   on 03-DEC-2002"
FT   mRNA            complement(join(14747078..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753548))
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, transcript variant
FT                   mCT2289"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT2289.2 created on
FT                   03-DEC-2002"
FT   CDS             complement(join(14747338..14747385,14747928..14748619,
FT                   14748942..14749044,14749958..14750011,14751016..14751153,
FT                   14753089..14753299,14753642..>14753754))
FT                   /codon_start=1
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, isoform CRA_b"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT191289.0
FT                   protein_id=mCP112299.0 isoform=CRA_b"
FT                   /protein_id="EDL20004.1"
FT   CDS             complement(join(14747338..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753299,
FT                   14753642..14753721))
FT                   /codon_start=1
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, isoform CRA_a"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT176851.0
FT                   protein_id=mCP99773.0 isoform=CRA_a"
FT                   /protein_id="EDL20003.1"
FT   CDS             complement(join(14747338..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753316))
FT                   /codon_start=1
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, isoform CRA_d"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT2289.2
FT                   protein_id=mCP21651.2 isoform=CRA_d"
FT                   /protein_id="EDL20006.1"
FT                   DTD"
FT   CDS             complement(join(14747338..14747385,14747928..14748619,
FT                   14748942..14749044,14751016..14751153,14753089..14753289))
FT                   /codon_start=1
FT                   /gene="Pus1"
FT                   /locus_tag="mCG_3282"
FT                   /product="pseudouridine synthase 1, isoform CRA_c"
FT                   /note="gene_id=mCG3282.3 transcript_id=mCT176850.0
FT                   protein_id=mCP99772.0 isoform=CRA_c"
FT                   /protein_id="EDL20005.1"
FT   gene            complement(14757898..>14783407)
FT                   /gene="Ulk1"
FT                   /locus_tag="mCG_3279"
FT                   /note="gene_id=mCG3279.3"
FT   mRNA            complement(join(14757898..14759630,14759703..14759838,
FT                   14760487..14760644,14760977..14761095,14761176..14761348,
FT                   14761513..14761703,14762132..14762275,14762351..14762460,
FT                   14762745..14762938,14763615..14763883,14764253..14764357,
FT                   14764455..14764600,14765006..14765131,14765507..14765596,
FT                   14765802..14765862,14766372..14766519,14767221..14767309,
FT                   14767598..14767648,14767990..14768072,14768152..14768210,
FT                   14769137..14769238,14769561..14769634,14769732..14769905,
FT                   14772287..14772323,14772529..14772561,14782380..14782421,
FT                   14782502..14782594,14782989..>14783407))
FT                   /gene="Ulk1"
FT                   /locus_tag="mCG_3279"
FT                   /product="Unc-51 like kinase 1 (C. elegans), transcript
FT                   variant mCT191428"
FT                   /note="gene_id=mCG3279.3 transcript_id=mCT191428.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14758879..14759630,14759703..14759838,
FT                   14760487..14760644,14760977..14761095,14761176..14761348,
FT                   14761513..14761703,14762132..14762275,14762351..14762460,
FT                   14762745..14762938,14763615..14763883,14764253..14764339,
FT                   14764455..14764600,14765006..14765131,14765507..14765596,
FT                   14765802..14765862,14766372..14766519,14767221..14767309,
FT                   14767598..14767648,14767990..14768072,14768152..14768210,
FT                   14769137..14769238,14769561..14769634,14769732..14769905,
FT                   14772287..14772323,14772529..14772561,14782380..14782421,
FT                   14782502..14782594,14782989..14783150))
FT                   /gene="Ulk1"
FT                   /locus_tag="mCG_3279"
FT                   /product="Unc-51 like kinase 1 (C. elegans), transcript
FT                   variant mCT2290"
FT                   /note="gene_id=mCG3279.3 transcript_id=mCT2290.2 created on
FT                   03-DEC-2002"
FT   CDS             complement(join(14759575..14759630,14759703..14759838,
FT                   14760487..14760644,14760977..14761095,14761176..14761348,
FT                   14761513..14761703,14762132..14762275,14762351..14762460,
FT                   14762745..14762938,14763615..14763883,14764253..14764357,
FT                   14764455..14764600,14765006..14765131,14765507..14765596,
FT                   14765802..14765862,14766372..14766519,14767221..14767309,
FT                   14767598..14767648,14767990..14768072,14768152..14768210,
FT                   14769137..14769238,14769561..14769634,14769732..14769905,
FT                   14772287..14772323,14772529..14772561,14782380..14782421,
FT                   14782502..14782594,14782989..>14783405))
FT                   /codon_start=1
FT                   /gene="Ulk1"
FT                   /locus_tag="mCG_3279"
FT                   /product="Unc-51 like kinase 1 (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG3279.3 transcript_id=mCT191428.0
FT                   protein_id=mCP112403.0 isoform=CRA_a"
FT                   /protein_id="EDL20001.1"
FT   CDS             complement(join(14759575..14759630,14759703..14759838,
FT                   14760487..14760644,14760977..14761095,14761176..14761348,
FT                   14761513..14761703,14762132..14762275,14762351..14762460,
FT                   14762745..14762938,14763615..14763883,14764253..14764339,
FT                   14764455..14764600,14765006..14765131,14765507..14765596,
FT                   14765802..14765862,14766372..14766519,14767221..14767309,
FT                   14767598..14767648,14767990..14768072,14768152..14768210,
FT                   14769137..14769238,14769561..14769634,14769732..14769905,
FT                   14772287..14772323,14772529..14772561,14782380..14782421,
FT                   14782502..14782594,14782989..14783099))
FT                   /codon_start=1
FT                   /gene="Ulk1"
FT                   /locus_tag="mCG_3279"
FT                   /product="Unc-51 like kinase 1 (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG3279.3 transcript_id=mCT2290.2
FT                   protein_id=mCP21613.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0R4J0B3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016237"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="MGI:MGI:1270126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0B3"
FT                   /protein_id="EDL20002.1"
FT                   VYA"
FT   assembly_gap    14784972..14785071
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            complement(14802339..14813228)
FT                   /gene="AW049829"
FT                   /locus_tag="mCG_3284"
FT                   /note="gene_id=mCG3284.2"
FT   mRNA            complement(join(14802339..14802476,14804260..14804307,
FT                   14808174..14808318,14809498..14809587,14809825..14809921,
FT                   14812968..14813213))
FT                   /gene="AW049829"
FT                   /locus_tag="mCG_3284"
FT                   /product="expressed sequence AW049829, transcript variant
FT                   mCT2297"
FT                   /note="gene_id=mCG3284.2 transcript_id=mCT2297.2 created on
FT                   07-FEB-2003"
FT   mRNA            complement(join(14802345..14802476,14804260..14804307,
FT                   14809493..14809587,14809825..14809921,14812968..14813228))
FT                   /gene="AW049829"
FT                   /locus_tag="mCG_3284"
FT                   /product="expressed sequence AW049829, transcript variant
FT                   mCT179880"
FT                   /note="gene_id=mCG3284.2 transcript_id=mCT179880.0 created
FT                   on 07-FEB-2003"
FT   CDS             complement(join(14802385..14802476,14804260..14804307,
FT                   14808174..14808318,14809498..14809587,14809825..14809921,
FT                   14812968..14813200))
FT                   /codon_start=1
FT                   /gene="AW049829"
FT                   /locus_tag="mCG_3284"
FT                   /product="expressed sequence AW049829, isoform CRA_b"
FT                   /note="gene_id=mCG3284.2 transcript_id=mCT2297.2
FT                   protein_id=mCP21621.1 isoform=CRA_b"
FT                   /protein_id="EDL20000.1"
FT                   IEEKIKLSKTPL"
FT   CDS             complement(join(14804304..14804307,14809493..14809587,
FT                   14809825..14809921,14812968..14813200))
FT                   /codon_start=1
FT                   /gene="AW049829"
FT                   /locus_tag="mCG_3284"
FT                   /product="expressed sequence AW049829, isoform CRA_a"
FT                   /note="gene_id=mCG3284.2 transcript_id=mCT179880.0
FT                   protein_id=mCP102802.0 isoform=CRA_a"
FT                   /protein_id="EDL19999.1"
FT   assembly_gap    14806591..14806610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14813473..14847792
FT                   /gene="Chek2"
FT                   /locus_tag="mCG_129534"
FT                   /note="gene_id=mCG129534.1"
FT   mRNA            join(<14813473..14813520,14813884..14814013,
FT                   14814679..14815016,14822502..14822626,14822743..14822890,
FT                   14829732..14829842,14832324..14832377,14834878..14834939,
FT                   14837380..14837479,14839601..14839687,14840342..14840505,
FT                   14840993..14841108,14842063..14842148,14846073..14846153,
FT                   14847526..14847792)
FT                   /gene="Chek2"
FT                   /locus_tag="mCG_129534"
FT                   /product="CHK2 checkpoint homolog (S. pombe), transcript
FT                   variant mCT176837"
FT                   /note="gene_id=mCG129534.1 transcript_id=mCT176837.0
FT                   created on 03-DEC-2002"
FT   mRNA            join(<14813486..14813520,14814679..14815016,
FT                   14822502..14822626,14822743..14822890,14829732..14829842,
FT                   14832324..14832377,14834878..14834939,14837380..14837479,
FT                   14839601..14839687,14840342..14840505,14840993..14841108,
FT                   14842063..14842148,14846073..14846153,14847526..14847792)
FT                   /gene="Chek2"
FT                   /locus_tag="mCG_129534"
FT                   /product="CHK2 checkpoint homolog (S. pombe), transcript
FT                   variant mCT130847"
FT                   /note="gene_id=mCG129534.1 transcript_id=mCT130847.1
FT                   created on 03-DEC-2002"
FT   CDS             join(<14822849..14822890,14829732..14829842,
FT                   14832324..14832377,14834878..14834939,14837380..14837479,
FT                   14839601..14839687,14840342..14840505,14840993..14841108,
FT                   14842063..14842148,14846073..14846153,14847526..14847612)
FT                   /codon_start=1
FT                   /gene="Chek2"
FT                   /locus_tag="mCG_129534"
FT                   /product="CHK2 checkpoint homolog (S. pombe), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG129534.1 transcript_id=mCT130847.1
FT                   protein_id=mCP63271.0 isoform=CRA_a"
FT                   /protein_id="EDL19997.1"
FT   CDS             join(<14822849..14822890,14829732..14829842,
FT                   14832324..14832377,14834878..14834939,14837380..14837479,
FT                   14839601..14839687,14840342..14840505,14840993..14841108,
FT                   14842063..14842148,14846073..14846153,14847526..14847612)
FT                   /codon_start=1
FT                   /gene="Chek2"
FT                   /locus_tag="mCG_129534"
FT                   /product="CHK2 checkpoint homolog (S. pombe), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG129534.1 transcript_id=mCT176837.0
FT                   protein_id=mCP99759.0 isoform=CRA_a"
FT                   /protein_id="EDL19998.1"
FT   assembly_gap    14823738..14824066
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    14831522..14831560
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    14833011..14833471
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    14835371..14836873
FT                   /estimated_length=1503
FT                   /gap_type="unknown"
FT   assembly_gap    14853139..14853269
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            <14853894..>15064985
FT                   /locus_tag="mCG_129542"
FT                   /note="gene_id=mCG129542.1"
FT   mRNA            join(<14853894..14854082,14866962..14867240,
FT                   15056358..15056505,15064947..>15064985)
FT                   /locus_tag="mCG_129542"
FT                   /product="mCG129542, transcript variant mCT179072"
FT                   /note="gene_id=mCG129542.1 transcript_id=mCT179072.0
FT                   created on 20-JAN-2003"
FT   CDS             join(<14853894..14854082,14866962..14867240,
FT                   15056358..15056505,15064947..>15064985)
FT                   /codon_start=1
FT                   /locus_tag="mCG_129542"
FT                   /product="mCG129542, isoform CRA_b"
FT                   /note="gene_id=mCG129542.1 transcript_id=mCT179072.0
FT                   protein_id=mCP101994.0 isoform=CRA_b"
FT                   /protein_id="EDL19996.1"
FT   mRNA            join(<14853915..14854082,14866962..14867240,
FT                   14886593..14887704)
FT                   /locus_tag="mCG_129542"
FT                   /product="mCG129542, transcript variant mCT130855"
FT                   /note="gene_id=mCG129542.1 transcript_id=mCT130855.0
FT                   created on 20-JAN-2003"
FT   CDS             join(<14853915..14854082,14866962..14867240,
FT                   14886593..14886637)
FT                   /codon_start=1
FT                   /locus_tag="mCG_129542"
FT                   /product="mCG129542, isoform CRA_a"
FT                   /note="gene_id=mCG129542.1 transcript_id=mCT130855.0
FT                   protein_id=mCP63311.0 isoform=CRA_a"
FT                   /protein_id="EDL19995.1"
FT                   "
FT   assembly_gap    14869513..14869696
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    14877949..14878250
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    14880411..14880430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14881633..14882279
FT                   /estimated_length=647
FT                   /gap_type="unknown"
FT   assembly_gap    14896413..14896432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14899853..14899951
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    14928782..14928801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14950690..14950991
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    14973682..14973701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14997369..14997388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14998113..14998173
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    15018991..15019010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15032806..15033514
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    15045026..15045045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15068666..15069762
FT                   /estimated_length=1097
FT                   /gap_type="unknown"
FT   assembly_gap    15088092..15088111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15096069..15096466
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    15103548..15103661
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            <15144282..15248368
FT                   /gene="Ttc28"
FT                   /locus_tag="mCG_129538"
FT                   /note="gene_id=mCG129538.1"
FT   mRNA            join(<15144282..15144792,15184348..15185689,
FT                   15186796..15187319,15190548..15190657,15192252..15192381,
FT                   15194448..15194666,15196675..15196840,15227192..15227332,
FT                   15231852..15231996,15236878..15237057,15237500..15238220,
FT                   15239192..15239316,15240680..15240911,15241396..15241472,
FT                   15242602..15242625,15243494..15243623,15244668..15244775,
FT                   15245715..15248368)
FT                   /gene="Ttc28"
FT                   /locus_tag="mCG_129538"
FT                   /product="tetratricopeptide repeat domain 28"
FT                   /note="gene_id=mCG129538.1 transcript_id=mCT130851.1
FT                   created on 20-JAN-2003"
FT   CDS             join(<15144282..15144792,15184348..15185689,
FT                   15186796..15187319,15190548..15190657,15192252..15192381,
FT                   15194448..15194666,15196675..15196840,15227192..15227332,
FT                   15231852..15231996,15236878..15237057,15237500..15238220,
FT                   15239192..15239316,15240680..15240911,15241396..15241472,
FT                   15242602..15242625,15243494..15243623,15244668..15244775,
FT                   15245715..15247270)
FT                   /codon_start=1
FT                   /gene="Ttc28"
FT                   /locus_tag="mCG_129538"
FT                   /product="tetratricopeptide repeat domain 28"
FT                   /note="gene_id=mCG129538.1 transcript_id=mCT130851.1
FT                   protein_id=mCP63375.1"
FT                   /protein_id="EDL19994.1"
FT   assembly_gap    15163255..15163560
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    15166987..15167006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15196019..15196038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15248687..15248706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <15249250..15249910
FT                   /locus_tag="mCG_3276"
FT                   /note="gene_id=mCG3276.1"
FT   mRNA            <15249250..15249910
FT                   /locus_tag="mCG_3276"
FT                   /product="mCG3276"
FT                   /note="gene_id=mCG3276.1 transcript_id=mCT2292.1 created on
FT                   02-DEC-2002"
FT   CDS             <15249250..15249507
FT                   /codon_start=1
FT                   /locus_tag="mCG_3276"
FT                   /product="mCG3276"
FT                   /note="gene_id=mCG3276.1 transcript_id=mCT2292.1
FT                   protein_id=mCP21610.0"
FT                   /protein_id="EDL19993.1"
FT   assembly_gap    15252436..15256448
FT                   /estimated_length=4013
FT                   /gap_type="unknown"
FT   assembly_gap    15257609..15257628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15258713..15258949
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    15260917..15261281
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    15265317..15265336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15299474..15357190
FT                   /gene="Pitpnb"
FT                   /locus_tag="mCG_3273"
FT                   /note="gene_id=mCG3273.2"
FT   mRNA            join(15299474..15299553,15304218..15304248,
FT                   15307005..15307150,15315212..15315311,15316510..15316584,
FT                   15318232..15318315,15340137..15340214,15349077..15349187,
FT                   15351872..15351994,15354404..15354488,15355387..15357190)
FT                   /gene="Pitpnb"
FT                   /locus_tag="mCG_3273"
FT                   /product="phosphatidylinositol transfer protein, beta"
FT                   /note="gene_id=mCG3273.2 transcript_id=mCT2303.2 created on
FT                   02-DEC-2002"
FT   CDS             join(15299534..15299553,15304218..15304248,
FT                   15307005..15307150,15315212..15315311,15316510..15316584,
FT                   15318232..15318315,15340137..15340214,15349077..15349187,
FT                   15351872..15351994,15354404..15354451)
FT                   /codon_start=1
FT                   /gene="Pitpnb"
FT                   /locus_tag="mCG_3273"
FT                   /product="phosphatidylinositol transfer protein, beta"
FT                   /note="gene_id=mCG3273.2 transcript_id=mCT2303.2
FT                   protein_id=mCP21604.2"
FT                   /protein_id="EDL19992.1"
FT   assembly_gap    15323298..15323451
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    15343903..15343922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15386139..15386196
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15399327..15399346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15414950..15415265
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    15429833..15430509
FT                   /estimated_length=677
FT                   /gap_type="unknown"
FT   assembly_gap    15432293..15432754
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    15436438..15437670
FT                   /estimated_length=1233
FT                   /gap_type="unknown"
FT   assembly_gap    15449550..15449640
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    15476989..15477023
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    15499888..15500221
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    15518690..15518709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15524548..15525717
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    15526520..15526719
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    15537954..15537973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15542680..15542911
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    15544229..15544483
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    15545744..15546351
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    15547594..15547624
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <15547765..15571322
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /note="gene_id=mCG1030678.1"
FT   mRNA            join(<15547765..15547846,15548026..15548213,
FT                   15548764..15548853,15552176..15554287)
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, transcript variant
FT                   mCT179833"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT179833.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(<15547897..15548213,15548764..15548853,
FT                   15570504..15570857,15571138..15571322)
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, transcript variant
FT                   mCT148382"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT148382.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<15548059..15548213,15548764..15548853,
FT                   15570504..15570624)
FT                   /codon_start=1
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, isoform CRA_a"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT148382.0
FT                   protein_id=mCP62370.0 isoform=CRA_a"
FT                   /protein_id="EDL19989.1"
FT                   EDMLKRREKPAGVHLRG"
FT   CDS             join(<15548059..15548213,15548764..15548853,
FT                   15552176..15552329)
FT                   /codon_start=1
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, isoform CRA_b"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT179833.0
FT                   protein_id=mCP102756.0 isoform=CRA_b"
FT                   /protein_id="EDL19990.1"
FT   mRNA            join(<15548091..15548213,15548522..15548639,
FT                   15548764..15548853,15552176..15552546)
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, transcript variant
FT                   mCT179834"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT179834.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<15548560..15548639,15548764..15548853,
FT                   15552176..15552329)
FT                   /codon_start=1
FT                   /gene="C130026L21Rik"
FT                   /locus_tag="mCG_1030678"
FT                   /product="RIKEN cDNA C130026L21, isoform CRA_c"
FT                   /note="gene_id=mCG1030678.1 transcript_id=mCT179834.0
FT                   protein_id=mCP102755.0 isoform=CRA_c"
FT                   /protein_id="EDL19991.1"
FT                   LHS"
FT   assembly_gap    15555162..15555373
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    15556342..15556645
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    15568441..15568482
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    15581596..15583087
FT                   /estimated_length=1492
FT                   /gap_type="unknown"
FT   assembly_gap    15586389..15586487
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    15596819..15596838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15621032..15621051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15652625..15652843
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    15655984..15656638
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    15668471..15668645
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    15676173..15676338
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            complement(<15701092..>15728766)
FT                   /gene="E130006D01Rik"
FT                   /locus_tag="mCG_1030676"
FT                   /note="gene_id=mCG1030676.1"
FT   mRNA            complement(join(<15701092..15701299,15714572..15714722,
FT                   15728688..>15728766))
FT                   /gene="E130006D01Rik"
FT                   /locus_tag="mCG_1030676"
FT                   /product="RIKEN cDNA E130006D01"
FT                   /note="gene_id=mCG1030676.1 transcript_id=mCT148380.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(<15701092..15701299,15714572..>15714683))
FT                   /codon_start=1
FT                   /gene="E130006D01Rik"
FT                   /locus_tag="mCG_1030676"
FT                   /product="RIKEN cDNA E130006D01"
FT                   /note="gene_id=mCG1030676.1 transcript_id=mCT148380.1
FT                   protein_id=mCP62343.0"
FT                   /protein_id="EDL19988.1"
FT                   NR"
FT   assembly_gap    15705239..15706741
FT                   /estimated_length=1503
FT                   /gap_type="unknown"
FT   assembly_gap    15710760..15710846
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    15723975..15723994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15741771..15741790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15744070..15744128
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    15746719..15746738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15748763..15748782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15753409..15753839
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    15755505..15762598
FT                   /estimated_length=7094
FT                   /gap_type="unknown"
FT   gene            15765220..15770103
FT                   /locus_tag="mCG_1030674"
FT                   /note="gene_id=mCG1030674.1"
FT   mRNA            join(15765220..15765375,15769793..15770103)
FT                   /locus_tag="mCG_1030674"
FT                   /product="mCG1030674, transcript variant mCT148378"
FT                   /note="gene_id=mCG1030674.1 transcript_id=mCT148378.1
FT                   created on 13-MAR-2003"
FT   mRNA            join(15765220..15765375,15769796..15770020)
FT                   /locus_tag="mCG_1030674"
FT                   /product="mCG1030674, transcript variant mCT181165"
FT                   /note="gene_id=mCG1030674.1 transcript_id=mCT181165.0
FT                   created on 13-MAR-2003"
FT   CDS             join(15765373..15765375,15769793..15769879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030674"
FT                   /product="mCG1030674, isoform CRA_a"
FT                   /note="gene_id=mCG1030674.1 transcript_id=mCT148378.1
FT                   protein_id=mCP62318.1 isoform=CRA_a"
FT                   /protein_id="EDL19986.1"
FT                   /translation="MQDCTRRSVSLVDPEATSLFLVVPNRAQG"
FT   CDS             join(15765373..15765375,15769796..15769879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030674"
FT                   /product="mCG1030674, isoform CRA_b"
FT                   /note="gene_id=mCG1030674.1 transcript_id=mCT181165.0
FT                   protein_id=mCP104087.0 isoform=CRA_b"
FT                   /protein_id="EDL19987.1"
FT                   /translation="MDCTRRSVSLVDPEATSLFLVVPNRAQG"
FT   assembly_gap    15768093..15768112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15782777..15782980
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    15800472..15800491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15804908..15806065
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   assembly_gap    15807382..15807992
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    15812268..15812287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15813560..15813579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15817147..15817200
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    15823612..15823631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15825108..15825127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15843481..15843835
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    15846828..15846847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15852459..15852497
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    15868154..15868173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15869562..15869581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15880321..15880508
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    15904076..15904535
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    15916514..15916639
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    15923569..15923889
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    15925816..15926550
FT                   /estimated_length=735
FT                   /gap_type="unknown"
FT   assembly_gap    15928249..15928525
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    15936441..15938149
FT                   /estimated_length=1709
FT                   /gap_type="unknown"
FT   assembly_gap    15940995..15941014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15943802..15945208
FT                   /estimated_length=1407
FT                   /gap_type="unknown"
FT   assembly_gap    15947006..15947083
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    15948171..15948260
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    15960523..15960697
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    15968624..15968693
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    15986430..15986530
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    15990608..15991228
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    16007098..16008025
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    16024312..16024535
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    16048459..16048478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16049704..16049723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16053393..16054028
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    16056568..16056627
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    16061821..16061840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16063303..16063322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16082530..16082599
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    16094332..16094351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16124054..16124614
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   assembly_gap    16142985..16143004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16144528..16144547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16146399..16146418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16148937..16148956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16150287..16154218
FT                   /estimated_length=3932
FT                   /gap_type="unknown"
FT   assembly_gap    16155360..16155379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16159761..16159888
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    16161597..16161894
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    16163947..16164945
FT                   /estimated_length=999
FT                   /gap_type="unknown"
FT   gene            <16167932..16171126
FT                   /locus_tag="mCG_144681"
FT                   /note="gene_id=mCG144681.0"
FT   mRNA            join(<16167932..16168099,16168425..16168582,
FT                   16170668..16170780,16170895..16171126)
FT                   /locus_tag="mCG_144681"
FT                   /product="mCG144681"
FT                   /note="gene_id=mCG144681.0 transcript_id=mCT184105.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<16168575..16168582,16170668..16170780,
FT                   16170895..16170944)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144681"
FT                   /product="mCG144681"
FT                   /note="gene_id=mCG144681.0 transcript_id=mCT184105.0
FT                   protein_id=mCP105418.0"
FT                   /protein_id="EDL19985.1"
FT                   PLNPSLASSKR"
FT   assembly_gap    16173686..16174440
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   gene            complement(16179097..16189852)
FT                   /locus_tag="mCG_128631"
FT                   /note="gene_id=mCG128631.1"
FT   mRNA            complement(join(16179097..16181130,16181478..16181574,
FT                   16181820..16182767,16185101..16185249,16188956..16189079,
FT                   16189210..16189257,16189511..>16189847))
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, transcript variant mCT129931"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT129931.1
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(16180962..16181130,16181478..16181574,
FT                   16181820..16182767,16185101..16185249,16188956..16189115,
FT                   16189202..16189257,16189511..16189852))
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, transcript variant mCT179840"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT179840.0
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(16182553..16182748,16185202..16185249,
FT                   16188956..16189079,16189210..16189257,16189511..>16189831))
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, transcript variant mCT179841"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT179841.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(16182589..16182748,16185202..16185249,
FT                   16188956..16189079,16189210..16189257,16189511..>16189679))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, isoform CRA_b"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT179841.0
FT                   protein_id=mCP102762.0 isoform=CRA_b"
FT                   /protein_id="EDL19983.1"
FT   CDS             complement(join(16182589..16182767,16185101..16185249,
FT                   16188956..16189079,16189210..16189257,16189511..>16189679))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, isoform CRA_c"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT129931.1
FT                   protein_id=mCP63272.1 isoform=CRA_c"
FT                   /protein_id="EDL19984.1"
FT                   "
FT   CDS             complement(join(16182589..16182767,16185101..16185249,
FT                   16188956..16189115,16189202..16189253))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128631"
FT                   /product="mCG128631, isoform CRA_a"
FT                   /note="gene_id=mCG128631.1 transcript_id=mCT179840.0
FT                   protein_id=mCP102763.0 isoform=CRA_a"
FT                   /protein_id="EDL19982.1"
FT                   KGSALESPTGGRMAVL"
FT   assembly_gap    16198333..16198836
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    16200709..16201004
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    16205446..16205465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16207480..16212745)
FT                   /gene="Cryba4"
FT                   /locus_tag="mCG_3484"
FT                   /note="gene_id=mCG3484.1"
FT   mRNA            complement(join(16207480..16207765,16209120..16209262,
FT                   16210116..16210257,16211966..16212084,16212694..16212745))
FT                   /gene="Cryba4"
FT                   /locus_tag="mCG_3484"
FT                   /product="crystallin, beta A4"
FT                   /note="gene_id=mCG3484.1 transcript_id=mCT2470.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(16207618..16207765,16209120..16209262,
FT                   16210116..16210257,16211966..16212084,16212694..16212732))
FT                   /codon_start=1
FT                   /gene="Cryba4"
FT                   /locus_tag="mCG_3484"
FT                   /product="crystallin, beta A4"
FT                   /note="gene_id=mCG3484.1 transcript_id=mCT2470.1
FT                   protein_id=mCP21642.2"
FT                   /protein_id="EDL19981.1"
FT   gene            16216786..16230532
FT                   /gene="Crybb1"
FT                   /locus_tag="mCG_3483"
FT                   /note="gene_id=mCG3483.1"
FT   mRNA            join(16216786..16216812,16218338..16218522,
FT                   16220201..16220319,16224461..16224593,16228265..16228407,
FT                   16230267..16230532)
FT                   /gene="Crybb1"
FT                   /locus_tag="mCG_3483"
FT                   /product="crystallin, beta B1, transcript variant mCT2469"
FT                   /note="gene_id=mCG3483.1 transcript_id=mCT2469.1 created on
FT                   07-FEB-2003"
FT   mRNA            join(16216810..16216915,16218338..16218522,
FT                   16220201..16220319,16224461..16224593,16228265..16228407,
FT                   16230267..16230528)
FT                   /gene="Crybb1"
FT                   /locus_tag="mCG_3483"
FT                   /product="crystallin, beta B1, transcript variant
FT                   mCT176852"
FT                   /note="gene_id=mCG3483.1 transcript_id=mCT176852.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(16218349..16218522,16220201..16220319,
FT                   16224461..16224593,16228265..16228407,16230267..16230450)
FT                   /codon_start=1
FT                   /gene="Crybb1"
FT                   /locus_tag="mCG_3483"
FT                   /product="crystallin, beta B1, isoform CRA_a"
FT                   /note="gene_id=mCG3483.1 transcript_id=mCT176852.0
FT                   protein_id=mCP99774.0 isoform=CRA_a"
FT                   /protein_id="EDL19979.1"
FT   CDS             join(16218349..16218522,16220201..16220319,
FT                   16224461..16224593,16228265..16228407,16230267..16230450)
FT                   /codon_start=1
FT                   /gene="Crybb1"
FT                   /locus_tag="mCG_3483"
FT                   /product="crystallin, beta B1, isoform CRA_a"
FT                   /note="gene_id=mCG3483.1 transcript_id=mCT2469.1
FT                   protein_id=mCP21640.2 isoform=CRA_a"
FT                   /protein_id="EDL19980.1"
FT   assembly_gap    16222058..16222077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16237661..16276571
FT                   /gene="Tpst2"
FT                   /locus_tag="mCG_3482"
FT                   /note="gene_id=mCG3482.3"
FT   mRNA            join(16237661..16237726,16265170..16265241,
FT                   16268835..16269746,16270958..16271156,16272951..16273001,
FT                   16274457..16274505,16276106..16276571)
FT                   /gene="Tpst2"
FT                   /locus_tag="mCG_3482"
FT                   /product="protein-tyrosine sulfotransferase 2, transcript
FT                   variant mCT2477"
FT                   /note="gene_id=mCG3482.3 transcript_id=mCT2477.2 created on
FT                   01-DEC-2004"
FT   mRNA            join(16237661..16237726,16268835..16269746,
FT                   16270958..16271156,16272951..16273001,16274457..16274505,
FT                   16276106..16276571)
FT                   /gene="Tpst2"
FT                   /locus_tag="mCG_3482"
FT                   /product="protein-tyrosine sulfotransferase 2, transcript
FT                   variant mCT191384"
FT                   /note="gene_id=mCG3482.3 transcript_id=mCT191384.1 created
FT                   on 01-DEC-2004"
FT   assembly_gap    16237997..16238156
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    16250087..16250420
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    16252492..16252511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16268866..16269746,16270958..16271156,
FT                   16272951..16273001,16274457..16274498)
FT                   /codon_start=1
FT                   /gene="Tpst2"
FT                   /locus_tag="mCG_3482"
FT                   /product="protein-tyrosine sulfotransferase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3482.3 transcript_id=mCT2477.2
FT                   protein_id=mCP21638.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TQN1"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1309516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQN1"
FT                   /protein_id="EDL19977.1"
FT   CDS             join(16268866..16269746,16270958..16271156,
FT                   16272951..16273001,16274457..16274498)
FT                   /codon_start=1
FT                   /gene="Tpst2"
FT                   /locus_tag="mCG_3482"
FT                   /product="protein-tyrosine sulfotransferase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3482.3 transcript_id=mCT191384.1
FT                   protein_id=mCP112337.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TQN1"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1309516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQN1"
FT                   /protein_id="EDL19978.1"
FT   assembly_gap    16283309..16283434
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    16287117..16287281
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            16287742..16299445
FT                   /gene="Tfip11"
FT                   /locus_tag="mCG_3481"
FT                   /note="gene_id=mCG3481.1"
FT   mRNA            join(16287742..16287846,16288858..16289043,
FT                   16289335..16289555,16290739..16290892,16291120..16291276,
FT                   16292464..16292591,16293241..16293393,16294337..16294864,
FT                   16294948..16295054,16295690..16295858,16296233..16296476,
FT                   16296946..16297088,16297389..16297554,16298360..16299445)
FT                   /gene="Tfip11"
FT                   /locus_tag="mCG_3481"
FT                   /product="tuftelin interacting protein 11"
FT                   /note="gene_id=mCG3481.1 transcript_id=mCT2472.1 created on
FT                   02-DEC-2002"
FT   CDS             join(16289344..16289555,16290739..16290892,
FT                   16291120..16291276,16292464..16292591,16293241..16293393,
FT                   16294337..16294864,16294948..16295054,16295690..16295858,
FT                   16296233..16296476,16296946..16297088,16297389..16297554,
FT                   16298360..16298715)
FT                   /codon_start=1
FT                   /gene="Tfip11"
FT                   /locus_tag="mCG_3481"
FT                   /product="tuftelin interacting protein 11"
FT                   /note="gene_id=mCG3481.1 transcript_id=mCT2472.1
FT                   protein_id=mCP21626.1"
FT                   /db_xref="GOA:Q3TTV6"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR022159"
FT                   /db_xref="InterPro:IPR022783"
FT                   /db_xref="InterPro:IPR024933"
FT                   /db_xref="MGI:MGI:1930075"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTV6"
FT                   /protein_id="EDL19976.1"
FT   gene            complement(16298764..16304355)
FT                   /locus_tag="mCG_3486"
FT                   /note="gene_id=mCG3486.2"
FT   mRNA            complement(join(16298764..16299115,16299376..16299421,
FT                   16299692..16299941,16301049..16301147,16301227..16301453,
FT                   16302426..16302466,16304205..16304354))
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, transcript variant mCT179086"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT179086.0 created
FT                   on 20-JAN-2003"
FT   mRNA            complement(join(16298765..16299115,16299376..16299421,
FT                   16299692..16299846,16301049..16301147,16301227..16301453,
FT                   16302426..16302466,16304205..16304355))
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, transcript variant mCT2468"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT2468.1 created on
FT                   20-JAN-2003"
FT   mRNA            complement(join(16298766..16299115,16299350..16299421,
FT                   16299692..16299846,16301049..16301147,16301227..16301453,
FT                   16302426..16302466,16304205..16304354))
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, transcript variant mCT179085"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT179085.0 created
FT                   on 20-JAN-2003"
FT   CDS             complement(join(16298780..16299115,16299376..16299421,
FT                   16299692..16299846,16301049..16301147,16301227..16301453,
FT                   16302426..16302466,16304205..16304353))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, isoform CRA_c"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT2468.1
FT                   protein_id=mCP21647.1 isoform=CRA_c"
FT                   /protein_id="EDL19975.1"
FT                   HPALVAWSPK"
FT   CDS             complement(join(16299109..16299115,16299350..16299421,
FT                   16299692..16299846,16301049..16301147,16301227..16301453,
FT                   16302426..16302466,16304205..16304353))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, isoform CRA_a"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT179085.0
FT                   protein_id=mCP102007.0 isoform=CRA_a"
FT                   /protein_id="EDL19973.1"
FT   CDS             complement(join(16299870..16299941,16301049..16301147,
FT                   16301227..16301453,16302426..16302466,16304205..16304353))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3486"
FT                   /product="mCG3486, isoform CRA_b"
FT                   /note="gene_id=mCG3486.2 transcript_id=mCT179086.0
FT                   protein_id=mCP102008.0 isoform=CRA_b"
FT                   /protein_id="EDL19974.1"
FT   gene            16304413..16339771
FT                   /gene="Hps4"
FT                   /locus_tag="mCG_128624"
FT                   /note="gene_id=mCG128624.1"
FT   mRNA            join(16304413..16304493,16305374..16306378,
FT                   16307924..16308014,16310639..16310782,16324466..16324573,
FT                   16324903..16325019,16325878..16325972,16328259..16328331,
FT                   16330289..16330325,16330808..16330904,16331299..16332097,
FT                   16336237..16336369,16336710..16336818,16339316..16339771)
FT                   /gene="Hps4"
FT                   /locus_tag="mCG_128624"
FT                   /product="Hermansky-Pudlak syndrome 4 homolog (human),
FT                   transcript variant mCT129928"
FT                   /note="gene_id=mCG128624.1 transcript_id=mCT129928.1
FT                   created on 02-DEC-2002"
FT   mRNA            join(<16304424..16304452,16305871..16306378,
FT                   16307924..16308014,16310639..16310782,16324466..16324573,
FT                   16324903..16325019,16325878..16325972,16328259..16328331,
FT                   16330289..16330325,16330808..16332097,16336237..16336369,
FT                   16336710..16336818,16339316..16339769)
FT                   /gene="Hps4"
FT                   /locus_tag="mCG_128624"
FT                   /product="Hermansky-Pudlak syndrome 4 homolog (human),
FT                   transcript variant mCT191429"
FT                   /note="gene_id=mCG128624.1 transcript_id=mCT191429.0
FT                   created on 09-MAR-2004"
FT   CDS             join(16306338..16306378,16307924..16308014,
FT                   16310639..16310782,16324466..16324573,16324903..16325019,
FT                   16325878..16325972,16328259..16328331,16330289..16330325,
FT                   16330808..16330904,16331299..16332097,16336237..16336369,
FT                   16336710..16336818,16339316..16339487)
FT                   /codon_start=1
FT                   /gene="Hps4"
FT                   /locus_tag="mCG_128624"
FT                   /product="Hermansky-Pudlak syndrome 4 homolog (human),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG128624.1 transcript_id=mCT129928.1
FT                   protein_id=mCP62708.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q541V2"
FT                   /db_xref="InterPro:IPR026091"
FT                   /db_xref="MGI:MGI:2177742"
FT                   /db_xref="UniProtKB/TrEMBL:Q541V2"
FT                   /protein_id="EDL19971.1"
FT   assembly_gap    16309980..16310017
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    16329006..16329061
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   CDS             join(<16331129..16332097,16336237..16336369,
FT                   16336710..16336818,16339316..16339487)
FT                   /codon_start=1
FT                   /gene="Hps4"
FT                   /locus_tag="mCG_128624"
FT                   /product="Hermansky-Pudlak syndrome 4 homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG128624.1 transcript_id=mCT191429.0
FT                   protein_id=mCP112365.0 isoform=CRA_a"
FT                   /protein_id="EDL19970.1"
FT                   LL"
FT   gene            complement(16335727..>16338996)
FT                   /locus_tag="mCG_146215"
FT                   /note="gene_id=mCG146215.0"
FT   mRNA            complement(join(16335727..16336075,16336188..16336468,
FT                   16338921..>16338996))
FT                   /locus_tag="mCG_146215"
FT                   /product="mCG146215"
FT                   /note="gene_id=mCG146215.0 transcript_id=mCT186318.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(16335811..16336075,16336188..>16336306))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146215"
FT                   /product="mCG146215"
FT                   /note="gene_id=mCG146215.0 transcript_id=mCT186318.0
FT                   protein_id=mCP107407.0"
FT                   /protein_id="EDL19972.1"
FT   gene            complement(16345730..16356613)
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /note="gene_id=mCG3485.2"
FT   mRNA            complement(join(16345730..16347235,16348133..16348246,
FT                   16352532..16353629,16354834..16354957,16355159..16355373,
FT                   16356556..16356613))
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   transcript variant mCT178802"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT178802.0 created
FT                   on 13-MAR-2003"
FT   mRNA            complement(join(16345731..16347235,16348133..16348246,
FT                   16352532..16353629,16355159..16355673))
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   transcript variant mCT2471"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT2471.2 created on
FT                   13-MAR-2003"
FT   mRNA            complement(join(16346816..16347235,16348133..16348246,
FT                   16350977..16351115,16352532..>16352839))
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   transcript variant mCT178801"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT178801.0 created
FT                   on 13-MAR-2003"
FT   CDS             complement(join(16347126..16347235,16348133..16348246,
FT                   16352532..16353339))
FT                   /codon_start=1
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT2471.2
FT                   protein_id=mCP21646.1 isoform=CRA_c"
FT                   /protein_id="EDL19968.1"
FT                   PGR"
FT   CDS             complement(join(16347126..16347235,16348133..16348246,
FT                   16352532..16353339))
FT                   /codon_start=1
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT178802.0
FT                   protein_id=mCP101724.0 isoform=CRA_c"
FT                   /protein_id="EDL19969.1"
FT                   PGR"
FT   CDS             complement(join(16351021..16351115,16352532..>16352838))
FT                   /codon_start=1
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT178801.0
FT                   protein_id=mCP101723.0 isoform=CRA_b"
FT                   /protein_id="EDL19967.1"
FT   mRNA            complement(join(<16353173..16353629,16354453..16354615,
FT                   16354834..16354957,16355159..16355379))
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   transcript variant mCT148371"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT148371.1 created
FT                   on 13-MAR-2003"
FT   CDS             complement(<16353173..16353339)
FT                   /codon_start=1
FT                   /gene="Asphd2"
FT                   /locus_tag="mCG_3485"
FT                   /product="aspartate beta-hydroxylase domain containing 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3485.2 transcript_id=mCT148371.1
FT                   protein_id=mCP62948.1 isoform=CRA_a"
FT                   /protein_id="EDL19966.1"
FT                   VWYCYHVGRE"
FT   assembly_gap    16356040..16356347
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    16365313..16366279
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    16377884..16377903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16383360..16540757)
FT                   /locus_tag="mCG_3478"
FT                   /note="gene_id=mCG3478.2"
FT   mRNA            complement(join(16383360..16383877,16386462..16386564,
FT                   16387451..16387559,16388563..16388595,16390213..16390407,
FT                   16398206..16398397,16400325..16400519,16402740..16402936,
FT                   16423094..16423232,16424802..16424996,16426670..16426836,
FT                   16428043..16428208,16433694..16433879,16434828..16435020,
FT                   16435515..16435648,16437104..16437661,16540330..16540613,
FT                   16540646..16540757))
FT                   /locus_tag="mCG_3478"
FT                   /product="mCG3478"
FT                   /note="gene_id=mCG3478.2 transcript_id=mCT2473.2 created on
FT                   04-FEB-2003"
FT   CDS             complement(join(16383848..16383877,16386462..16386564,
FT                   16387451..16387559,16388563..16388595,16390213..16390407,
FT                   16398206..16398397,16400325..16400519,16402740..16402936,
FT                   16423094..16423232,16424802..16424996,16426670..16426836,
FT                   16428043..16428208,16433694..16433879,16434828..16435020,
FT                   16435515..16435648,16437104..16437661,16540330..16540426))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3478"
FT                   /product="mCG3478"
FT                   /note="gene_id=mCG3478.2 transcript_id=mCT2473.2
FT                   protein_id=mCP21618.2"
FT                   /db_xref="GOA:A0A0R4J0Y4"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="MGI:MGI:1935121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0Y4"
FT                   /protein_id="EDL19965.1"
FT   assembly_gap    16397681..16398074
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    16425792..16426096
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    16458849..16459036
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    16460886..16461135
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    16462781..16462930
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    16466176..16466195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16474546..16474565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16482484..16482503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16485462..16485481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16487529..16487548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16489196..16489215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16490389..16491095
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    16493073..16493092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16495359..16496542
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   assembly_gap    16497809..16497828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16509358..16509401
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    16511059..16511390
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    16517122..16517141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16528002..16528259
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    16534868..16534916
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    16540614..16540643
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    16542728..16542747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16545327..16552398)
FT                   /locus_tag="mCG_15902"
FT                   /note="gene_id=mCG15902.2"
FT   mRNA            complement(join(16545327..16545844,16546431..16546605,
FT                   16548331..16548495,16548703..16548809,16552275..16552398))
FT                   /locus_tag="mCG_15902"
FT                   /product="mCG15902, transcript variant mCT13955"
FT                   /note="gene_id=mCG15902.2 transcript_id=mCT13955.2 created
FT                   on 17-JAN-2003"
FT   mRNA            complement(join(16545416..16545844,16546431..16546574,
FT                   16548331..16548495,16548703..16548809,16552275..16552398))
FT                   /locus_tag="mCG_15902"
FT                   /product="mCG15902, transcript variant mCT178788"
FT                   /note="gene_id=mCG15902.2 transcript_id=mCT178788.0 created
FT                   on 17-JAN-2003"
FT   CDS             complement(16545588..16545812)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15902"
FT                   /product="mCG15902, isoform CRA_a"
FT                   /note="gene_id=mCG15902.2 transcript_id=mCT13955.2
FT                   protein_id=mCP12412.2 isoform=CRA_a"
FT                   /protein_id="EDL19963.1"
FT   CDS             complement(16545588..16545812)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15902"
FT                   /product="mCG15902, isoform CRA_a"
FT                   /note="gene_id=mCG15902.2 transcript_id=mCT178788.0
FT                   protein_id=mCP101710.0 isoform=CRA_a"
FT                   /protein_id="EDL19964.1"
FT   assembly_gap    16552887..16553089
FT                   /estimated_length=203
FT                   /gap_type="unknow